


| Basic Information | |
|---|---|
| Family ID | F051844 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 143 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MGYHPLVKRLLDGELSLAELPPELRAEGEEALRLLGAVD |
| Number of Associated Samples | 125 |
| Number of Associated Scaffolds | 143 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.30 % |
| % of genes near scaffold ends (potentially truncated) | 98.60 % |
| % of genes from short scaffolds (< 2000 bps) | 84.62 % |
| Associated GOLD sequencing projects | 116 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.66 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (24.476 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.944 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.441 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.81% β-sheet: 0.00% Coil/Unstructured: 61.19% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.66 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 143 Family Scaffolds |
|---|---|---|
| PF08281 | Sigma70_r4_2 | 90.21 |
| PF04542 | Sigma70_r2 | 5.59 |
| PF00593 | TonB_dep_Rec | 2.10 |
| PF07980 | SusD_RagB | 0.70 |
| PF16561 | AMPK1_CBM | 0.70 |
| COG ID | Name | Functional Category | % Frequency in 143 Family Scaffolds |
|---|---|---|---|
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 5.59 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 5.59 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 5.59 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 5.59 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002558|JGI25385J37094_10183223 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300002560|JGI25383J37093_10207438 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300002561|JGI25384J37096_10126670 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300002562|JGI25382J37095_10247435 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 538 | Open in IMG/M |
| 3300002911|JGI25390J43892_10088123 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300002914|JGI25617J43924_10091120 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300005172|Ga0066683_10541190 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300005174|Ga0066680_10596236 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 692 | Open in IMG/M |
| 3300005176|Ga0066679_10146797 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1473 | Open in IMG/M |
| 3300005178|Ga0066688_10163809 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1398 | Open in IMG/M |
| 3300005179|Ga0066684_10659013 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300005181|Ga0066678_10402515 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300005186|Ga0066676_10133039 | All Organisms → cellular organisms → Bacteria | 1547 | Open in IMG/M |
| 3300005187|Ga0066675_10063472 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2324 | Open in IMG/M |
| 3300005294|Ga0065705_10313030 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300005447|Ga0066689_10111966 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1581 | Open in IMG/M |
| 3300005450|Ga0066682_10169085 | All Organisms → cellular organisms → Bacteria | 1396 | Open in IMG/M |
| 3300005468|Ga0070707_100383873 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
| 3300005471|Ga0070698_101152823 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300005530|Ga0070679_101672372 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300005540|Ga0066697_10175870 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300005555|Ga0066692_10648509 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300005555|Ga0066692_10694623 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300005558|Ga0066698_10047182 | All Organisms → cellular organisms → Bacteria | 2705 | Open in IMG/M |
| 3300005559|Ga0066700_10585182 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300005561|Ga0066699_10227365 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
| 3300005566|Ga0066693_10163837 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300005575|Ga0066702_10483710 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300005586|Ga0066691_10039569 | All Organisms → cellular organisms → Bacteria | 2481 | Open in IMG/M |
| 3300005586|Ga0066691_10916353 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300006032|Ga0066696_10037468 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2644 | Open in IMG/M |
| 3300006791|Ga0066653_10124400 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
| 3300006797|Ga0066659_10019946 | All Organisms → cellular organisms → Bacteria | 3815 | Open in IMG/M |
| 3300006797|Ga0066659_10060849 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2428 | Open in IMG/M |
| 3300006797|Ga0066659_11413374 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300006854|Ga0075425_100440999 | All Organisms → cellular organisms → Bacteria | 1499 | Open in IMG/M |
| 3300006903|Ga0075426_10442912 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300006914|Ga0075436_100657536 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300007076|Ga0075435_100997007 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300007076|Ga0075435_101316211 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 633 | Open in IMG/M |
| 3300007255|Ga0099791_10046817 | All Organisms → cellular organisms → Bacteria | 1931 | Open in IMG/M |
| 3300007258|Ga0099793_10000168 | All Organisms → cellular organisms → Bacteria | 15265 | Open in IMG/M |
| 3300009012|Ga0066710_100972206 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
| 3300009147|Ga0114129_13331719 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300009812|Ga0105067_1029385 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300010134|Ga0127484_1034278 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300010134|Ga0127484_1141090 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300010142|Ga0127483_1115801 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300010320|Ga0134109_10020131 | All Organisms → cellular organisms → Bacteria | 2038 | Open in IMG/M |
| 3300010320|Ga0134109_10286552 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300010320|Ga0134109_10333294 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300010322|Ga0134084_10460240 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300010335|Ga0134063_10584051 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 567 | Open in IMG/M |
| 3300010336|Ga0134071_10163054 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300010336|Ga0134071_10610601 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300010371|Ga0134125_11476666 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300010403|Ga0134123_10038122 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3546 | Open in IMG/M |
| 3300010896|Ga0138111_1070682 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300011120|Ga0150983_11437068 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300012200|Ga0137382_10355828 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300012200|Ga0137382_10447723 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300012202|Ga0137363_11578400 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300012203|Ga0137399_10151279 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1854 | Open in IMG/M |
| 3300012204|Ga0137374_10494734 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 951 | Open in IMG/M |
| 3300012285|Ga0137370_10946460 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300012349|Ga0137387_10147465 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1673 | Open in IMG/M |
| 3300012349|Ga0137387_10170970 | All Organisms → cellular organisms → Bacteria | 1554 | Open in IMG/M |
| 3300012354|Ga0137366_10106310 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2125 | Open in IMG/M |
| 3300012357|Ga0137384_10144770 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1989 | Open in IMG/M |
| 3300012359|Ga0137385_10141343 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2120 | Open in IMG/M |
| 3300012360|Ga0137375_10600372 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 917 | Open in IMG/M |
| 3300012362|Ga0137361_11037976 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300012376|Ga0134032_1243327 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300012379|Ga0134058_1191440 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300012380|Ga0134047_1202999 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300012392|Ga0134043_1112379 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300012395|Ga0134044_1047245 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300012398|Ga0134051_1335640 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300012400|Ga0134048_1371337 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300012403|Ga0134049_1243960 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300012407|Ga0134050_1446308 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300012409|Ga0134045_1115444 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300012532|Ga0137373_10030060 | All Organisms → cellular organisms → Bacteria | 5294 | Open in IMG/M |
| 3300012917|Ga0137395_10188588 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1430 | Open in IMG/M |
| 3300012927|Ga0137416_10967316 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300012930|Ga0137407_11897022 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300012944|Ga0137410_10061885 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2694 | Open in IMG/M |
| 3300012975|Ga0134110_10312629 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300012976|Ga0134076_10086311 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1229 | Open in IMG/M |
| 3300014150|Ga0134081_10007944 | All Organisms → cellular organisms → Bacteria | 2776 | Open in IMG/M |
| 3300014154|Ga0134075_10164256 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300014157|Ga0134078_10034426 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1682 | Open in IMG/M |
| 3300015359|Ga0134085_10095229 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1232 | Open in IMG/M |
| 3300015373|Ga0132257_100749594 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1216 | Open in IMG/M |
| 3300017657|Ga0134074_1009045 | All Organisms → cellular organisms → Bacteria | 3199 | Open in IMG/M |
| 3300017659|Ga0134083_10161636 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300018071|Ga0184618_10357365 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 622 | Open in IMG/M |
| 3300018078|Ga0184612_10409582 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 680 | Open in IMG/M |
| 3300018431|Ga0066655_10237008 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300018431|Ga0066655_11047183 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300018468|Ga0066662_11888184 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300018468|Ga0066662_12295930 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300018482|Ga0066669_11012778 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300018482|Ga0066669_11765577 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300019249|Ga0184648_1190498 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 707 | Open in IMG/M |
| 3300019255|Ga0184643_1457623 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1906 | Open in IMG/M |
| 3300019259|Ga0184646_1449381 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 589 | Open in IMG/M |
| 3300020170|Ga0179594_10019962 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2021 | Open in IMG/M |
| 3300020170|Ga0179594_10187846 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300022195|Ga0222625_1227838 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 745 | Open in IMG/M |
| 3300025322|Ga0209641_10137575 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1859 | Open in IMG/M |
| 3300026301|Ga0209238_1193199 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 597 | Open in IMG/M |
| 3300026306|Ga0209468_1017681 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2575 | Open in IMG/M |
| 3300026309|Ga0209055_1185224 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300026310|Ga0209239_1033782 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2408 | Open in IMG/M |
| 3300026313|Ga0209761_1098609 | All Organisms → cellular organisms → Bacteria | 1467 | Open in IMG/M |
| 3300026323|Ga0209472_1016600 | All Organisms → cellular organisms → Bacteria | 3583 | Open in IMG/M |
| 3300026329|Ga0209375_1091999 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
| 3300026331|Ga0209267_1097787 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
| 3300026332|Ga0209803_1158496 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300026333|Ga0209158_1030756 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2324 | Open in IMG/M |
| 3300026333|Ga0209158_1203168 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300026536|Ga0209058_1051900 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2331 | Open in IMG/M |
| 3300026536|Ga0209058_1152424 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1081 | Open in IMG/M |
| 3300027169|Ga0209897_1014372 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300027616|Ga0209106_1098483 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300027846|Ga0209180_10356027 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 834 | Open in IMG/M |
| 3300028536|Ga0137415_10666886 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 852 | Open in IMG/M |
| 3300028711|Ga0307293_10175914 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 681 | Open in IMG/M |
| 3300030829|Ga0308203_1039249 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300030903|Ga0308206_1146831 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 565 | Open in IMG/M |
| 3300030904|Ga0308198_1044975 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300030987|Ga0308155_1014348 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 678 | Open in IMG/M |
| 3300031114|Ga0308187_10221001 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 674 | Open in IMG/M |
| 3300031421|Ga0308194_10139934 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 737 | Open in IMG/M |
| 3300031424|Ga0308179_1025760 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 673 | Open in IMG/M |
| 3300031720|Ga0307469_10555467 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300031720|Ga0307469_11299491 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300031740|Ga0307468_101148317 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300031753|Ga0307477_10569031 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 766 | Open in IMG/M |
| 3300032180|Ga0307471_103660436 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300032205|Ga0307472_100969096 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 794 | Open in IMG/M |
| 3300033417|Ga0214471_10062604 | All Organisms → cellular organisms → Bacteria | 3045 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 24.48% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 20.28% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 11.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.59% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.20% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.20% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.80% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.40% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.40% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.40% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.40% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.40% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.70% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.70% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.70% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.70% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009812 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60 | Environmental | Open in IMG/M |
| 3300010134 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010142 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010896 | Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012376 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012379 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012380 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012392 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012395 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012398 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012400 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012403 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012407 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012409 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019249 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300027169 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300030829 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030904 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030987 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_144 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031424 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_150 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25385J37094_101832232 | 3300002558 | Grasslands Soil | MTQAYHQLVKRLLDGELSLSDLPPELRAEGAEALRLLGAV |
| JGI25383J37093_102074381 | 3300002560 | Grasslands Soil | MTTGYHPLVKRLLDGELSLAELPPELQGEGEEALRLVGAADRAPVALS |
| JGI25384J37096_101266702 | 3300002561 | Grasslands Soil | MSDHDFHPLVMQLLDGDLTIADLPAELRAQGEEALRLLAAVDRRPV |
| JGI25382J37095_102474351 | 3300002562 | Grasslands Soil | MTKQYHPLIKQLLDGELSPAALPPELRAEGDEALHVLAAVDRAP |
| JGI25390J43892_100881231 | 3300002911 | Grasslands Soil | MKTGYHALVKRLLDGELTLGELPPELRAEGEEALRLVGAADRA |
| JGI25617J43924_100911203 | 3300002914 | Grasslands Soil | MXTNYPRPVKQLLDGELTLADLPPELRAEGEEALGLVAGVDR |
| Ga0066683_105411902 | 3300005172 | Soil | MTTGYHPLVKRLLDGEVSLAELPRELQAEGEEALRLVGAAD |
| Ga0066680_105962361 | 3300005174 | Soil | MKAYDPLVKRLLDGELTLAELPPELQAEGSEALRLLGAVDRRAVVLPV |
| Ga0066679_101467974 | 3300005176 | Soil | MKTGYHALVKRLLDGELTLGELPPELRAEGEEALRLVGAADRAPVALSP |
| Ga0066688_101638094 | 3300005178 | Soil | MTREFHPLVKRLLDGELTLGDLPLELRPEGEEALRLLAPLDRAPV |
| Ga0066684_106590132 | 3300005179 | Soil | MSMSKTYHPLVKGLLDGERSLADLPPELRAEAEEAERLLGA |
| Ga0066678_104025151 | 3300005181 | Soil | MSAQYHPLVKRLLDGELSLAELPAELRAEGEQALRLIRGVDRAPVTLPATL |
| Ga0066676_101330391 | 3300005186 | Soil | VTMTDFHPLVKQLLDGEVTLADLPPGLRAEGEEALRLLGAV |
| Ga0066675_100634725 | 3300005187 | Soil | MTEHSERQFHPLVKQLLDGDITLADLPAELRAEGEEALRLLADLDRRPV |
| Ga0065705_103130303 | 3300005294 | Switchgrass Rhizosphere | MSGKDFHPQVKQLLDGELSVADLPSELRAEGEEALRLLAMVDREPVTFPGL |
| Ga0066689_101119661 | 3300005447 | Soil | MKTGYHALVKRLLDGELTLGELPPELRAEGEEALRLVGAADRAP |
| Ga0066682_101690851 | 3300005450 | Soil | MSKAYHPQVKALLDGERSLADLPPELRAESDEAERLLGAVDRTP |
| Ga0070707_1003838731 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDHDFHPLVKQLLDGDLTLAELPAELRAEGEEALRLLAAADR |
| Ga0070698_1011528232 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGYHPLVKQVLDGELSLAVLPRDLRAEGEEAVRLIQAAD |
| Ga0070679_1016723722 | 3300005530 | Corn Rhizosphere | MTAFHPLVKQLLDGEITLADLPAELRAEGEEALRLLAAVD |
| Ga0066697_101758701 | 3300005540 | Soil | MMASYHPLVKRLLDGEVSLAELPPELQAEGEEALRLVGAAD |
| Ga0066692_106485091 | 3300005555 | Soil | MSEHEYHPLVKQLLDGDITSAELPAELRVQGEEALRLLGLVDR |
| Ga0066692_106946232 | 3300005555 | Soil | MMGYHPLVKRLLDGELSLAELPPELRAEGEEALRLLG |
| Ga0066698_100471825 | 3300005558 | Soil | MTTGYHPLVKRLLDGELSLADLPPELRVEGEDALRLVGAVDRAPVTL |
| Ga0066700_105851821 | 3300005559 | Soil | MTREFHPLVKRLLDGELTLGDLPLELRPEGEEALRLLAAL |
| Ga0066699_102273654 | 3300005561 | Soil | MSMSKTYHPLVKGLLDGERSLADLPPELRAEAEEAERLLGAV |
| Ga0066693_101638372 | 3300005566 | Soil | MTTDYHPLVKRLLDGELTLADLPSELRAEGAEALRTI |
| Ga0066702_104837101 | 3300005575 | Soil | MTETFHPLVKRLLDGELSLGDLPPGLRGEGAEALRLLGAVDR |
| Ga0066691_100395695 | 3300005586 | Soil | MSAQYHPLVKRLLDGELSLAELPAELRAEGEQALRLIRGVDRAPV |
| Ga0066691_109163532 | 3300005586 | Soil | MTREFHPLVKRLLDGELTLGDLPLELRPEGEEALRLLAPLDR |
| Ga0066696_100374684 | 3300006032 | Soil | MTETFHPLVKRLLDGELSLGDLPPGLRGEGAEALRLLGAVDRTPVALSVQL |
| Ga0066653_101244003 | 3300006791 | Soil | MSGHDFSPLVKQLLDGDITLADLPSELRAEGEAARRLL |
| Ga0066659_100199461 | 3300006797 | Soil | MKTGYHALVKRLLDGELTLGELPPELRAEGEEALRLVG |
| Ga0066659_100608491 | 3300006797 | Soil | MSMSKTYHPLVKGLLDGERSLADLPPELRAEAEEAERLLGAVDRTP |
| Ga0066659_114133742 | 3300006797 | Soil | MTETFHPLVKRLLDGDLSLGDLPAGLRGEGAEALRLLGALDRTPVALSAQ |
| Ga0075425_1004409994 | 3300006854 | Populus Rhizosphere | MMGFDPMVKRLLDGELSLAGLPPELRAEGEEALRLVGAANRAPVALS |
| Ga0075426_104429121 | 3300006903 | Populus Rhizosphere | MTAGYHPLVKRLLDGELSLAGLPPELRAEGEEALRLVGAANRAP |
| Ga0075436_1006575362 | 3300006914 | Populus Rhizosphere | MTAGYHPLVKRLLDGELSLAGLPPELRAEGEEALRLVGAANRAPVA |
| Ga0075435_1009970072 | 3300007076 | Populus Rhizosphere | MSEREFHPLVKQLLDGDITLGELPAELRAEGEEALQLLGMVDRSAVA |
| Ga0075435_1013162111 | 3300007076 | Populus Rhizosphere | MSGNGFHPQVIQLLDGEITLADLPPALRAEGEEALRLLAAVDR |
| Ga0099791_100468175 | 3300007255 | Vadose Zone Soil | MKAYDPLVKRLLDGELTLAELPPELQAEGSEALRLLGAVDRR |
| Ga0099793_100001681 | 3300007258 | Vadose Zone Soil | MTKTYHPLVKRLLDGELSLSDLPLELRGEGAEALRLLGAVDRAP |
| Ga0066710_1009722061 | 3300009012 | Grasslands Soil | MSMSKTYHPLVKGLLDGERSLADLPPELRAEAEEAE |
| Ga0114129_133317192 | 3300009147 | Populus Rhizosphere | MTTGYHPLVKRLLDGELSLAELPPELRVEGEEALRLVGAADR |
| Ga0105067_10293851 | 3300009812 | Groundwater Sand | MSEPFHPLVKRLLDGELSLSELPPELVAQGAEAFRLLDAVDR |
| Ga0127484_10342782 | 3300010134 | Grasslands Soil | MSGHDFHPLVKQLLDGDITLADLPSELRVEGEAALRLLAAVDR |
| Ga0127484_11410902 | 3300010134 | Grasslands Soil | MTTGYHPLVKRLLDGELSLAELPPELQGEGEEALRLVGAADR |
| Ga0127483_11158012 | 3300010142 | Grasslands Soil | MTREFHPLVKRLLDGELTLGDLPLELRPEGEEALRLLAALDSTPVT |
| Ga0134109_100201311 | 3300010320 | Grasslands Soil | MTQAYHQLVKRLLDGELSLSDLPAELRAEGAEALRLLGTVDRTPV |
| Ga0134109_102865522 | 3300010320 | Grasslands Soil | MTETLHPLVKRLLDGELSLGDLPPELRGEGAAALRLL |
| Ga0134109_103332942 | 3300010320 | Grasslands Soil | MSDFHPLVKQLLDGELTLAELPAELRAEGEEALRLIGAVDR |
| Ga0134084_104602402 | 3300010322 | Grasslands Soil | MSEHEFHPLVKQLLDGDITLAALPPELRAEGEEALRLLAAVDRS |
| Ga0134063_105840511 | 3300010335 | Grasslands Soil | MSGYDFHPLVKQLLDGDLTLADLPVELRAEGEEALRLLTAVDRRP |
| Ga0134071_101630543 | 3300010336 | Grasslands Soil | MTTGYHPLVKRLLDGELSLADLPPELRVEGEDALRL |
| Ga0134071_106106011 | 3300010336 | Grasslands Soil | MGYHPLVKRLLDGELSLAELPPELRAEGEEALRLLGAVD |
| Ga0134125_114766661 | 3300010371 | Terrestrial Soil | MTTGYHPLVKRLLDGEVSLAELPPELRAEGEEALRL |
| Ga0134123_100381227 | 3300010403 | Terrestrial Soil | MSEREFHPLVKQLLDGDVTLADLPAELRAEGEEALLILGAVDRRPVQLGDF |
| Ga0138111_10706821 | 3300010896 | Grasslands Soil | MTTVYHPLVKRLLDGEVSLAELPRELQAEGEEALRLVGAADRAPVA |
| Ga0150983_114370681 | 3300011120 | Forest Soil | MTRDYHPLVKRLLDGEGTIADLPAELRAEGERALRVLGLVDRSPVVLSSAIEG |
| Ga0137382_103558281 | 3300012200 | Vadose Zone Soil | MTETFHSLVKRLLDRELSLSYLPPELRGEGAEALRLLGAVDR |
| Ga0137382_104477231 | 3300012200 | Vadose Zone Soil | MTKREFDPQVKQLLDGELTLADLPAELRQEGEEAL |
| Ga0137363_115784002 | 3300012202 | Vadose Zone Soil | MTESFHPVIKRLLDGELSRADVPAELRAEVEEALRLVTAVDRTEVRLT |
| Ga0137399_101512791 | 3300012203 | Vadose Zone Soil | MTDFHPQVRQLLDGDINLADLPPELRAEGEEALRLLAAVDREPVTLP |
| Ga0137374_104947341 | 3300012204 | Vadose Zone Soil | MTVADFDPRVKRLLDGELTLADLPSELRAEGQEALR |
| Ga0137370_109464602 | 3300012285 | Vadose Zone Soil | MTETLHPLVKRLLDGELSLGDLPPELRGEGAEALRLLGALDRT |
| Ga0137387_101474651 | 3300012349 | Vadose Zone Soil | MSGHELHPLVKQLLDGEITRADLPAELRAEGEAALRLLAGVDRTDV |
| Ga0137387_101709704 | 3300012349 | Vadose Zone Soil | MSKHEFHPLVKQLLDGDITLADLPPELRAEGDEALRLL |
| Ga0137366_101063101 | 3300012354 | Vadose Zone Soil | MSEYDFHPLVKQLLDGDITIADLPAELRAEGEEAL |
| Ga0137384_101447705 | 3300012357 | Vadose Zone Soil | MTEHEFHPLVKQLLDGDITLAALPPELRAEGKEAL |
| Ga0137385_101413431 | 3300012359 | Vadose Zone Soil | MTETFHSLVKRLLDGELSLSDLPPELRGEGAEALRLLGAVD |
| Ga0137375_106003721 | 3300012360 | Vadose Zone Soil | MSAKDFHPQVKQLLDGELTLADLPPELRAEGEEALHLLAGVDREPV |
| Ga0137361_110379761 | 3300012362 | Vadose Zone Soil | MSGHELHPLVKQLLDGDITLADLPAELRAEGEAAVR |
| Ga0134032_12433271 | 3300012376 | Grasslands Soil | MMASYHPLVKRLLDGEVSLAELPPELQAEGEEALRLV |
| Ga0134058_11914401 | 3300012379 | Grasslands Soil | MMAGYHPLVKQMLDGELSLADLPPELRGEGEEALRLVQAADRAPVALSP |
| Ga0134047_12029992 | 3300012380 | Grasslands Soil | MSAQYHPLVKRLLDGELSLAELPAELRAEGEQALR |
| Ga0134043_11123791 | 3300012392 | Grasslands Soil | MSAQYHPLVKRLLDGELSLAELPAELRAEGEQALRLIRGVDRAP |
| Ga0134044_10472451 | 3300012395 | Grasslands Soil | MSGYDFHPLVKQLLDGDLTLADLPVELRAEGEEALRLLPAVDRRAVE |
| Ga0134051_13356402 | 3300012398 | Grasslands Soil | MTETFHPLVKRLLDGELSLSDLPPELRGEGAEALRLLGAVDR |
| Ga0134048_13713371 | 3300012400 | Grasslands Soil | MTETFHPLVKRLLDGELSLGDLPPGLRGEGAEALRLLGAVDRTPVALSVQLE |
| Ga0134049_12439602 | 3300012403 | Grasslands Soil | MSAQYHPLVKRLLDGELSLAELPAELRAEGEQALRLIR |
| Ga0134050_14463082 | 3300012407 | Grasslands Soil | MSAQYHPLVNRLLDGEPSLAELPAELRAEGEQALRLIRGVDRAPVTLPATLDRA* |
| Ga0134045_11154441 | 3300012409 | Grasslands Soil | MTTGYHPLVKRVLDGELSLAELPPELRAEGEDALRLVAAVDRAP |
| Ga0137373_100300601 | 3300012532 | Vadose Zone Soil | MITGYHPLVKRLLDGELSLAELPPELRAEGEEALRLAGAADRAPVALS |
| Ga0137395_101885881 | 3300012917 | Vadose Zone Soil | MSGYEFHPLVKQLLDGDITLADLPAELRAEGEEALQL |
| Ga0137416_109673161 | 3300012927 | Vadose Zone Soil | MTTGYHPLVKRLLDGELSLAELPPELRAEGEEALHLVGAADRAPVA |
| Ga0137407_118970221 | 3300012930 | Vadose Zone Soil | MTTGYHPLVKRLLDGELSLAELPPELRAEGEEALH |
| Ga0137410_100618851 | 3300012944 | Vadose Zone Soil | MSGHEFHPLIKQLLDGDITLADLPPELRGEGEAALRLLAAVDRT |
| Ga0134110_103126291 | 3300012975 | Grasslands Soil | MTETLHPLVKRLLDGELSLGDLPPELRGEGAEALRLL |
| Ga0134076_100863114 | 3300012976 | Grasslands Soil | MNEREFHPEVRRLLDGEITIAELPLELRVEGEEALRLLAAV |
| Ga0134081_100079445 | 3300014150 | Grasslands Soil | MGYHPLVKRLLDGELSLAELPPELRAEGEEALRLLGAVDRAPVALS |
| Ga0134075_101642562 | 3300014154 | Grasslands Soil | MMAGYHPLVKQMLDGELSLADLPPELRGEGEEALRLVQAAD |
| Ga0134078_100344264 | 3300014157 | Grasslands Soil | MSLGYHPLVKRLLDGELSLAELPPELRAEGAEALRLVGAVDCT |
| Ga0134085_100952291 | 3300015359 | Grasslands Soil | MTKHEFDPQVRQLLDGELTLADLPAELRQEGEEALRLLAAVDREPV |
| Ga0132257_1007495941 | 3300015373 | Arabidopsis Rhizosphere | MSEREFHPLVKQLLDGDITLADLPAELRAEGEEALRILAAVDR |
| Ga0134074_10090453 | 3300017657 | Grasslands Soil | MSERDFHPLVKQLLDGEVTIADLPAELRAEGEEALRLLTGVDRSPVELPP |
| Ga0134083_101616362 | 3300017659 | Grasslands Soil | MSEAFHPLVKQLLDGEITLAELPPELRTEGAAALRLLAAV |
| Ga0184618_103573651 | 3300018071 | Groundwater Sediment | LTMTDFHPQVKQLLDGEITLADLPPELRAEGEEALRL |
| Ga0184612_104095822 | 3300018078 | Groundwater Sediment | LTMTDFHPQVKQLLDGEITLADLPPELRAEGEEALHLLAA |
| Ga0066655_102370083 | 3300018431 | Grasslands Soil | MSKAYHPQVKALLDGERSLADLPPELRAESDEAERLLGAVDRT |
| Ga0066655_110471831 | 3300018431 | Grasslands Soil | MSEHEFHPLVKQLLDGDITLAALPPELRAEGEEALRLLAAVDRSVV |
| Ga0066662_118881841 | 3300018468 | Grasslands Soil | MTTGYHPLVKGLLDGELSLAELPPELRAEGEEALRLVG |
| Ga0066662_122959301 | 3300018468 | Grasslands Soil | MTREFHPLVKRLLDGELTLGDLPLELRPEAEEALRMLAALDRTPVTLSP |
| Ga0066669_110127781 | 3300018482 | Grasslands Soil | MTETFHPLVKRLLDGELSLSDLPLELRGEGAEALRLLG |
| Ga0066669_117655771 | 3300018482 | Grasslands Soil | MMASYHPLVKRLLDGEVSLAELPPELQAEGEEALRLVGAA |
| Ga0184648_11904981 | 3300019249 | Groundwater Sediment | LTMTDFHPQVKQLLDGELTLADLPPELRAEGEEALRLLAAVDR |
| Ga0184643_14576231 | 3300019255 | Groundwater Sediment | VTMIEFHPLVKQLLDGELTLADLPPELRRQGEAALRLLAAVDREPV |
| Ga0184646_14493811 | 3300019259 | Groundwater Sediment | LTMTDFHPQVKQLLDGELTLADLPPELRAEGEAALRLLAAVDREPVTFP |
| Ga0179594_100199625 | 3300020170 | Vadose Zone Soil | MTTGYHPLVKRLLDGELSLAELPPELRAEGEEALRLVGAANRAPV |
| Ga0179594_101878461 | 3300020170 | Vadose Zone Soil | MSGYEFHPLVKQLLDGEITLADLPAELRAEGDEALQLLAGVE |
| Ga0222625_12278381 | 3300022195 | Groundwater Sediment | MTKSDFHPQVKQLLDGELTLADLPPELRVEGEEALHLLAAVDREPVTFPG |
| Ga0209641_101375754 | 3300025322 | Soil | MTMTDFHPQVKRLLDGELTLADLRPELRAEGEEALRLLAA |
| Ga0209238_11931991 | 3300026301 | Grasslands Soil | MNEREFHPEVRRLLDGEITIADLPLELRVEGEEALRLLA |
| Ga0209468_10176811 | 3300026306 | Soil | MSGHDFHPLVKQLLDGDITLADLPSELRVEGEAALRLLAAV |
| Ga0209055_11852242 | 3300026309 | Soil | MSHGYHPLVKQLLDGELSLAQLPPELRAEGAEALRLVGAVDRTP |
| Ga0209239_10337825 | 3300026310 | Grasslands Soil | MTREFHPLVKRLLDGELTLGELPLELRPEGEEALRLLAPLDR |
| Ga0209761_10986091 | 3300026313 | Grasslands Soil | MTETFHPLVKRLLDGELSLSDLPPELRGEGAEALGLLGA |
| Ga0209472_10166005 | 3300026323 | Soil | MTQAYHQLVKRLLDGELSLSDLPPELRAEGAEALRLLGA |
| Ga0209375_10919991 | 3300026329 | Soil | MSMSKTYHPLVKGLLDGERSLADLPPELRAEAEEAERLLGAVDRT |
| Ga0209267_10977871 | 3300026331 | Soil | MSLGYHPLVKQLLDGELSLAELPPELRAEGAEALRLIGAVDRAPVVL |
| Ga0209803_11584962 | 3300026332 | Soil | MTETFHSLVKRLLDGELSLSDLPPELRGEGAEALRLLGAVDR |
| Ga0209158_10307563 | 3300026333 | Soil | MTETFHPLVKRLLDGELSLSDLPPELRGEGAEALGLLGAVDRAPVALSAAFE |
| Ga0209158_12031681 | 3300026333 | Soil | MSAQYHPLVKRLLDGELSLAELPAELRAEGEQALRLIRGVDRA |
| Ga0209058_10519001 | 3300026536 | Soil | MNEREFHPEVRRLLDGEITIADLPLELRVEGEEALRLLAA |
| Ga0209058_11524241 | 3300026536 | Soil | MTREFHPLVKRVLDGELTLGDLPLELRPEAEEALRMLA |
| Ga0209897_10143721 | 3300027169 | Groundwater Sand | VTNPLIKRLLDGEIELADLPPELRSEGERALRLLDRL |
| Ga0209106_10984831 | 3300027616 | Forest Soil | MMKTYHPQVKRLLDGELTLADLPRELRAEGEEALRPVAAVDRAPVT |
| Ga0209180_103560271 | 3300027846 | Vadose Zone Soil | MNAYDPLVKQLLDGELTLAELPPELQAEASEALRLLAAVDRRA |
| Ga0137415_106668862 | 3300028536 | Vadose Zone Soil | MTDFHPQVKQVLDGELTLAQLPPELRAQGEEAVRLLAAVDREPVTLPDTLD |
| Ga0307293_101759141 | 3300028711 | Soil | LTMTDFHPQVKQLLDGEITLADLPPELRAEGEEALRLLAAVDREPVTFPAL |
| Ga0308203_10392491 | 3300030829 | Soil | MSGKDFHPQVKQLLDGEITLADLPSALRAEGEEALHLLAAVDREPVTFP |
| Ga0308206_11468311 | 3300030903 | Soil | MTSDFHPQVKQLLDGELALADLPPELRAEGEEALRLL |
| Ga0308198_10449751 | 3300030904 | Soil | MTMSDFHPQVKQLLDGELTLADLPPELRAEGEEALHLLVAV |
| Ga0308155_10143481 | 3300030987 | Soil | MSGNSFNPQVKQLLDGEITLADLPPALRAEGEEALHLLAAVDR |
| Ga0308187_102210012 | 3300031114 | Soil | LTMTDFHPQVKQLLDGEITLADLPPELRAEGEEALRLLAAVD |
| Ga0308194_101399341 | 3300031421 | Soil | MTDFHPQVKQLLDGELTLADLAPELRAEGEEALRLLAAVDREPVTLPGTLGA |
| Ga0308179_10257602 | 3300031424 | Soil | MTDFHPQVKQLLDGEITLADLPPELRAEGEEALRLLAAVD |
| Ga0307469_105554673 | 3300031720 | Hardwood Forest Soil | MTKREFDPQVKQLLDGELTLADLPAELRQEGEEALRL |
| Ga0307469_112994912 | 3300031720 | Hardwood Forest Soil | MSLGYHPLVKQLLDGELSLADLPLELRAEGAEALRLIGAVDRTSVVLS |
| Ga0307468_1011483171 | 3300031740 | Hardwood Forest Soil | MAGYHPLVKQVLDGELSLADLPRDLRAEGEEAVRLIQAAN |
| Ga0307477_105690312 | 3300031753 | Hardwood Forest Soil | MTRSYHPLVKRLLDGEVSLADLPLELRAEGEDALRW |
| Ga0307471_1036604361 | 3300032180 | Hardwood Forest Soil | MSLGYHPLVKQLLDGELSLAELPPELRAEGAVALRLVG |
| Ga0307472_1009690961 | 3300032205 | Hardwood Forest Soil | MTEQYHPLIKQLLDGELSLAELPPGLKAEGERALQLLAAVD |
| Ga0214471_100626046 | 3300033417 | Soil | MTQRAFHPLVKLLLDGDITLADLPADLRAEGEEALRLLGAIDRT |
| ⦗Top⦘ |