


| Basic Information | |
|---|---|
| Family ID | F051860 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 143 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MKLSINEVWGQVYLLPFIKFTHTRQLNGDLELIIGYLKWEIVIGI |
| Number of Associated Samples | 123 |
| Number of Associated Scaffolds | 143 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 42.75 % |
| % of genes near scaffold ends (potentially truncated) | 34.27 % |
| % of genes from short scaffolds (< 2000 bps) | 69.23 % |
| Associated GOLD sequencing projects | 121 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (61.538 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water (9.790 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.469 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (42.657 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 43.84% Coil/Unstructured: 56.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 143 Family Scaffolds |
|---|---|---|
| PF00149 | Metallophos | 9.09 |
| PF00383 | dCMP_cyt_deam_1 | 8.39 |
| PF12850 | Metallophos_2 | 5.59 |
| PF01223 | Endonuclease_NS | 2.10 |
| PF13585 | CHU_C | 2.10 |
| PF08406 | CbbQ_C | 2.10 |
| PF00156 | Pribosyltran | 1.40 |
| PF02195 | ParBc | 1.40 |
| PF01471 | PG_binding_1 | 1.40 |
| PF00085 | Thioredoxin | 1.40 |
| PF07728 | AAA_5 | 0.70 |
| PF01569 | PAP2 | 0.70 |
| PF05721 | PhyH | 0.70 |
| PF12705 | PDDEXK_1 | 0.70 |
| PF00535 | Glycos_transf_2 | 0.70 |
| PF00908 | dTDP_sugar_isom | 0.70 |
| PF01832 | Glucosaminidase | 0.70 |
| PF03016 | Exostosin | 0.70 |
| PF01048 | PNP_UDP_1 | 0.70 |
| PF13715 | CarbopepD_reg_2 | 0.70 |
| PF10504 | DUF2452 | 0.70 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.70 |
| PF00574 | CLP_protease | 0.70 |
| COG ID | Name | Functional Category | % Frequency in 143 Family Scaffolds |
|---|---|---|---|
| COG0714 | MoxR-like ATPase | General function prediction only [R] | 2.10 |
| COG1864 | DNA/RNA endonuclease G, NUC1 | Nucleotide transport and metabolism [F] | 2.10 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.40 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 1.40 |
| COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 0.70 |
| COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 0.70 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.70 |
| COG1898 | dTDP-4-dehydrorhamnose 3,5-epimerase or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 0.70 |
| COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 0.70 |
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.70 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 61.54 % |
| All Organisms | root | All Organisms | 38.46 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000385|PR_CR_10_Liq_1_inCRDRAFT_1060696 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 628 | Open in IMG/M |
| 3300001968|GOS2236_1066348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 6194 | Open in IMG/M |
| 3300002132|M2t6BS2_1099441 | All Organisms → Viruses → Predicted Viral | 1781 | Open in IMG/M |
| 3300002274|B570J29581_107505 | Not Available | 668 | Open in IMG/M |
| 3300002835|B570J40625_100004796 | Not Available | 25256 | Open in IMG/M |
| 3300003346|JGI26081J50195_1000562 | Not Available | 15889 | Open in IMG/M |
| 3300003427|JGI26084J50262_1074051 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 741 | Open in IMG/M |
| 3300003986|Ga0063233_10003320 | All Organisms → cellular organisms → Bacteria | 3237 | Open in IMG/M |
| 3300004240|Ga0007787_10004321 | Not Available | 5299 | Open in IMG/M |
| 3300005581|Ga0049081_10133557 | Not Available | 914 | Open in IMG/M |
| 3300005582|Ga0049080_10041048 | Not Available | 1606 | Open in IMG/M |
| 3300005662|Ga0078894_10482640 | Not Available | 1114 | Open in IMG/M |
| 3300005662|Ga0078894_11034708 | Not Available | 705 | Open in IMG/M |
| 3300005805|Ga0079957_1007383 | Not Available | 8643 | Open in IMG/M |
| 3300006752|Ga0098048_1018231 | All Organisms → cellular organisms → Bacteria | 2376 | Open in IMG/M |
| 3300007177|Ga0102978_1295611 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
| 3300007345|Ga0070752_1317830 | Not Available | 590 | Open in IMG/M |
| 3300007538|Ga0099851_1161373 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 831 | Open in IMG/M |
| 3300007541|Ga0099848_1347165 | Not Available | 500 | Open in IMG/M |
| 3300007554|Ga0102820_1069429 | Not Available | 848 | Open in IMG/M |
| 3300007557|Ga0102821_1021854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus | 1722 | Open in IMG/M |
| 3300007609|Ga0102945_1047518 | Not Available | 847 | Open in IMG/M |
| 3300007634|Ga0102901_1193468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
| 3300007681|Ga0102824_1070508 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus | 918 | Open in IMG/M |
| 3300007960|Ga0099850_1039829 | All Organisms → Viruses → Predicted Viral | 2028 | Open in IMG/M |
| 3300008107|Ga0114340_1095541 | Not Available | 1198 | Open in IMG/M |
| 3300008107|Ga0114340_1100234 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1160 | Open in IMG/M |
| 3300008107|Ga0114340_1129708 | Not Available | 961 | Open in IMG/M |
| 3300008108|Ga0114341_10079754 | Not Available | 2036 | Open in IMG/M |
| 3300008110|Ga0114343_1101977 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 992 | Open in IMG/M |
| 3300008113|Ga0114346_1038771 | Not Available | 2453 | Open in IMG/M |
| 3300008116|Ga0114350_1015515 | Not Available | 7200 | Open in IMG/M |
| 3300008116|Ga0114350_1043705 | Not Available | 1676 | Open in IMG/M |
| 3300008120|Ga0114355_1043364 | Not Available | 2111 | Open in IMG/M |
| 3300008120|Ga0114355_1195550 | Not Available | 658 | Open in IMG/M |
| 3300008448|Ga0114876_1063990 | Not Available | 1595 | Open in IMG/M |
| 3300008448|Ga0114876_1079741 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1363 | Open in IMG/M |
| 3300008450|Ga0114880_1169445 | Not Available | 765 | Open in IMG/M |
| 3300009082|Ga0105099_10158446 | Not Available | 1279 | Open in IMG/M |
| 3300009172|Ga0114995_10004634 | All Organisms → cellular organisms → Bacteria | 9119 | Open in IMG/M |
| 3300009420|Ga0114994_10171657 | Not Available | 1466 | Open in IMG/M |
| 3300010296|Ga0129348_1305759 | Not Available | 530 | Open in IMG/M |
| 3300010297|Ga0129345_1090878 | All Organisms → Viruses → Predicted Viral | 1137 | Open in IMG/M |
| 3300012012|Ga0153799_1003517 | Not Available | 4054 | Open in IMG/M |
| 3300013004|Ga0164293_10021078 | Not Available | 5442 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10029304 | Not Available | 3823 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10496920 | Not Available | 743 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10950691 | Not Available | 522 | Open in IMG/M |
| (restricted) 3300013133|Ga0172362_10035604 | Not Available | 3987 | Open in IMG/M |
| 3300013372|Ga0177922_10124620 | Not Available | 878 | Open in IMG/M |
| 3300017716|Ga0181350_1102597 | Not Available | 702 | Open in IMG/M |
| 3300017761|Ga0181356_1039354 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1667 | Open in IMG/M |
| 3300017766|Ga0181343_1056552 | Not Available | 1145 | Open in IMG/M |
| 3300017766|Ga0181343_1058873 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1119 | Open in IMG/M |
| 3300017778|Ga0181349_1010600 | All Organisms → Viruses → Predicted Viral | 3834 | Open in IMG/M |
| 3300017778|Ga0181349_1098438 | Not Available | 1097 | Open in IMG/M |
| 3300017785|Ga0181355_1028613 | Not Available | 2410 | Open in IMG/M |
| 3300017788|Ga0169931_10834779 | Not Available | 588 | Open in IMG/M |
| 3300017818|Ga0181565_10031148 | All Organisms → Viruses → Predicted Viral | 3924 | Open in IMG/M |
| 3300018041|Ga0181601_10206117 | All Organisms → Viruses → Predicted Viral | 1150 | Open in IMG/M |
| 3300018416|Ga0181553_10377608 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 774 | Open in IMG/M |
| 3300018418|Ga0181567_10635976 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 686 | Open in IMG/M |
| 3300020055|Ga0181575_10280804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus | 950 | Open in IMG/M |
| 3300020074|Ga0194113_10752738 | Not Available | 671 | Open in IMG/M |
| 3300020084|Ga0194110_10970924 | Not Available | 500 | Open in IMG/M |
| 3300020109|Ga0194112_10521251 | Not Available | 828 | Open in IMG/M |
| 3300020109|Ga0194112_10725605 | Not Available | 660 | Open in IMG/M |
| 3300020162|Ga0211735_10557728 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1365 | Open in IMG/M |
| 3300020176|Ga0181556_1021013 | All Organisms → Viruses → Predicted Viral | 3921 | Open in IMG/M |
| 3300020178|Ga0181599_1217743 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus | 754 | Open in IMG/M |
| 3300020183|Ga0194115_10032260 | Not Available | 3663 | Open in IMG/M |
| 3300020184|Ga0181573_10416176 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → unclassified Sphingobacteriia → Sphingobacteriia bacterium 28-36-52 | 615 | Open in IMG/M |
| 3300020506|Ga0208091_1000350 | Not Available | 9009 | Open in IMG/M |
| 3300020524|Ga0208858_1030072 | Not Available | 783 | Open in IMG/M |
| 3300020553|Ga0208855_1012850 | Not Available | 1335 | Open in IMG/M |
| 3300020575|Ga0208053_1019505 | Not Available | 1335 | Open in IMG/M |
| 3300020603|Ga0194126_10157930 | Not Available | 1699 | Open in IMG/M |
| 3300021335|Ga0213867_1181004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus | 709 | Open in IMG/M |
| 3300021356|Ga0213858_10249701 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 854 | Open in IMG/M |
| 3300021959|Ga0222716_10142349 | All Organisms → Viruses → Predicted Viral | 1574 | Open in IMG/M |
| 3300021960|Ga0222715_10092578 | Not Available | 1969 | Open in IMG/M |
| 3300021961|Ga0222714_10000408 | Not Available | 50142 | Open in IMG/M |
| 3300021961|Ga0222714_10025426 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 4520 | Open in IMG/M |
| 3300021961|Ga0222714_10136465 | All Organisms → Viruses → Predicted Viral | 1492 | Open in IMG/M |
| 3300021961|Ga0222714_10283338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus | 915 | Open in IMG/M |
| 3300021961|Ga0222714_10463573 | Not Available | 657 | Open in IMG/M |
| 3300021962|Ga0222713_10010113 | Not Available | 8523 | Open in IMG/M |
| 3300021962|Ga0222713_10143111 | All Organisms → Viruses → Predicted Viral | 1659 | Open in IMG/M |
| 3300021962|Ga0222713_10767319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus | 542 | Open in IMG/M |
| 3300021962|Ga0222713_10821501 | Not Available | 517 | Open in IMG/M |
| 3300021963|Ga0222712_10000708 | Not Available | 42631 | Open in IMG/M |
| 3300021963|Ga0222712_10312529 | Not Available | 981 | Open in IMG/M |
| 3300021963|Ga0222712_10479318 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 740 | Open in IMG/M |
| 3300022190|Ga0181354_1017940 | Not Available | 2209 | Open in IMG/M |
| 3300022407|Ga0181351_1164601 | Not Available | 782 | Open in IMG/M |
| 3300022926|Ga0255753_1033945 | All Organisms → Viruses → Predicted Viral | 3212 | Open in IMG/M |
| 3300022929|Ga0255752_10243002 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300023105|Ga0255782_10091257 | All Organisms → Viruses → Predicted Viral | 1629 | Open in IMG/M |
| 3300023110|Ga0255743_10280585 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300024346|Ga0244775_10000558 | Not Available | 45804 | Open in IMG/M |
| 3300024505|Ga0255150_1012678 | Not Available | 1462 | Open in IMG/M |
| 3300024515|Ga0255183_1023076 | Not Available | 1506 | Open in IMG/M |
| 3300024570|Ga0255276_1099726 | Not Available | 774 | Open in IMG/M |
| 3300024865|Ga0256340_1099049 | Not Available | 712 | Open in IMG/M |
| 3300025070|Ga0208667_1014247 | Not Available | 1703 | Open in IMG/M |
| 3300025543|Ga0208303_1065807 | Not Available | 837 | Open in IMG/M |
| 3300025610|Ga0208149_1017786 | All Organisms → Viruses → Predicted Viral | 2058 | Open in IMG/M |
| 3300025640|Ga0209198_1192990 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
| 3300025671|Ga0208898_1042264 | Not Available | 1734 | Open in IMG/M |
| 3300026138|Ga0209951_1016026 | Not Available | 1659 | Open in IMG/M |
| 3300027293|Ga0255132_1026082 | Not Available | 1418 | Open in IMG/M |
| 3300027581|Ga0209651_1207766 | Not Available | 509 | Open in IMG/M |
| 3300027595|Ga0255122_1018581 | Not Available | 1328 | Open in IMG/M |
| 3300027779|Ga0209709_10002170 | Not Available | 17447 | Open in IMG/M |
| 3300027792|Ga0209287_10150950 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 881 | Open in IMG/M |
| 3300027797|Ga0209107_10246671 | Not Available | 860 | Open in IMG/M |
| 3300028025|Ga0247723_1080005 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 862 | Open in IMG/M |
| 3300028103|Ga0255172_1035024 | Not Available | 941 | Open in IMG/M |
| 3300031227|Ga0307928_10305280 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 786 | Open in IMG/M |
| 3300031519|Ga0307488_10019011 | Not Available | 5552 | Open in IMG/M |
| 3300031519|Ga0307488_10076307 | All Organisms → Viruses → Predicted Viral | 2505 | Open in IMG/M |
| 3300031539|Ga0307380_10032925 | Not Available | 5950 | Open in IMG/M |
| 3300031578|Ga0307376_10366602 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 952 | Open in IMG/M |
| 3300031669|Ga0307375_10454307 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 782 | Open in IMG/M |
| 3300031707|Ga0315291_10830946 | Not Available | 800 | Open in IMG/M |
| 3300031758|Ga0315907_10128962 | Not Available | 2154 | Open in IMG/M |
| 3300031787|Ga0315900_10299886 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1332 | Open in IMG/M |
| 3300031857|Ga0315909_10008939 | Not Available | 10910 | Open in IMG/M |
| 3300033418|Ga0316625_102441004 | Not Available | 527 | Open in IMG/M |
| 3300033992|Ga0334992_0003432 | Not Available | 11811 | Open in IMG/M |
| 3300034061|Ga0334987_0497251 | Not Available | 744 | Open in IMG/M |
| 3300034062|Ga0334995_0704979 | Not Available | 568 | Open in IMG/M |
| 3300034072|Ga0310127_063227 | All Organisms → Viruses → Predicted Viral | 1763 | Open in IMG/M |
| 3300034073|Ga0310130_0098673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → unclassified Neisseriaceae → Neisseriaceae bacterium | 877 | Open in IMG/M |
| 3300034102|Ga0335029_0697618 | Not Available | 551 | Open in IMG/M |
| 3300034103|Ga0335030_0238546 | All Organisms → Viruses → Predicted Viral | 1247 | Open in IMG/M |
| 3300034106|Ga0335036_0084028 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 2366 | Open in IMG/M |
| 3300034283|Ga0335007_0348615 | Not Available | 949 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 9.79% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 9.79% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 8.39% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 8.39% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.69% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.99% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.99% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 4.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.50% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 3.50% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.80% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.10% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.10% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.10% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.10% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 2.10% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.40% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.40% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.40% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 1.40% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.40% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.40% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 1.40% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.70% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.70% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.70% |
| Enviromental | Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental | 0.70% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.70% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.70% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.70% |
| Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 0.70% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.70% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.70% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000385 | Marine microbial community from Cabo Rojo, Puerto Rico - PR CR 10% Liquid 1 | Environmental | Open in IMG/M |
| 3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
| 3300002132 | Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t6BS2 (105f) | Environmental | Open in IMG/M |
| 3300002274 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003346 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA | Environmental | Open in IMG/M |
| 3300003427 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA | Environmental | Open in IMG/M |
| 3300003986 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (v2) | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007554 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 | Environmental | Open in IMG/M |
| 3300007557 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 | Environmental | Open in IMG/M |
| 3300007609 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG | Environmental | Open in IMG/M |
| 3300007634 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 | Environmental | Open in IMG/M |
| 3300007681 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753 | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013127 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013133 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2 | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018041 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018418 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020055 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041405US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020184 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101409BT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020524 | Freshwater microbial communities from Lake Mendota, WI - 16NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020553 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020575 | Freshwater microbial communities from Lake Mendota, WI - 20MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020603 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150m | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022926 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG | Environmental | Open in IMG/M |
| 3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
| 3300023105 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG | Environmental | Open in IMG/M |
| 3300023110 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024505 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8h | Environmental | Open in IMG/M |
| 3300024515 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8d | Environmental | Open in IMG/M |
| 3300024570 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024865 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025640 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300026138 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027293 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8d | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027595 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepC_8h | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028103 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8d | Environmental | Open in IMG/M |
| 3300031227 | Saline water microbial communities from Ace Lake, Antarctica - #232 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| PR_CR_10_Liq_1_inCRDRAFT_10606963 | 3300000385 | Enviromental | MKFRRCNVWGQIYLFPYLKITHTRELNGDLELIIGWLKWELIIGL* |
| GOS2236_10663483 | 3300001968 | Marine | MKATFCKIYGQFYVLPFIGVTHSRTLNGDLELIIGWGKWELVFGV* |
| M2t6BS2_10994415 | 3300002132 | Marine | MKLNYCKVWGQVYLFPYVKLTHTRFLNGDLELIIGWLKWEAVIGI* |
| B570J29581_1075053 | 3300002274 | Freshwater | VKLSINEVWGQVYLLPFIKFTHTRQLNGDLELIIGYLKWEIVIGI* |
| B570J40625_10000479636 | 3300002835 | Freshwater | MKLSINEVWGQVYLLPFIKFTHTRQLNGDLELIIGYLKWEIVIGI* |
| JGI26081J50195_100056221 | 3300003346 | Marine | MRVTYCEVWGQVYLLPYVKLTHTRTLNGDLELIIGWLKWEIVIGI* |
| JGI26084J50262_10740512 | 3300003427 | Marine | MKTRIYTIYGQIYLLPYIKITHTRELNGDLELIVGWLKWEVVFGI* |
| Ga0063233_100033206 | 3300003986 | Freshwater Lake | MKIYEVYGQIYIFPFVKITHTRKLNGDLELIFGWLKWELAIRL* |
| Ga0007787_100043213 | 3300004240 | Freshwater Lake | MKFSICKIYGQVYFLPFIGMTHSRRLNGDIELIIGWLKWEIVIGI* |
| Ga0049081_101335572 | 3300005581 | Freshwater Lentic | MKIYEVYGQIYIFPFVKITHTRKLNGDLELIFGWLKWEFAIRL* |
| Ga0049080_100410485 | 3300005582 | Freshwater Lentic | MKLSISEVWGQVYLLPFIKFTHTRQLNGDLELIIGYLKWEIVIGI* |
| Ga0078894_104826402 | 3300005662 | Freshwater Lake | MKLSINEVWGQVYFLPFIKMTHTRQLNGDLELIIGYLKWEIVIGI* |
| Ga0078894_110347083 | 3300005662 | Freshwater Lake | MKLSINEVWGQVYLLPFIKFTHTRQLNGDIELIIGYLKWEIVIGI* |
| Ga0079957_10073836 | 3300005805 | Lake | MKFSICKIYGQCYFLPFIGMTHSRRLNGDIELIIGWLKWEIVIGI* |
| Ga0075474_101475252 | 3300006025 | Aqueous | MKITVSKSHEQVYLLPYVKVTHSRVLNGDLELIVGWLHLELVVGI* |
| Ga0098048_10182316 | 3300006752 | Marine | MGKIMKITKYEVWGQIYLLPYIKLTHTRTLNGDLELIIGWLKWEITIGI* |
| Ga0102978_12956113 | 3300007177 | Freshwater Lake | MKVTFCKVYGQFYLIPFIGITHTRKLNGDLELIIGWGKWEIVFGI* |
| Ga0070752_13178302 | 3300007345 | Aqueous | MRLSFVNIWGQLYLLPYIKVTHDKQLNGDLELIIGWL |
| Ga0099851_11613733 | 3300007538 | Aqueous | MKISKAEVWGQIYLLPYIKITHTRDLNGDLELIAGWLKWELVFSI* |
| Ga0099851_12323751 | 3300007538 | Aqueous | MKITVSKSHEQIYLLPYIKVTHTRLINGDLELIVGWLHLELVVGI* |
| Ga0099849_13734291 | 3300007539 | Aqueous | MKITVSKSHEQVYLLPYVKVTHSRVLNGDLELIIGW |
| Ga0099848_13471651 | 3300007541 | Aqueous | VGLMKISKAEVWGQIYLLPYIKITHTRDLNGNLELIAGWLKWELVFSI* |
| Ga0099846_11951022 | 3300007542 | Aqueous | MKVTVSKSHEQVYLLPYIKVTHTRLINGDLELIVGWLHLELVVGI* |
| Ga0102820_10694291 | 3300007554 | Estuarine | MGKIMRVTYCEVWGQVYLLPYVKLTHTRTLNGDLELIIGWLKWEIIIGI* |
| Ga0102821_10218542 | 3300007557 | Estuarine | MGKIMRVTYCEVWGQVYLLPYVKLTHTRTLNGDLELIIGWLKWEIVIGI* |
| Ga0102945_10475183 | 3300007609 | Pond Water | MKTTICRVWGQIYPLPYIKITHTRKLNGDLELIIGWFKWEIIIGL* |
| Ga0102901_11934682 | 3300007634 | Estuarine | MKITINEVWGQVYFLPYIKMTHTRRLNGDIEFIIGYLKWEIVFGY* |
| Ga0102824_10705082 | 3300007681 | Estuarine | EVWGQVYLLPYVKLTHTRTLNGDLELIIGWLKWEIVIGI* |
| Ga0099850_10398294 | 3300007960 | Aqueous | MKVIISEVFGQVYLLPYVKITHTRELNGDLELIIGWLFWEIGVGI* |
| Ga0114340_10955412 | 3300008107 | Freshwater, Plankton | MKISKAEVWGQIYLLPYIKITYTRDLNGDLELIAGWLKWELVFSI* |
| Ga0114340_11002342 | 3300008107 | Freshwater, Plankton | MKISKAEVWGQIYLLPYIKVTHTRDLNGDLELIFGWLKWELVFSI* |
| Ga0114340_11297082 | 3300008107 | Freshwater, Plankton | MKISKAEVWGQIYLLPYIKVTYTRDLNGNLELIVGWLKWELVFSI* |
| Ga0114341_100797545 | 3300008108 | Freshwater, Plankton | MKLSINEIWGQVYLLPFIKLTHTRQLNGDLELIIGYLKWELVIGI* |
| Ga0114343_11019771 | 3300008110 | Freshwater, Plankton | MKLSINEVWGQVYFLPFIKFTHTRQLNGDIELIIGYLKWEIVIGI* |
| Ga0114346_10387716 | 3300008113 | Freshwater, Plankton | MKISINEVWGQVYFLPFIKLTHTRQLNGDLELIIGYLKWELVIGM* |
| Ga0114350_10155156 | 3300008116 | Freshwater, Plankton | MKIYEIYGQIYLFPFVKITHTKKLNGDLEFIIGWLKWELTIKL* |
| Ga0114350_10437054 | 3300008116 | Freshwater, Plankton | MKVTLCEVWGQIYFLPYIKMTHTRTLNGNLELIIGYLKWEVVIGV* |
| Ga0114355_10433643 | 3300008120 | Freshwater, Plankton | MKFSICKIYGQVYFLPFIGMTHSRRLNGDIELIIGWLKWEIV |
| Ga0114355_11955502 | 3300008120 | Freshwater, Plankton | CKIYGQVYFLPFIGMTHSRRLNGDIELIIGWLKWEIVIGI* |
| Ga0114876_10639902 | 3300008448 | Freshwater Lake | MKLSINEIWGQVYFLPFIKLTHTRQLNGDLELIIGYLKWELVIGM* |
| Ga0114876_10797414 | 3300008448 | Freshwater Lake | MKISKAEVWGQIYLLPYIKITHTRDLNGDLELIFGWLKWELVFTI* |
| Ga0114880_11694452 | 3300008450 | Freshwater Lake | MRISKAEVWGQIYLLPYIKITYTRDLNGDLELIVGWLKWELVFSI* |
| Ga0105099_101584463 | 3300009082 | Freshwater Sediment | MKLSINEIWGQVYLLPFIKLTHTRDLNGDLELIIGYLKWELVIGI* |
| Ga0114995_1000463413 | 3300009172 | Marine | MKSQIVSVWGQIYLFPYLKITHTRTLNGDLEIILGWLKWEWVIGI* |
| Ga0114994_101716573 | 3300009420 | Marine | MKSQIASVGGQIYLFPYLKITHTRILNGDLELIIGWLKWEWVIGI* |
| Ga0129348_13057593 | 3300010296 | Freshwater To Marine Saline Gradient | MIELCKVVGQIYILPYIKLTHSRILNGNLEFIIGWLKWE |
| Ga0129345_10908781 | 3300010297 | Freshwater To Marine Saline Gradient | MKTTKCTVYGQIYLLPYVKLTHNRMLNGDLELIIGWLKWELVIGI* |
| Ga0153799_10035177 | 3300012012 | Freshwater | MKIFEVYGQIYIFPFVKITHTRKLNGDLELIFGWLKWEFAIRL* |
| Ga0164293_1002107817 | 3300013004 | Freshwater | MRLSISEVWGQVYLLPFIKFTHTRQLNGDLELIIGYLKWEIVIGI* |
| (restricted) Ga0172365_100293049 | 3300013127 | Sediment | MKISKAEIWGQIYLLPYIKLTYTRDLNGDLELIFGWLKWELVFSI* |
| (restricted) Ga0172373_104969203 | 3300013131 | Freshwater | QIYLLPYIKVTYTRDLNVDLELIFGWLKWELVFSI* |
| (restricted) Ga0172372_109506912 | 3300013132 | Freshwater | MKISKAEVWGQIYLLPYIKVTYTRDLNVDLELIFGWLKWELVFSI* |
| (restricted) Ga0172362_1003560410 | 3300013133 | Sediment | MVMKISKAEVWGQIYLLPYIKVTYTRDLNGDLELIFGWLKWELVFSI* |
| Ga0177922_101246202 | 3300013372 | Freshwater | MKIFEVYGQIYIFPFVKITHTRKLNGDLELIFGWLKWELSIRL* |
| Ga0181350_11025972 | 3300017716 | Freshwater Lake | MKIFEVYGQIYIFPFVKITHTRKLNGDLELIFGWLKWELAIRL |
| Ga0181356_10393544 | 3300017761 | Freshwater Lake | MKISINEVWGQVYLLPFIKFTHTRQLNGDIELIIGYLKWEIVIGI |
| Ga0181343_10565523 | 3300017766 | Freshwater Lake | MKLSINEVWGQVYLLPFIKFTHTRQLTGDLELIIGYLKWEIVIGI |
| Ga0181343_10588731 | 3300017766 | Freshwater Lake | IQMKLSINEIWGQVYFLPFIKLTHTRQLNGDLELIIGYLKWELVIGM |
| Ga0181349_10106002 | 3300017778 | Freshwater Lake | MKISISEVWGQVYLLPFIKFTHTRQLNGDIELIIGYLKWEIVIGI |
| Ga0181349_10984383 | 3300017778 | Freshwater Lake | MKIAINEVWGQVYLLPFIKLTHTRQLNGDIELIIGYLKWELVIGM |
| Ga0181355_10286135 | 3300017785 | Freshwater Lake | DTTFVIGGIDMKIYEVYGQIYIFPFVKITHTRKLNGDLELIFGWLKWELAIRL |
| Ga0169931_108347792 | 3300017788 | Freshwater | MTTTLREVWGQVYFLPHLKMTHTRTLNGNLELIIGYLKWELV |
| Ga0181565_100311487 | 3300017818 | Salt Marsh | MKTTKCTVYGQIYLLPYVKITHNRMLNGDLELIIGWLKWEIIFGW |
| Ga0181601_102061173 | 3300018041 | Salt Marsh | MRLAFVNIWGQLYLLPYIKVTHDRQLNGDLEFIIGWLKWEMVIGY |
| Ga0181553_103776082 | 3300018416 | Salt Marsh | MKISINEIWGQVYFLPFIKMTHTRQLNGDLELIIGYLKWEIVIGI |
| Ga0181567_106359763 | 3300018418 | Salt Marsh | MKTTKCTVYGQIYLLPYVKITHNRMLNGDLELIIGWLKWE |
| Ga0181575_102808041 | 3300020055 | Salt Marsh | SISSIWGQVYILPFIKLTHTRTLNGDLELIIGWLKWELIIGI |
| Ga0194113_107527381 | 3300020074 | Freshwater Lake | MKITLCEVWGQIYFLPYIKMTHTRTLNGNLELIIG |
| Ga0194110_109709242 | 3300020084 | Freshwater Lake | MGKIMKITLCEVWGQIYFLPYIKMTHTRTLNGNLELIIGYLKWELVIGI |
| Ga0194112_105212511 | 3300020109 | Freshwater Lake | MKITLCEVWGQIYFLPYIKMTHTRTLNGNLELIIGYLKWELVIG |
| Ga0194112_107256052 | 3300020109 | Freshwater Lake | KIMKITLCEVWGQIYFLPYIKMTHTRTLNGNLELIIGYLKWELVIGI |
| Ga0211735_105577282 | 3300020162 | Freshwater | MEITKAKVWGQVYLFPYVKVTHTRELNGDLEIIVGWLKWQLIFGI |
| Ga0181556_10210131 | 3300020176 | Salt Marsh | MRISISSIWGQVYILPFIKLTHTRTLNGDLELIIGWLKWEL |
| Ga0181599_12177432 | 3300020178 | Salt Marsh | MRLAFVNIWGQLYLLPYIKVTHDRQLNGDLEIIIGWLKWEMIIGY |
| Ga0194115_100322604 | 3300020183 | Freshwater Lake | MKITLCEVWGQIYFLPYIKMTHTRTLNGNLELIIGYLKWELVIGI |
| Ga0181573_104161763 | 3300020184 | Salt Marsh | MRISISSIWGQVYILPFIKLTHTRTLNGDLELIIGWL |
| Ga0208091_100035018 | 3300020506 | Freshwater | MKLSINEVWGQVYLLPFIKFTHTRQLNGDLELIIGYLKWEIVIGI |
| Ga0208858_10300723 | 3300020524 | Freshwater | MKLSINEIWGQVYLLPFIKFTHTRQLNGDLELIIGYLKWEIVIGI |
| Ga0208855_10128503 | 3300020553 | Freshwater | VYGQIYIFPFVKITHTRKLNGDLELIIGWLKWELAIRL |
| Ga0208053_10195053 | 3300020575 | Freshwater | KIYIFPFVKITHTRKLNGDLELIIGWLKWELAISL |
| Ga0194126_101579304 | 3300020603 | Freshwater Lake | WGQIYFLPYIKMTHTRTLNGNLELIIGYLKWELVIGI |
| Ga0213867_11810042 | 3300021335 | Seawater | GQVYILPFIKLKHTRTLNGDLELIIGWLKWELIIGI |
| Ga0213858_102497011 | 3300021356 | Seawater | MKTTKCTVYGQIYLLPYVKITHNRMLNGDLELIIGWLKWEIIFGI |
| Ga0222716_101423492 | 3300021959 | Estuarine Water | MKITLSKIFGQVYLLPYVKITHTRELNGDLEVIIGYLKWEIALGL |
| Ga0222715_100925781 | 3300021960 | Estuarine Water | KGGWGKGYFLPFIKMTHTRQLNGDLELIIGYLKWEIVIGI |
| Ga0222714_1000040819 | 3300021961 | Estuarine Water | MKFSICKIYGQVYFLPFIGMTHSRRLNGDIELIIGWLKWEIVIGI |
| Ga0222714_100254262 | 3300021961 | Estuarine Water | MKISINEVWGQVYFLPFIKMTHTRQLNGDLELIIGYLKWEIVIGI |
| Ga0222714_101364653 | 3300021961 | Estuarine Water | MKTTICKVWGQVYLLPYIKLTHTRKLNGDLELIIGWLKWEIIFGK |
| Ga0222714_102833382 | 3300021961 | Estuarine Water | KFEICSIWGQVYFLPFIKITHTRTLNGDLELIIGWLKWELVIGI |
| Ga0222714_104635731 | 3300021961 | Estuarine Water | MKVTFCEVWGQVYFLPYIKLTHTRKLNGDLELIIGWLKWEIVIGI |
| Ga0222713_100101134 | 3300021962 | Estuarine Water | MKVTLCEVWGQIYFLPYIKMTHTRTLNGNLELIIGYLKWEVVIGV |
| Ga0222713_101431114 | 3300021962 | Estuarine Water | MKTTICKVWGQVYLLPYIKLTHTRKLNGDLELIIGWGKWEIIFGI |
| Ga0222713_107673192 | 3300021962 | Estuarine Water | EVWGQVYFLPYIKLTHTRKLNGDLELIIGWLKWEIVIGI |
| Ga0222713_108215012 | 3300021962 | Estuarine Water | MRISKAEVWGQIYLLPYIKITYTRDLNGDLELIVGWVKWELVFSI |
| Ga0222712_100007083 | 3300021963 | Estuarine Water | MKITLCEVWGQIYFLPYIKMTHTRTLNGNLELIIGYLKWEVVIGV |
| Ga0222712_103125293 | 3300021963 | Estuarine Water | AYQIYVTPYIKITHSKFLNGDREFIIGWLKWELVISF |
| Ga0222712_104793181 | 3300021963 | Estuarine Water | MKVSKAEVWGQIYLLPYIKITYTRDLNGDLELIVGWLKWELVFNI |
| Ga0181354_10179404 | 3300022190 | Freshwater Lake | MKIYEVYGQIYIFPFVKITHTRKLNGDLELIFGWLKWELAIRL |
| Ga0196905_10270633 | 3300022198 | Aqueous | MKITVSKSHEQVYLLPYVKVTHSRVLNGDLELIVGWLHLELVVGI |
| Ga0181351_11646012 | 3300022407 | Freshwater Lake | MKISKAEVWGQIYLLPYIKITHTRDLNGDLELIFGWLKWELVFTI |
| Ga0255753_10339451 | 3300022926 | Salt Marsh | VNIWGQLYLLPYIKVTHDRQLNGDLEFIIGWLKWEMVIGY |
| Ga0255752_102430021 | 3300022929 | Salt Marsh | MIISISSIWGQVYILPFIKLTHTRTLNGDLELIIGWLK |
| Ga0255782_100912574 | 3300023105 | Salt Marsh | VGLIMKTTKCTVYGQIYLLPYVKITHDRMLNGDLELIIGWLKWEIIFGW |
| Ga0255743_102805854 | 3300023110 | Salt Marsh | MIISISSIWGQVYILPFIKLTHTRTLNGDLELIIGWL |
| Ga0244775_100005589 | 3300024346 | Estuarine | MRVTYCEVWGQVYLLPYVKLTHTRTLNGDLELIIGWLKWEIVIGI |
| Ga0255150_10126783 | 3300024505 | Freshwater | MKITLCEVWGQIYFLPYIKMTHTRTLNGNLELIIGYLK |
| Ga0255183_10230764 | 3300024515 | Freshwater | CEVWGQIYFLPYIKMTHTRTLNGNLELIIGYLKWEVVIGV |
| Ga0255276_10997261 | 3300024570 | Freshwater | KATFCKIYGQFYVLPFIGITHSRTLNGDLELIIGWGKWELVFGV |
| Ga0256340_10990492 | 3300024865 | Freshwater | MKATFCKIYGEFYVLPFIGITHSRTLNGDLELIIGWGKWELVFGV |
| Ga0208667_10142473 | 3300025070 | Marine | MKITKYEVWGQIYLLPYIKLTHTRTLNGDLELIIGWLKWEITIGI |
| Ga0208303_10658071 | 3300025543 | Aqueous | MIELCKVVGQIYILPYIKLTHSRILNGNLEFIIGWLKWEI |
| Ga0208149_10177861 | 3300025610 | Aqueous | MIELCKVVGQIYILPYIKLTHSRILNGNLEFIIGWLKW |
| Ga0209198_11929902 | 3300025640 | Pelagic Marine | QTYITPYIKITHNRDLNGYLEFIIGWLKWEIVIGI |
| Ga0208898_10422641 | 3300025671 | Aqueous | MRISISSIWGQVYILPFIKLTHTRTLNGDLELIIGWFKWE |
| Ga0209951_10160265 | 3300026138 | Pond Water | MKVTYCEVWGQIYLLPFIKLTHTRTLNGDLELIIGWLK |
| Ga0255132_10260824 | 3300027293 | Freshwater | GIDMKIYEVYGQIYIFPFVKITHTRKLNGDLELIFGWLKWELAIRL |
| Ga0209651_12077662 | 3300027581 | Freshwater Lake | MKIYEVYGQIYIFPFVKITHTRKLNGDLELIFGWLKWE |
| Ga0255122_10185814 | 3300027595 | Freshwater | VYGQIYIFPFVKITHTRKLNGDLELIFGWLKWELAIRL |
| Ga0209709_1000217017 | 3300027779 | Marine | MKSQIASVGGQIYLFPYLKITHTRILNGDLELIIGWLKWEWVIGI |
| Ga0209287_101509504 | 3300027792 | Freshwater Sediment | MKLSINEIWGQVYLLPFIKLTHTRDLNGDLELIIGYLKWELVIGI |
| Ga0209107_102466711 | 3300027797 | Freshwater And Sediment | FVIGGIDMKIYEVYGQIYIFPFVKITHTRKLNGDLELIFGWLKWEFAIRL |
| Ga0247723_10800052 | 3300028025 | Deep Subsurface Sediment | MKIAINEIWGQVYFLPFIKLTHTRQLNGDLELIIGYLKWELVIGM |
| Ga0255172_10350243 | 3300028103 | Freshwater | EVWGQIYFLPYIKMTHTRTLNGNLELIIGYLKWEVVIGV |
| Ga0307928_103052803 | 3300031227 | Saline Water | MKIGISSVWGQIYILPYIKLTHTRTLNGDLELIIGWL |
| Ga0307488_100190117 | 3300031519 | Sackhole Brine | MKLNYCKVWGQVYLFPYVKLTHTRTLNGDLELIIGWFKWEVVIGI |
| Ga0307488_100763072 | 3300031519 | Sackhole Brine | MKSQIVSVWGQMYLFPYLKITHTRTLNGDLELIVGWLKWEWVIGI |
| Ga0307380_100329253 | 3300031539 | Soil | MKLNYCKVWGQVYLFPYVKLTHTRFLNGDLELIIGWLKWEAVIGI |
| Ga0307376_103666024 | 3300031578 | Soil | MKISKAEVWGQIYLLPYIKITHTRDLNGNLELIFGWLKWELVF |
| Ga0307375_104543072 | 3300031669 | Soil | MKISKAEVWGQIYLLPYIKITHTRDLNGDLELIAGWLKWELVFSI |
| Ga0315291_108309462 | 3300031707 | Sediment | MKIFEVYGQIYIFPFVKITHTRKLNGDLELIFGWLKWELAISL |
| Ga0315907_101289624 | 3300031758 | Freshwater | MKLSINEIWGQVYLLPFIKLTHTRQLNGDLELIIGYLKWELVIGI |
| Ga0315900_102998865 | 3300031787 | Freshwater | MKISKAEVWGQIYLLPYIKVTHTRDLNGDLELIFGWLKWELVFSI |
| Ga0315909_1000893917 | 3300031857 | Freshwater | MKIYEIYGQIYLFPFVKITHTKKLNGDLEFIIGWLKWELTIKL |
| Ga0316625_1024410041 | 3300033418 | Soil | MKIFEVYGQIYIFPFVKITNTRYLNGDLELIIGWL |
| Ga0334992_0003432_3476_3613 | 3300033992 | Freshwater | MRLSISEVWGQVYLLPFIKFTHTRQLNGDLELIIGYLKWEIVIGI |
| Ga0334987_0497251_2_112 | 3300034061 | Freshwater | GQVYLLPFIKFTHTRQLNGDLELIIGYLKWEIVIGI |
| Ga0334995_0704979_40_177 | 3300034062 | Freshwater | MKLSINEVWGQVYLLPFIKLTHTRQLNGDIELIIGYLKWELVIGI |
| Ga0310127_063227_298_435 | 3300034072 | Fracking Water | MKLSINEVWGQVYFLPFIKLTYTRQLNGDLELIIGYLKWELVIGM |
| Ga0310130_0098673_445_594 | 3300034073 | Fracking Water | MGKIIRIKVYDVWGQVYILPYIKLTHNRKLNGDLEFIIGWLKWELVIGI |
| Ga0335029_0697618_398_535 | 3300034102 | Freshwater | MKLSINEVWGQVYLLPFIKLTHTRQLNGDIELIIGYLKWEIVIGI |
| Ga0335030_0238546_442_579 | 3300034103 | Freshwater | MKVSINEVWGQVYLLPFIKLTHTRQLNGDIELIIGYLKWELVIGI |
| Ga0335036_0084028_1429_1566 | 3300034106 | Freshwater | MKLSINEVWGQVYLLPFIKLTHTRQLNGDLELIIGYLKWELVIGM |
| Ga0335007_0348615_3_110 | 3300034283 | Freshwater | QVYLLPFIKLTHTRQLNGDIELIIGYLKWEIVIGI |
| ⦗Top⦘ |