


| Basic Information | |
|---|---|
| Family ID | F051796 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 143 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MSNTTFSRRLQQLIKQVENHPNRDEIIKLAQEQLIDDTFTITS |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 143 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 4.20 % |
| % of genes near scaffold ends (potentially truncated) | 33.57 % |
| % of genes from short scaffolds (< 2000 bps) | 70.63 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Predicted Viral (37.762 % of family members) |
| NCBI Taxonomy ID | 10239 (predicted) |
| Taxonomy | All Organisms → Viruses → Predicted Viral |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (21.678 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.860 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (39.161 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.70% β-sheet: 0.00% Coil/Unstructured: 49.30% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 143 Family Scaffolds |
|---|---|---|
| PF14700 | RPOL_N | 26.57 |
| PF05367 | Phage_endo_I | 1.40 |
| PF13155 | Toprim_2 | 1.40 |
| PF00476 | DNA_pol_A | 1.40 |
| PF00589 | Phage_integrase | 1.40 |
| PF13529 | Peptidase_C39_2 | 0.70 |
| PF02511 | Thy1 | 0.70 |
| PF14279 | HNH_5 | 0.70 |
| PF13482 | RNase_H_2 | 0.70 |
| PF10991 | DUF2815 | 0.70 |
| PF00940 | RNA_pol | 0.70 |
| COG ID | Name | Functional Category | % Frequency in 143 Family Scaffolds |
|---|---|---|---|
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 1.40 |
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 0.70 |
| COG5108 | Mitochondrial DNA-directed RNA polymerase | Transcription [K] | 0.70 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.61 % |
| Unclassified | root | N/A | 8.39 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000126|BS_KBB_SWE26_205mDRAFT_c1075794 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 534 | Open in IMG/M |
| 3300000792|BS_KBA_SWE02_21mDRAFT_10157294 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 558 | Open in IMG/M |
| 3300000792|BS_KBA_SWE02_21mDRAFT_10164869 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 543 | Open in IMG/M |
| 3300000882|FwDRAFT_10000650 | Not Available | 8107 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_107075234 | Not Available | 627 | Open in IMG/M |
| 3300002835|B570J40625_100297412 | All Organisms → Viruses → Predicted Viral | 1639 | Open in IMG/M |
| 3300003413|JGI25922J50271_10121741 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → unclassified Autographiviridae → Synechococcus phage S-CBP1 | 549 | Open in IMG/M |
| 3300003430|JGI25921J50272_10015987 | All Organisms → Viruses → Predicted Viral | 2103 | Open in IMG/M |
| 3300004112|Ga0065166_10006667 | All Organisms → Viruses → Predicted Viral | 2944 | Open in IMG/M |
| 3300004240|Ga0007787_10430587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → unclassified Autographiviridae → Synechococcus phage S-CBP1 | 658 | Open in IMG/M |
| 3300005662|Ga0078894_10009064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 7763 | Open in IMG/M |
| 3300005662|Ga0078894_10279124 | Not Available | 1516 | Open in IMG/M |
| 3300005662|Ga0078894_10985389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 726 | Open in IMG/M |
| 3300005805|Ga0079957_1022936 | All Organisms → Viruses → Predicted Viral | 4298 | Open in IMG/M |
| 3300005805|Ga0079957_1230674 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 872 | Open in IMG/M |
| 3300005833|Ga0074472_11509060 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → unclassified Autographiviridae → Synechococcus phage S-CBP1 | 500 | Open in IMG/M |
| 3300006033|Ga0075012_10816306 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 563 | Open in IMG/M |
| 3300006802|Ga0070749_10000182 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 38665 | Open in IMG/M |
| 3300006802|Ga0070749_10014289 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 5069 | Open in IMG/M |
| 3300006802|Ga0070749_10181616 | All Organisms → Viruses → Predicted Viral | 1211 | Open in IMG/M |
| 3300006802|Ga0070749_10476736 | All Organisms → Viruses | 682 | Open in IMG/M |
| 3300007538|Ga0099851_1088015 | All Organisms → Viruses → Predicted Viral | 1192 | Open in IMG/M |
| 3300007538|Ga0099851_1320528 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 544 | Open in IMG/M |
| 3300007541|Ga0099848_1065565 | All Organisms → Viruses → Predicted Viral | 1437 | Open in IMG/M |
| 3300007541|Ga0099848_1208573 | All Organisms → Viruses | 698 | Open in IMG/M |
| 3300007542|Ga0099846_1329922 | All Organisms → Viruses | 519 | Open in IMG/M |
| 3300007551|Ga0102881_1180166 | All Organisms → Viruses | 584 | Open in IMG/M |
| 3300007593|Ga0102918_1047617 | All Organisms → Viruses → Predicted Viral | 1230 | Open in IMG/M |
| 3300007600|Ga0102920_1000242 | Not Available | 13460 | Open in IMG/M |
| 3300007600|Ga0102920_1229011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → unclassified Autographiviridae → Synechococcus phage S-CBP1 | 598 | Open in IMG/M |
| 3300007621|Ga0102872_1047646 | All Organisms → Viruses → Predicted Viral | 1172 | Open in IMG/M |
| 3300007642|Ga0102876_1206114 | All Organisms → Viruses | 520 | Open in IMG/M |
| 3300008055|Ga0108970_10080688 | All Organisms → Viruses → Predicted Viral | 1183 | Open in IMG/M |
| 3300008107|Ga0114340_1033874 | All Organisms → Viruses → Predicted Viral | 3191 | Open in IMG/M |
| 3300008107|Ga0114340_1066260 | All Organisms → Viruses | 1535 | Open in IMG/M |
| 3300008114|Ga0114347_1034927 | All Organisms → Viruses → Predicted Viral | 2245 | Open in IMG/M |
| 3300008262|Ga0114337_1081571 | All Organisms → Viruses → Predicted Viral | 1564 | Open in IMG/M |
| 3300008266|Ga0114363_1021666 | All Organisms → Viruses → Predicted Viral | 2822 | Open in IMG/M |
| 3300008266|Ga0114363_1139705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS2 | 816 | Open in IMG/M |
| 3300008266|Ga0114363_1176690 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 681 | Open in IMG/M |
| 3300008996|Ga0102831_1003931 | Not Available | 5788 | Open in IMG/M |
| 3300009009|Ga0105105_10627231 | All Organisms → Viruses | 631 | Open in IMG/M |
| 3300009057|Ga0102892_1008431 | All Organisms → Viruses → Predicted Viral | 1933 | Open in IMG/M |
| 3300009075|Ga0105090_10954208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 523 | Open in IMG/M |
| 3300009111|Ga0115026_10059099 | All Organisms → Viruses → Predicted Viral | 2164 | Open in IMG/M |
| 3300009165|Ga0105102_10310776 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 818 | Open in IMG/M |
| 3300009169|Ga0105097_10256030 | Not Available | 965 | Open in IMG/M |
| 3300009169|Ga0105097_10321640 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → unclassified Autographiviridae → Synechococcus phage S-CBP1 | 856 | Open in IMG/M |
| 3300010354|Ga0129333_10025669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → unclassified Autographiviridae → Synechococcus phage S-CBP1 | 5584 | Open in IMG/M |
| 3300010354|Ga0129333_10139643 | All Organisms → Viruses → Predicted Viral | 2226 | Open in IMG/M |
| 3300010354|Ga0129333_10163989 | All Organisms → Viruses → Predicted Viral | 2035 | Open in IMG/M |
| 3300010354|Ga0129333_10203636 | All Organisms → Viruses → Predicted Viral | 1799 | Open in IMG/M |
| 3300010354|Ga0129333_10250161 | All Organisms → Viruses → Predicted Viral | 1598 | Open in IMG/M |
| 3300010354|Ga0129333_10274432 | All Organisms → Viruses → Predicted Viral | 1514 | Open in IMG/M |
| 3300010354|Ga0129333_10559971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → unclassified Autographiviridae → Synechococcus phage S-CBP1 | 996 | Open in IMG/M |
| 3300010354|Ga0129333_10615223 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 941 | Open in IMG/M |
| 3300010354|Ga0129333_11217803 | All Organisms → Viruses | 625 | Open in IMG/M |
| 3300010354|Ga0129333_11252580 | All Organisms → Viruses | 614 | Open in IMG/M |
| 3300011268|Ga0151620_1002862 | All Organisms → Viruses | 6467 | Open in IMG/M |
| 3300011268|Ga0151620_1128336 | Not Available | 788 | Open in IMG/M |
| 3300011984|Ga0119931_1029238 | All Organisms → Viruses | 648 | Open in IMG/M |
| 3300017707|Ga0181363_1001213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 6263 | Open in IMG/M |
| 3300017707|Ga0181363_1005819 | All Organisms → Viruses → Predicted Viral | 2656 | Open in IMG/M |
| 3300017707|Ga0181363_1009335 | All Organisms → Viruses → Predicted Viral | 2033 | Open in IMG/M |
| 3300017747|Ga0181352_1103112 | All Organisms → Viruses | 781 | Open in IMG/M |
| 3300017747|Ga0181352_1193444 | All Organisms → Viruses | 525 | Open in IMG/M |
| 3300017754|Ga0181344_1078632 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → unclassified Autographiviridae → Synechococcus phage S-CBP1 | 968 | Open in IMG/M |
| 3300017766|Ga0181343_1138519 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → unclassified Autographiviridae → Synechococcus phage S-CBP1 | 680 | Open in IMG/M |
| 3300017766|Ga0181343_1195068 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 556 | Open in IMG/M |
| 3300017785|Ga0181355_1047902 | All Organisms → Viruses → Predicted Viral | 1819 | Open in IMG/M |
| 3300017785|Ga0181355_1177254 | All Organisms → Viruses | 848 | Open in IMG/M |
| 3300017785|Ga0181355_1225402 | All Organisms → Viruses | 727 | Open in IMG/M |
| 3300019201|Ga0180032_1105093 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → unclassified Autographiviridae → Synechococcus phage S-CBP1 | 506 | Open in IMG/M |
| 3300019784|Ga0181359_1170974 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 727 | Open in IMG/M |
| 3300019784|Ga0181359_1187183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 678 | Open in IMG/M |
| 3300019784|Ga0181359_1233333 | All Organisms → Viruses | 570 | Open in IMG/M |
| 3300020141|Ga0211732_1004427 | All Organisms → Viruses | 45427 | Open in IMG/M |
| 3300020159|Ga0211734_10047421 | All Organisms → Viruses → Predicted Viral | 4961 | Open in IMG/M |
| 3300020161|Ga0211726_10172490 | All Organisms → Viruses → Predicted Viral | 3012 | Open in IMG/M |
| 3300020172|Ga0211729_10705209 | All Organisms → Viruses → Predicted Viral | 4221 | Open in IMG/M |
| 3300020172|Ga0211729_10857169 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → unclassified Autographiviridae → Synechococcus phage S-CBP1 | 780 | Open in IMG/M |
| 3300020172|Ga0211729_11281441 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → unclassified Autographiviridae → Synechococcus phage S-CBP1 | 628 | Open in IMG/M |
| 3300020547|Ga0208361_1000908 | All Organisms → Viruses | 6643 | Open in IMG/M |
| 3300021323|Ga0210295_1175775 | All Organisms → Viruses → Predicted Viral | 4325 | Open in IMG/M |
| 3300021963|Ga0222712_10507703 | All Organisms → Viruses | 712 | Open in IMG/M |
| 3300022063|Ga0212029_1052992 | All Organisms → Viruses | 588 | Open in IMG/M |
| 3300022179|Ga0181353_1013720 | All Organisms → Viruses → Predicted Viral | 2081 | Open in IMG/M |
| 3300022179|Ga0181353_1019934 | All Organisms → Viruses → Predicted Viral | 1761 | Open in IMG/M |
| 3300022190|Ga0181354_1034409 | All Organisms → Viruses → Predicted Viral | 1666 | Open in IMG/M |
| 3300022190|Ga0181354_1228074 | All Organisms → Viruses | 541 | Open in IMG/M |
| 3300022198|Ga0196905_1096232 | Not Available | 794 | Open in IMG/M |
| 3300022407|Ga0181351_1067816 | All Organisms → Viruses → Predicted Viral | 1451 | Open in IMG/M |
| 3300022407|Ga0181351_1201868 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 663 | Open in IMG/M |
| 3300024343|Ga0244777_10002250 | All Organisms → Viruses | 13427 | Open in IMG/M |
| 3300024346|Ga0244775_10038268 | All Organisms → Viruses → Predicted Viral | 4235 | Open in IMG/M |
| 3300025646|Ga0208161_1043286 | All Organisms → Viruses → Predicted Viral | 1494 | Open in IMG/M |
| 3300025647|Ga0208160_1049703 | All Organisms → Viruses → Predicted Viral | 1197 | Open in IMG/M |
| 3300025889|Ga0208644_1000164 | All Organisms → Viruses | 45585 | Open in IMG/M |
| 3300025889|Ga0208644_1023567 | All Organisms → Viruses → Predicted Viral | 3827 | Open in IMG/M |
| 3300025889|Ga0208644_1053923 | All Organisms → Viruses → Predicted Viral | 2209 | Open in IMG/M |
| 3300026425|Ga0256300_1058108 | Not Available | 554 | Open in IMG/M |
| 3300027131|Ga0255066_1001803 | All Organisms → Viruses → Predicted Viral | 3802 | Open in IMG/M |
| 3300027218|Ga0208165_1060068 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → unclassified Autographiviridae → Synechococcus phage S-CBP1 | 547 | Open in IMG/M |
| 3300027494|Ga0255094_1032887 | All Organisms → Viruses → Predicted Viral | 1023 | Open in IMG/M |
| 3300027579|Ga0255068_104458 | All Organisms → Viruses → Predicted Viral | 1801 | Open in IMG/M |
| 3300027697|Ga0209033_1256689 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 502 | Open in IMG/M |
| 3300027721|Ga0209492_1145582 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 828 | Open in IMG/M |
| 3300027762|Ga0209288_10244325 | All Organisms → Viruses | 592 | Open in IMG/M |
| 3300027769|Ga0209770_10002139 | All Organisms → Viruses | 9915 | Open in IMG/M |
| 3300027793|Ga0209972_10131236 | Not Available | 1220 | Open in IMG/M |
| 3300027793|Ga0209972_10143980 | All Organisms → Viruses → Predicted Viral | 1148 | Open in IMG/M |
| 3300028266|Ga0255227_1078071 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 517 | Open in IMG/M |
| 3300031758|Ga0315907_10678677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 787 | Open in IMG/M |
| 3300031784|Ga0315899_10081891 | All Organisms → Viruses → Predicted Viral | 3338 | Open in IMG/M |
| 3300031784|Ga0315899_10159018 | Not Available | 2299 | Open in IMG/M |
| 3300031784|Ga0315899_10191040 | All Organisms → Viruses → Predicted Viral | 2069 | Open in IMG/M |
| 3300031784|Ga0315899_11059332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 715 | Open in IMG/M |
| 3300031784|Ga0315899_11095982 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 699 | Open in IMG/M |
| 3300031857|Ga0315909_10100685 | All Organisms → Viruses → Predicted Viral | 2491 | Open in IMG/M |
| 3300031857|Ga0315909_10304175 | All Organisms → Viruses → Predicted Viral | 1190 | Open in IMG/M |
| 3300031951|Ga0315904_10275046 | All Organisms → Viruses → Predicted Viral | 1595 | Open in IMG/M |
| 3300031951|Ga0315904_10365977 | All Organisms → Viruses → Predicted Viral | 1320 | Open in IMG/M |
| 3300031951|Ga0315904_10875683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS2 | 728 | Open in IMG/M |
| 3300031951|Ga0315904_11065326 | All Organisms → Viruses | 634 | Open in IMG/M |
| 3300031963|Ga0315901_10690535 | Not Available | 758 | Open in IMG/M |
| 3300032116|Ga0315903_10504116 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 955 | Open in IMG/M |
| 3300033482|Ga0316627_101130559 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → unclassified Autographiviridae → Synechococcus phage S-CBP1 | 770 | Open in IMG/M |
| 3300033521|Ga0316616_101835570 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 798 | Open in IMG/M |
| 3300033521|Ga0316616_104674820 | All Organisms → Viruses | 515 | Open in IMG/M |
| 3300033557|Ga0316617_100719536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → unclassified Autographiviridae → Synechococcus phage S-CBP1 | 945 | Open in IMG/M |
| 3300033557|Ga0316617_100852895 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → unclassified Autographiviridae → Synechococcus phage S-CBP1 | 877 | Open in IMG/M |
| 3300033816|Ga0334980_0069227 | All Organisms → Viruses → Predicted Viral | 1482 | Open in IMG/M |
| 3300033981|Ga0334982_0125338 | All Organisms → Viruses → Predicted Viral | 1330 | Open in IMG/M |
| 3300033994|Ga0334996_0396379 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 650 | Open in IMG/M |
| 3300034018|Ga0334985_0177928 | All Organisms → Viruses → Predicted Viral | 1427 | Open in IMG/M |
| 3300034061|Ga0334987_0003067 | All Organisms → Viruses | 16080 | Open in IMG/M |
| 3300034061|Ga0334987_0035258 | All Organisms → Viruses → Predicted Viral | 4317 | Open in IMG/M |
| 3300034061|Ga0334987_0268293 | All Organisms → Viruses → Predicted Viral | 1152 | Open in IMG/M |
| 3300034061|Ga0334987_0579310 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → unclassified Autographiviridae → Synechococcus phage S-CBP1 | 667 | Open in IMG/M |
| 3300034066|Ga0335019_0041300 | All Organisms → Viruses → Predicted Viral | 3171 | Open in IMG/M |
| 3300034200|Ga0335065_0513314 | All Organisms → Viruses | 714 | Open in IMG/M |
| 3300034272|Ga0335049_0003868 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 11061 | Open in IMG/M |
| 3300034272|Ga0335049_0223294 | All Organisms → Viruses → Predicted Viral | 1310 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 21.68% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 11.19% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 9.79% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.39% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 8.39% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 6.99% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.90% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.20% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.50% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.50% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.40% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.40% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.40% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 1.40% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.70% |
| Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.70% |
| Drinking Water Treatment Plant | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Drinking Water Treatment Plant | 0.70% |
| Watersheds | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Watersheds | 0.70% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.70% |
| Marine | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine | 0.70% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.70% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.70% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.70% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.70% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000126 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBB sample SWE 26_20.5m | Environmental | Open in IMG/M |
| 3300000792 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 02_21m | Environmental | Open in IMG/M |
| 3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
| 3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300006033 | Freshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007551 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 | Environmental | Open in IMG/M |
| 3300007593 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 | Environmental | Open in IMG/M |
| 3300007600 | Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3 | Environmental | Open in IMG/M |
| 3300007621 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3 | Environmental | Open in IMG/M |
| 3300007642 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3 | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009057 | Estuarine microbial communities from the Columbia River estuary - metaG 1553A-3 | Environmental | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300011984 | Freshwater microbial communities from drinking water treatment plant - The University of Hong Kong - Raw_water_201107 | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019201 | Estuarine microbial communities from the Columbia River estuary - R6.10AS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020547 | Freshwater microbial communities from Lake Mendota, WI - 05AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021323 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R9.63AS (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026425 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027131 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300027218 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027494 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8d | Environmental | Open in IMG/M |
| 3300027579 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8h | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027762 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028266 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BS_KBB_SWE26_205mDRAFT_10757943 | 3300000126 | Marine | MTNATFSRRLQQLIQQVENHPHRDEIIKLAQEQLI |
| BS_KBA_SWE02_21mDRAFT_101572942 | 3300000792 | Marine | MSNTTFSRRLAQLIKQVENHPNRDEIIKLAQEQMIDDSEFTRCVHFVHTH* |
| BS_KBA_SWE02_21mDRAFT_101648693 | 3300000792 | Marine | MSKTTFNRRLQQLIQQVENHPHRDEIIKLAQEQLIDDN |
| FwDRAFT_1000065010 | 3300000882 | Freshwater And Marine | MSDYTFSRRLQQLIEQVENHPNRDEIIKLAQEQLVDDTFTTERN* |
| JGIcombinedJ13530_1070752342 | 3300001213 | Wetland | LSMSNTTFSRRLQQLIKQVENHPNRDEIIKLAQEQLIDDTFTITSGN* |
| B570J40625_1002974122 | 3300002835 | Freshwater | MSNTTFSRRLQQLIKQVENHPNRDEIIKLAQEQLIDDTFTITSVN* |
| JGI25922J50271_101217412 | 3300003413 | Freshwater Lake | MTNTTYSRRLSQLIKQVKDHPNRDEILKLAQEQLVDEAEFTIIRN* |
| JGI25921J50272_100159872 | 3300003430 | Freshwater Lake | MTDTTYSRRLSQLIKQVKDHPNRDEILKLAQEQLIDEAEFTIIRN* |
| Ga0065166_1000666710 | 3300004112 | Freshwater Lake | MSDYTFSRRLQQLIKQVENHPNRDEIIKLAQEQLVDDSFTIIENN* |
| Ga0007787_104305871 | 3300004240 | Freshwater Lake | MSDATFSRRLQQLIAQVENHPHRDEILQLALEQLADDEDLQQD |
| Ga0078894_1000906416 | 3300005662 | Freshwater Lake | MTDTTFSRRLSQLIKQVKNHPNRDEILKLAQEQLIDEAEFTIIRN* |
| Ga0078894_102791243 | 3300005662 | Freshwater Lake | MSEVTFSRRLQQLIAQVENHPHRDEILQLALEQLADDEDLQQG* |
| Ga0078894_109853893 | 3300005662 | Freshwater Lake | MSEVTFSRRLQQLIAQVENHPNRDEIIQLALEQLADDEDLQQG*SHDRSTRTHPN |
| Ga0079957_10229367 | 3300005805 | Lake | MNNTTYSRRLSQLIKQVKNHPNRDEIIKLAQEQLIDDTFTIIARN* |
| Ga0079957_12306743 | 3300005805 | Lake | MSNTTFSRRLQQLIKQVENHPNRDEIIKLAQEQLIDDTFTITTDN* |
| Ga0074472_115090602 | 3300005833 | Sediment (Intertidal) | MSDYTFSRRLQQLIEQVENHPNRDEIIRLAQEQLVDESEFTITE |
| Ga0075012_108163061 | 3300006033 | Watersheds | MSNTTFSRRLQQLIKQVENHPNRDEIIKLAQEQLVDDSFTIIENN* |
| Ga0070749_1000018246 | 3300006802 | Aqueous | MSEYTFSRRLQELIKQVENHPNRDEIIKLAEEQLVDDTFTITRN* |
| Ga0070749_100142897 | 3300006802 | Aqueous | MSNTTFSRRLAQLIKQVENHPNRDEIIKLAQEQLIDDNKFTITND* |
| Ga0070749_101816167 | 3300006802 | Aqueous | MSNTTFSRRLQQLIKQVENHPNRDEVIKLAQEQLIDDTFTI |
| Ga0070749_104767361 | 3300006802 | Aqueous | MTNKTFSRRLAQLIQQVENHPNRDEIIKLAKEQLIDEAEFTIIARN* |
| Ga0099851_10880153 | 3300007538 | Aqueous | MNNTTYSRRLSQLIKQVKNHPNRDEIIKLAQEQLIDDTFTIIARK* |
| Ga0099851_13205282 | 3300007538 | Aqueous | MSNTTFSRRLQQLIKQVENHPDRDEIIKLAQEQLIDDTFTITTDN* |
| Ga0099848_10655654 | 3300007541 | Aqueous | MSNTTFSRRLQQLIKQVENHPNRDEIIKLAQEQLVDDTFTITSVN* |
| Ga0099848_12085733 | 3300007541 | Aqueous | MSNTTFSRRLHQLIKQVENHPNRDEIIKLAQEQLIDDTFTITTDN* |
| Ga0099846_13299221 | 3300007542 | Aqueous | MSNTTFSRRLQQLIKQVENHPNRDEIIKLAQEQLVDDS |
| Ga0102881_11801662 | 3300007551 | Estuarine | MSSTTFSRRLAQLIKQVENHPNRDEIIKLAQEQLIDDNEFTITNN* |
| Ga0102918_10476172 | 3300007593 | Estuarine | MSDYTFSRRLAQLIKQVENHPNRDEIIKLAQEQLIDDNEFTITNN* |
| Ga0102920_100024215 | 3300007600 | Estuarine | MSDYTFSRRLAQLIKQVENHPNRDEIIKLAQEQLIDDSEFTITNN* |
| Ga0102920_12290111 | 3300007600 | Estuarine | MTDHVFSVRLQQLIAQLENHPNKDEILELAFEQLADDNDKVQQH* |
| Ga0102872_10476462 | 3300007621 | Estuarine | SDYTFSRRLQQLIEQVENHPNRDEIIKLAQEQLVDDTFTTERN* |
| Ga0102876_12061141 | 3300007642 | Estuarine | MSSTTFSRRLAQLIKQVENHPNRDEIIKLAQEQLIDDN |
| Ga0108970_100806882 | 3300008055 | Estuary | MTNKTFSRRLTQLIEQVENHPHRDEIIKLAQEQLIDDSEFTVTEN* |
| Ga0114340_103387412 | 3300008107 | Freshwater, Plankton | MTDVTFSRRLQQLIKQVKNHPNRDEIIKLAQEQLIDDSFTLTNN* |
| Ga0114340_10662602 | 3300008107 | Freshwater, Plankton | MSDYTFAVRLQQLIAQLENHPNRDEILELANEQFIDDTYTIDSH* |
| Ga0114347_10349272 | 3300008114 | Freshwater, Plankton | MSDATFSRRLQQLIAQVENHPHRDEILQLALEQLADDEDLQQD* |
| Ga0114337_10815711 | 3300008262 | Freshwater, Plankton | AQLIQQLENHPHRDEIIKLAQEQMIDDNEFVHFVHTH* |
| Ga0114363_10216665 | 3300008266 | Freshwater, Plankton | MSNTTFSRRLAQLIQQLENHPHRDEIIKLAQEQMIDDNEFVHFVHTH* |
| Ga0114363_11397051 | 3300008266 | Freshwater, Plankton | MTSTTFSRRLAQLIQQLENHPHRDEIIKLAQEQMIDDNEFTLTEN* |
| Ga0114363_11766902 | 3300008266 | Freshwater, Plankton | MSNYTFSRRLAQLIAEVENHPNRDEIIKLAQEQMIDDNEFTLTND* |
| Ga0102831_10039317 | 3300008996 | Estuarine | MSDYTFSRHLQQLIEQVENHPNRDEIIKLAQEQLVDDTFTTERN* |
| Ga0105105_106272313 | 3300009009 | Freshwater Sediment | MSDYTFSRRLQQLIKQVENHPNRDEIIKLAQEQLVDDSFTIIADN* |
| Ga0102892_10084312 | 3300009057 | Estuarine | MSDYTFSLRLQQPIEQVENHPNRDEIIKLAQEQLVDDTFTTERN* |
| Ga0105090_109542081 | 3300009075 | Freshwater Sediment | MSDYTFSRRLQQLIKQVENHPNRDEIIKLAQEQLVEDSF |
| Ga0115026_100590995 | 3300009111 | Wetland | MTDTTFSRRLLQLINEVKNHPDRDEIIKLAKEQLIDEAEFTIIARN* |
| Ga0105102_103107764 | 3300009165 | Freshwater Sediment | MSNYTFSRRLAQLIAEVENHPNRDEIIKLAQEQMIDDNEFTL |
| Ga0105097_102560302 | 3300009169 | Freshwater Sediment | QLMSNYTFSRRLAQLIAEVENHPNRDEIIKLAQEQLVDDSFTIIENN* |
| Ga0105097_103216404 | 3300009169 | Freshwater Sediment | MSNTTFSRRLQQLIKQVENHPNRDEIIKLAQEQLVDDTF |
| Ga0129333_1002566912 | 3300010354 | Freshwater To Marine Saline Gradient | MTSITFSRRLQQLIKQVENHPNRDEIIKLAQEQLVDDSFTITRN* |
| Ga0129333_101396433 | 3300010354 | Freshwater To Marine Saline Gradient | MSDYTFSRRLQQLIKQVENHPNRDEIIKLAQEQLVDDSFTIITDN* |
| Ga0129333_101639891 | 3300010354 | Freshwater To Marine Saline Gradient | MTDVTFSRRLQQLIKQVKNHPNRDEIIKLAQEQLIDDS |
| Ga0129333_102036367 | 3300010354 | Freshwater To Marine Saline Gradient | MTNITFSRRLAQLIQQVENHPHRDEIIKLAQEQLIDE |
| Ga0129333_102501612 | 3300010354 | Freshwater To Marine Saline Gradient | MTNYTFSRRLSQLIQQVENHPNRDEIIKLAQEQLIDDNEFTITEN* |
| Ga0129333_102744322 | 3300010354 | Freshwater To Marine Saline Gradient | MTNTTFSRRLQQLIQQVENHPHRDEIIKLAQEQLIDEAEFTLTEN* |
| Ga0129333_105599711 | 3300010354 | Freshwater To Marine Saline Gradient | MTNTTYSRRLSQLIKQVKDHPNRDEILKLAQEQLI |
| Ga0129333_106152233 | 3300010354 | Freshwater To Marine Saline Gradient | MTNKTFSRRLAQLIQQVENHPHRDEIIKLAQEQLIDEAEFTITEN* |
| Ga0129333_112178031 | 3300010354 | Freshwater To Marine Saline Gradient | MSNTTFSRRLQQLIKQVENHPNRDEIIKLAQEQLIDDTFTITSV |
| Ga0129333_112525802 | 3300010354 | Freshwater To Marine Saline Gradient | MTNTTYSRLSQLIKQVKNHPNRDEILKLAQEQLIDEAEFTIIRN* |
| Ga0151620_100286211 | 3300011268 | Freshwater | MSETTFNIRLEQLIKDVENHPNRDEIIKLALEQLADDNYEV* |
| Ga0151620_11283361 | 3300011268 | Freshwater | FSRRLQQLIKQVENHPNRDEIIKLAQEQLIDDTFTITSGN* |
| Ga0119931_10292382 | 3300011984 | Drinking Water Treatment Plant | MTNKTFSRRLQQLIQQVENHPHRDEIIKLAQEQLIDDNEFTIAEN* |
| Ga0181363_100121313 | 3300017707 | Freshwater Lake | MTNATFSRRLQQLIKQVENHPNRDEIIKLAQEQLIDDSFTLTNN |
| Ga0181363_10058192 | 3300017707 | Freshwater Lake | MSNTTFSRRLAQLIQQLENHPHRDEIIKLAQEQMIDDNEFTLTEN |
| Ga0181363_10093351 | 3300017707 | Freshwater Lake | MSNTTFSRRLQQLIKQVENHPNRDEIIKLAQEQLVDDAFTF |
| Ga0181352_11031122 | 3300017747 | Freshwater Lake | MSNYTFSRRLAQLIKQVENHPNRDEIIKLAEEQIIDDNEFTRCVHRGVSP |
| Ga0181352_11934442 | 3300017747 | Freshwater Lake | MSNTTFSRRLQQLIKQVENHPNRDEIIKLAQEQLIDDNEFTITRN |
| Ga0181344_10786322 | 3300017754 | Freshwater Lake | MTTETYSRRLAQLIQQVKNHPNRDEILRLAMEQLVDEAEFTIIRN |
| Ga0181343_11385192 | 3300017766 | Freshwater Lake | MTTETYSRRLAQLIQQVKEHPNRDEILRLAQEQLIDEAEFTIIRN |
| Ga0181343_11950682 | 3300017766 | Freshwater Lake | MSNYTFSRPLQQLIKQVENHPNRDEIIKLAQEQLVDDSFTIIADN |
| Ga0181355_10479021 | 3300017785 | Freshwater Lake | MSDYTFSRRLQQLIKQVENHPNRDEIIKLAQEQLVDDS |
| Ga0181355_11772542 | 3300017785 | Freshwater Lake | MSDYTFSRRLQQLIKQVENHPNRDEIIKLAQEQLVDDSFTIIADN |
| Ga0181355_12254023 | 3300017785 | Freshwater Lake | MSDYTFSRRLAQLIKQVENHPNRDEIIKLAEEQIIDDNEFTRCVHRGVSP |
| Ga0180032_11050931 | 3300019201 | Estuarine | MSDYTFSRRLAQLIKQVENHPNRDEIIKLAQEQLIDDSEFTITNN |
| Ga0181359_11709741 | 3300019784 | Freshwater Lake | MSDYTFSRRLQQLIKQVENHPNRDEIIKLAQEQLVDDSFT |
| Ga0181359_11871831 | 3300019784 | Freshwater Lake | MTDVTFSRRLQQLIKQVKNHPNRDEIIKLAQEQLIDDSFTS |
| Ga0181359_12333333 | 3300019784 | Freshwater Lake | MSNTTFSRRLQQLIKQVENHPNRDEIIKLAQEQLIDDTFT |
| Ga0211732_10044279 | 3300020141 | Freshwater | MTDSTFSRRLAQLIQQVKDHPNRDEILKLAQEQLIDEAEFTIIRN |
| Ga0211734_100474217 | 3300020159 | Freshwater | MTDTTFSRRLQQLIQQVKDHPNRDEILKLAQEQLIDDSFTITRN |
| Ga0211726_101724902 | 3300020161 | Freshwater | MSNTTFSRRLAQLIKQVENHPNRDEIIKLAQEQLIDDNEFTITNN |
| Ga0211729_1070520910 | 3300020172 | Freshwater | MTDATFSRRLAQLIQQVKDHPNRDEILKLAQEQLIDDSFTITRN |
| Ga0211729_108571692 | 3300020172 | Freshwater | MSNTTFSRRLAQLIKQIEDHPNRDEIIKLAQEQLIDDNEFTITNN |
| Ga0211729_112814413 | 3300020172 | Freshwater | MTDTTFSRRLAQLIQQVEDHPNRDEILKLAQEQLIDEAEFTIIRN |
| Ga0208361_10009087 | 3300020547 | Freshwater | MSNTTFSRRLQQLIKQVENHPNRDEIIKLAQEQLIDDTFTITSVN |
| Ga0210295_11757752 | 3300021323 | Estuarine | MTNNTFSRRLQQLIQQVENHPHRDEIIKLAQEQLIDDNEFTITEN |
| Ga0222712_105077031 | 3300021963 | Estuarine Water | MTNATFSRRLQQLIKQVENHPNRDEIIKLAQEQLIDDSFTITRN |
| Ga0212029_10529921 | 3300022063 | Aqueous | MNNTTYSRRLSQLIKQVKNHPNRDEIIKLAQEQLIDDTFTF |
| Ga0181353_10137202 | 3300022179 | Freshwater Lake | MSNTTFSRRLAQLIQQLENHPHRDEIIKLAQEQMIDDNEFVHFVHTH |
| Ga0181353_10199345 | 3300022179 | Freshwater Lake | MSNTTFSRRLQQLIKQVENHPNRDEIIKLAQEQLVDDAFTITSVN |
| Ga0181354_10344092 | 3300022190 | Freshwater Lake | MTDVTFSRRLQQLIKQVKNHPNRDEIIKLAQEQLIDDSFTLTNN |
| Ga0181354_12280741 | 3300022190 | Freshwater Lake | MSNTTFSRRLAQLIQQLENHPHRDEIIKLAQEQMIDDNEFVHFVH |
| Ga0196905_10962322 | 3300022198 | Aqueous | SNTTFSRRLQQLIKQVENHPNRDEIIKLAQEQLVDDTFTITSVN |
| Ga0181351_10678168 | 3300022407 | Freshwater Lake | MSNTTFSRRLQQLIKQVENHPNRDEIIKLAQEQLIDDTFTLS |
| Ga0181351_12018682 | 3300022407 | Freshwater Lake | MSNYTFSRRLAQLIAEVENHPNRDEIIKLAQDQMIDDNEFT |
| Ga0244777_100022507 | 3300024343 | Estuarine | MSDYTFSRRLQQLIEQVENHPNRDEIIKLAQEQLVDDTFTTERN |
| Ga0244775_100382687 | 3300024346 | Estuarine | MSDYTFSRHLQQLIEQVENHPNRDEIIKLAQEQLVDDTFTTERN |
| Ga0208161_10432861 | 3300025646 | Aqueous | MNNTTYSRRLSQLIKQVKNHPNRDEIIKLAQEQLIDDTFTIIARN |
| Ga0208160_10497034 | 3300025647 | Aqueous | MNNTTYSRRLSQLIKQVKNHPNRDEIIKLAQEQLIDDTFTIIAR |
| Ga0208644_10001646 | 3300025889 | Aqueous | MSEYTFSRRLQELIKQVENHPNRDEIIKLAEEQLVDDTFTITRN |
| Ga0208644_10235675 | 3300025889 | Aqueous | MTDTTFSRRLLQLINEVKNHPDRDEIIKLAKEQLIDEAEFTIIARN |
| Ga0208644_10539234 | 3300025889 | Aqueous | MSNTTFSRRLAQLIKQVENHPNRDEIIKLAQEQLIDDNKFTITND |
| Ga0256300_10581082 | 3300026425 | Freshwater | MSNTTFSPRLQQLIKQVENHPNRDEIIKLAQEQLVDDTFTITSVN |
| Ga0255066_10018031 | 3300027131 | Freshwater | ISSPLLISIMSNTTFSRRLQQLIKQVENHPNRDEIIKLAQEQLVDDTFTITSVN |
| Ga0208165_10600682 | 3300027218 | Estuarine | MSSTTFSRRLAQLIKQVENHPNRDEIIKLAQEQLIDDNE |
| Ga0255094_10328871 | 3300027494 | Freshwater | MSNTTFSRRLQQLIKQVENHPNRDEIIKLAQEQLVDDTFTIT |
| Ga0255068_10445810 | 3300027579 | Freshwater | MSNTTFSRRLQQLIKQVENHPNRDEIIKLAQEQLVDDTFTITS |
| Ga0209033_12566891 | 3300027697 | Freshwater Lake | MSEVTFSRRLQQLIAQVENHPNRDEIIQLALEQLADDEDLQQG |
| Ga0209492_11455821 | 3300027721 | Freshwater Sediment | MSDYTFSRRLQQLIKQVENHPNRDEIIKLAQEQLVDDSFTIIAD |
| Ga0209288_102443251 | 3300027762 | Freshwater Sediment | MSDYTFSRRLQQLIKQVENHPNRDEIIKLAQEQLVEDSFTII |
| Ga0209770_100021399 | 3300027769 | Freshwater Lake | MTNTTYSRRLSQLIKQVKDHPNRDEILKLAQEQLVDEAEFTIIRN |
| Ga0209972_101312362 | 3300027793 | Freshwater Lake | MTSTTFSRRLAQLIQQLENHPHRDEIIKLAQEQMIDDNEFTLTEN |
| Ga0209972_101439802 | 3300027793 | Freshwater Lake | MSDYTFSRRLQQLIKQVENHPNRDEIIKLAQEQLVDDSFTIIENN |
| Ga0255227_10780712 | 3300028266 | Freshwater | MSNTTFSRRLQQLINQVENHPNRDEIIKLAQEQLVDDTFTITSVN |
| Ga0315907_106786771 | 3300031758 | Freshwater | MTSATFSRRLQQLIEQVETHPNKDEIIKLAFEQLSDDLDDADVA |
| Ga0315899_100818912 | 3300031784 | Freshwater | MTEATFNTRLQQLIAQVENHPQKEEILALALQQLADDTYEVQQN |
| Ga0315899_101590183 | 3300031784 | Freshwater | MPTAATFDHFLRQLKEQLVDHPYEDEIIKLAFEQLSDDLDDADIE |
| Ga0315899_101910403 | 3300031784 | Freshwater | MTDQVFSRRLQQLINQLESHPNKDEIIELALQQLADDDYKVQQH |
| Ga0315899_110593323 | 3300031784 | Freshwater | MTEATFNTRLQQLIAQVENHPQKDEILALALQQLADDTYEVQQN |
| Ga0315899_110959822 | 3300031784 | Freshwater | MTSATFSRRLQQLIEQVETHPNKDEIIKLAFEQLSDDLDDADVE |
| Ga0315909_101006856 | 3300031857 | Freshwater | MSNYTFSRRLAQLIAEVENHPNRDEIIKLAQEQMIDDNEFTLTND |
| Ga0315909_103041756 | 3300031857 | Freshwater | MTSTTFSRRLAQLIKQVENHPHRDEIIKLAQEQMI |
| Ga0315904_102750468 | 3300031951 | Freshwater | MSNTTFSRRLAQLIQQLENHPHRDEIIKLAQEQMIDDNEFTITEN |
| Ga0315904_103659777 | 3300031951 | Freshwater | MSDYTFSRRLAQLIQQLENHPHRDEIIKLAQEQMIDDNEFTITN |
| Ga0315904_108756833 | 3300031951 | Freshwater | MTSTTFSRRLAQLIQQLENHPHRDEIIKLAQEQMIDDNEFTLT |
| Ga0315904_110653261 | 3300031951 | Freshwater | MTSTTFSRRLAQLIKQVENHPHRDEIIKLAQEQMIDDNEFTLTND |
| Ga0315901_106905351 | 3300031963 | Freshwater | TFSRRLAQLIQQLENHPHRDEIIKLAQEQMIDDNEFVHFVHTH |
| Ga0315903_105041161 | 3300032116 | Freshwater | MSDYTFSRRLAQLIQQLENHPHRDEIIKLAQEQMIDDNEFT |
| Ga0316627_1011305594 | 3300033482 | Soil | MSDYTFSRRLQQLIKQVENHPNRDEIIKLAQEQLVDDTFTIIADN |
| Ga0316616_1018355703 | 3300033521 | Soil | MTNKTFSRRLAQLIQQVENHPHRDEIIKLAQEQLVDEAEFTI |
| Ga0316616_1046748203 | 3300033521 | Soil | MSDYTFSRRLQQLIKQVENHPNRDEIIKLAQEQLVDDT |
| Ga0316617_1007195365 | 3300033557 | Soil | MSDYTFSRRLQQLIKQVENHPNRDEIIKLAQEQLVDDTSTII |
| Ga0316617_1008528951 | 3300033557 | Soil | MTNKTFSRRLAQLIQQVENHPHRDEIIKLAQEQLVDESEFT |
| Ga0334980_0069227_1089_1226 | 3300033816 | Freshwater | MSSTTFSRRLAQLIKQVENHPNRDEIIKLAQEQLIDDNEFTITNN |
| Ga0334982_0125338_1200_1328 | 3300033981 | Freshwater | MSNTTFSRRLQQLIKQVENHPNRDEIIKLAQEQLIDDTFTITS |
| Ga0334996_0396379_515_649 | 3300033994 | Freshwater | MTSTTFSRRLQQLIKQVENHPNRDEIIKLAQEQLIDDTFTITTDN |
| Ga0334985_0177928_1155_1292 | 3300034018 | Freshwater | MTDYTFSRRLQQLIQQVKDHPNRDEILKLAQEQLIDEAEFTITRN |
| Ga0334987_0003067_15370_15510 | 3300034061 | Freshwater | MTTETYSRRLAQLIQQVKNHPNRDEILRLAQEQLIDEAEFTIIDGN |
| Ga0334987_0035258_576_713 | 3300034061 | Freshwater | MTDYTFSRRLAQLIQQVKDHPNRDEILKLAQEQLIDEAEFTITRN |
| Ga0334987_0268293_177_314 | 3300034061 | Freshwater | MSNYTFSRRLAQLIAEVENHPNRDEIIKLAQDQMIDDNEFTLTND |
| Ga0334987_0579310_236_373 | 3300034061 | Freshwater | MTDTTYSRRLSQLIKQVKDHPNRDEILKLAQEQLIDEAEFTIIRN |
| Ga0335019_0041300_1369_1506 | 3300034066 | Freshwater | MSDYTFSRRLSQLIKQVENHPNRDEIIKLAQEQMIDDNEFTITND |
| Ga0335065_0513314_362_499 | 3300034200 | Freshwater | MTNKTFSRRLAQLIQQVENHPHRDEIIKLAQEQLIDDNEFTITEN |
| Ga0335049_0003868_7259_7396 | 3300034272 | Freshwater | MSNTTFSRRLQQLIKQVENHPNRDEIIKLAQEQLIDDTFTITNVN |
| Ga0335049_0223294_913_1050 | 3300034272 | Freshwater | MSDYTFSRRLQQLLKQVENHPNRDEIIKLAQEQLVDDSFTIITDN |
| ⦗Top⦘ |