


| Basic Information | |
|---|---|
| Family ID | F051450 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 144 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MEKEIEDIKPFTPEDEYVEYQNDMQSQVKKDLEEASA |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 144 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 75.00 % |
| % of genes near scaffold ends (potentially truncated) | 6.94 % |
| % of genes from short scaffolds (< 2000 bps) | 87.50 % |
| Associated GOLD sequencing projects | 68 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (81.944 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (72.917 % of family members) |
| Environment Ontology (ENVO) | Unclassified (95.833 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (86.806 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.92% β-sheet: 0.00% Coil/Unstructured: 63.08% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 144 Family Scaffolds |
|---|---|---|
| PF08401 | ArdcN | 6.25 |
| COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
|---|---|---|---|
| COG4227 | Antirestriction protein ArdC | Replication, recombination and repair [L] | 6.25 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 81.94 % |
| All Organisms | root | All Organisms | 18.06 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 72.92% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 5.56% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 5.56% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 4.86% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 2.08% |
| Background Seawater | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater | 1.39% |
| Filtered Seawater | Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater | 1.39% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.39% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 1.39% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.69% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.69% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.69% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.69% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001721 | Marine viral communities from the Pacific Ocean - LP-54 | Environmental | Open in IMG/M |
| 3300001728 | Marine viral communities from the Pacific Ocean - LP-46 | Environmental | Open in IMG/M |
| 3300001731 | Marine viral communities from the Pacific Ocean - LP-37 | Environmental | Open in IMG/M |
| 3300001735 | Marine viral communities from the Pacific Ocean - LP-45 | Environmental | Open in IMG/M |
| 3300001743 | Marine viral communities from the Pacific Ocean - LP-38 | Environmental | Open in IMG/M |
| 3300002511 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 | Environmental | Open in IMG/M |
| 3300002519 | Marine viral communities from the Pacific Ocean - ETNP_2_300 | Environmental | Open in IMG/M |
| 3300002760 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 | Environmental | Open in IMG/M |
| 3300006090 | Marine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP124 | Environmental | Open in IMG/M |
| 3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
| 3300006308 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0500m | Environmental | Open in IMG/M |
| 3300006310 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_3_0500m | Environmental | Open in IMG/M |
| 3300006336 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0500m | Environmental | Open in IMG/M |
| 3300006340 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0770m | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006841 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT234_2_0200m | Environmental | Open in IMG/M |
| 3300006902 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_250_ad_251m_LV_A | Environmental | Open in IMG/M |
| 3300006923 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG | Environmental | Open in IMG/M |
| 3300006926 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG | Environmental | Open in IMG/M |
| 3300006927 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007756 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample CTDBack_2015_DNA CLC_assembly | Environmental | Open in IMG/M |
| 3300007758 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample CTDPlume_2015_DNA CLC_assembly | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008216 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar | Environmental | Open in IMG/M |
| 3300008217 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009370 | Combined Assembly of Gp0127930, Gp0127931 | Environmental | Open in IMG/M |
| 3300009412 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009604 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 | Environmental | Open in IMG/M |
| 3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300017705 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_08 viral metaG | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017715 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_06 viral metaG | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300020472 | Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995) | Environmental | Open in IMG/M |
| 3300021791 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmer | Environmental | Open in IMG/M |
| 3300024052 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_5 | Environmental | Open in IMG/M |
| 3300024517 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3 | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300024520 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1 | Environmental | Open in IMG/M |
| 3300025029 | Marine viral communities from the Pacific Ocean - LP-39 (SPAdes) | Environmental | Open in IMG/M |
| 3300025042 | Marine viral communities from the Pacific Ocean - LP-47 (SPAdes) | Environmental | Open in IMG/M |
| 3300025043 | Marine viral communities from the Subarctic Pacific Ocean - LP-52 (SPAdes) | Environmental | Open in IMG/M |
| 3300025045 | Marine viral communities from the Pacific Ocean - LP-46 (SPAdes) | Environmental | Open in IMG/M |
| 3300025046 | Marine viral communities from the Pacific Ocean - LP-45 (SPAdes) | Environmental | Open in IMG/M |
| 3300025049 | Marine viral communities from the Pacific Ocean - LP-55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025050 | Marine viral communities from the Pacific Ocean - LP-54 (SPAdes) | Environmental | Open in IMG/M |
| 3300025052 | Marine viral communities from the Pacific Ocean - LP-37 (SPAdes) | Environmental | Open in IMG/M |
| 3300025069 | Marine viral communities from the Pacific Ocean - LP-38 (SPAdes) | Environmental | Open in IMG/M |
| 3300025078 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025096 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025112 | Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300025118 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025122 | Marine viral communities from the Pacific Ocean - ETNP_2_300 (SPAdes) | Environmental | Open in IMG/M |
| 3300025125 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025264 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025267 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar (SPAdes) | Environmental | Open in IMG/M |
| 3300025873 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300027838 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
| 3300031606 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Tmax | Environmental | Open in IMG/M |
| 3300031701 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Bottom | Environmental | Open in IMG/M |
| 3300031773 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915 | Environmental | Open in IMG/M |
| 3300031802 | Marine microbial communities from Western Arctic Ocean, Canada - CB6_AW_1057 | Environmental | Open in IMG/M |
| 3300031811 | Marine microbial communities from Western Arctic Ocean, Canada - CB11b_Tmax_Bot8 | Environmental | Open in IMG/M |
| 3300034628 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 543_2961 | Environmental | Open in IMG/M |
| 3300034629 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 543_2600 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24006J15134_101192202 | 3300001450 | Marine | MENKKVEELEPYTPDEEYVEYQNDMQSQVQKDIEEASA* |
| JGI24006J15134_102106092 | 3300001450 | Marine | MEKQNIEELEPYTPDEEYVEYQNDMQSQVQKDLEEASA* |
| JGI24528J20060_10055831 | 3300001721 | Marine | MEKEIEDIEPFTPEDEYAEYQNDMQSQLIKDLEEASA* |
| JGI24521J20086_10030086 | 3300001728 | Marine | MEKENLEDLKPFTPEDEYVEYQNEMQSQVIKDLEEASA* |
| JGI24521J20086_10165832 | 3300001728 | Marine | MEKEIEDIEPFTPEDAYVEYQNDMQSQLIKDLEEASA* |
| JGI24514J20073_10160701 | 3300001731 | Marine | MEKEIEDIEPFTPEDAYAEYQNDMQSQLIKDLEEASA* |
| JGI24520J20079_10052632 | 3300001735 | Marine | MEKEIEDIEPFKPEDEYVEYQNDMQSQVKKDLEEAGNSA* |
| JGI24515J20084_10056543 | 3300001743 | Marine | MEKEIEDIEPFTPEDEYVEYQNDMQSQLIKDLEEASA* |
| JGI24515J20084_10240951 | 3300001743 | Marine | MEKENLEDIEPFTAEDEYVEYQNDMQSQLKKDIEEASA* |
| JGI25131J35506_10198271 | 3300002511 | Marine | MEKENLEDINPFHPEHEHEYYKYWEYQNEMQSQVIKDLEEASA* |
| JGI25130J35507_10358791 | 3300002519 | Marine | MEKEIEDIKPLTPEEMARLEYVEYLNDMQSQVIKDLEEASA* |
| JGI25136J39404_10517792 | 3300002760 | Marine | GNMEKENLEDIKPFTAEDEYVEYQNDMQSQAIKDVEEASA* |
| Ga0082015_10078223 | 3300006090 | Marine | MEKEIEDIKSLTPEEMARLEYVEYLNDMQSQVIKDLEEASA* |
| Ga0066836_106580252 | 3300006166 | Marine | MEKEIEDIKPFTAEDEYEEYQNDMQSQFKKDLEEASA* |
| Ga0068470_13810572 | 3300006308 | Marine | MEKEIEDIKPFTAEDEYAEYQNDMQSQAIKDVEEAQA* |
| Ga0068471_13320702 | 3300006310 | Marine | MEKEIEDIEPFKPEDEYVEYQNDMQSQVKKDLEEASA* |
| Ga0068502_11700311 | 3300006336 | Marine | MEKEIEDIKPFTPEDEYVEYQNDMQSQVKKDLEEASA* |
| Ga0068502_12220443 | 3300006336 | Marine | MEKEIEDIEPFNPEDEYIEYQNDMQSQVVKDIEEASA* |
| Ga0068503_102610301 | 3300006340 | Marine | MEKEIEDIKPFTAEDEYAEYQNDMQSQLIKDLEEASA* |
| Ga0068503_103046372 | 3300006340 | Marine | MEKEIEDIEPFTAEDEYVEYQNDMQSQVVKDVEEASA* |
| Ga0068503_104720801 | 3300006340 | Marine | MEKEIEELEPYTPEDEYVEYQNDMQSQLIKDLEEAGNYA* |
| Ga0098035_11681323 | 3300006738 | Marine | MEKEKIEDIKPFIAEDEYVEYQNDMQSQFKKDLEEASA* |
| Ga0098058_10338853 | 3300006750 | Marine | MEKEIEDIKPFTAEDEYVEYQNDMQSQVKKDLEEASA* |
| Ga0098040_10713212 | 3300006751 | Marine | MEKEIEDIKPFTAEDEYVEYQNDMQSQAIKDVEEAQA* |
| Ga0098040_10829564 | 3300006751 | Marine | MEKEIEDIKPFTAEDEYVEYQNDMQSQLKKDLEEASA* |
| Ga0098040_11453402 | 3300006751 | Marine | MEKENLEDIKPFTAEDEYVEYQNDMQSQAIKDVEEAQA* |
| Ga0098040_12152112 | 3300006751 | Marine | MEKEIEDIKPFTAEDEYVEYQNDMQTQVKKDLEEASA* |
| Ga0098048_11717943 | 3300006752 | Marine | MEKEIEDIKPFTAEDEYEEYQNDMQSQFVKDIEEAQA* |
| Ga0098039_11248454 | 3300006753 | Marine | MEKEIEDIKPFTPEDEYAEYLNDMQSQVIKDLEEASA* |
| Ga0098039_11520822 | 3300006753 | Marine | MEKEIEEIKPFTAEDEYVEYQNDMQSQFKKDLEEASA* |
| Ga0098044_10670431 | 3300006754 | Marine | MEKEIEDIKPFKPEDEYVEYQNDMQSQAIKDVEEAQA* |
| Ga0098054_10334515 | 3300006789 | Marine | MEKETIEDIKPFTPEDEYVEYQNDMQSQVQKDWEEASA* |
| Ga0098054_12173021 | 3300006789 | Marine | MEKEIEDIKPFTAEDEYAEYQNDMQSQLKKDLEEASA* |
| Ga0098055_11643014 | 3300006793 | Marine | MEKENLEEIKPFTAEDEYVEYQNDMQSQAIKDVEEAQA* |
| Ga0068489_1281903 | 3300006841 | Marine | MEKEIEDIKPFTAEDEYVEYQNHMQSQVQKDWEEASA* |
| Ga0066372_103148511 | 3300006902 | Marine | MEKENIEDIEPFKPEDEYVEYQNDMQSQLKKDLEEASA* |
| Ga0098053_10604981 | 3300006923 | Marine | KETIEDIKPFTPEDEYVEYQNDMQSQVQKDWEEASA* |
| Ga0098053_10837931 | 3300006923 | Marine | MEKEKIEDIKPFTAEDEYVEYQNDMQSQLKKDLEEAS |
| Ga0098057_11735301 | 3300006926 | Marine | MTQKEIEDIKPFTAEDEYVEYQNDMQSQFKKDLEEASA* |
| Ga0098034_11454602 | 3300006927 | Marine | MEKEIEDIEPFTTEDEYIEYQKDMQSQFKKDLEEASA* |
| Ga0098036_12707951 | 3300006929 | Marine | MEKENIEDIEPFKPEDEYVEYQNDMQSQFKKDLEEASA* |
| Ga0105664_10333462 | 3300007756 | Background Seawater | MEKENLEDIEPFNPEEEYVEYQNDMQSQLIKDLEEASA* |
| Ga0105668_10365804 | 3300007758 | Background Seawater | MEKEIEDIEPYQPEDEYVEYQNDMQSQLIKDLEEASA* |
| Ga0110931_11509722 | 3300007963 | Marine | MEKETIEDIKPFTSEDEYVEYQNDMQSQLKKDLEEASA* |
| Ga0114898_10126281 | 3300008216 | Deep Ocean | MEKENLEDLKPFTPEDEYAEYQNDMQSQVKKDLEEASA* |
| Ga0114898_10721731 | 3300008216 | Deep Ocean | MEKEIEDIKPFKPEDEYIEYQNDMQSQVKKDLEEASA* |
| Ga0114899_12795331 | 3300008217 | Deep Ocean | MEKEIEDIKPLKAEDEYAEYQNDMQSQVKKDLEEA |
| Ga0114996_101814522 | 3300009173 | Marine | MEKENIEELEPYTPDEEYVDYQNDMQSQVQKDIEEASA* |
| Ga0114996_106084873 | 3300009173 | Marine | MEKEIEDIEPFTAEEEYVEYQNDMQSQLKKDLEEASA* |
| Ga0118716_12138822 | 3300009370 | Marine | MEKEKEDIKPFNPEDEYVEYQNDMQSQVKKDWEEASA* |
| Ga0114903_10119803 | 3300009412 | Deep Ocean | MEKEIEDIKPFTAEDEYVEYQNDMQTQLKKDLEEASA* |
| Ga0114932_100827971 | 3300009481 | Deep Subsurface | MEKEIEDIKPFNPEDEYVEYQNDMQSQLMKDVEEAQA* |
| Ga0114901_10648602 | 3300009604 | Deep Ocean | MNKKQKENTEKLEPYTFEDEYVEYQDDMQSQVQKDLEEASA* |
| Ga0114906_10145592 | 3300009605 | Deep Ocean | MEKEIEDIKPFKPEDEYVEYQNDMQSQVKKDLEEASA* |
| Ga0098056_11042912 | 3300010150 | Marine | MEKETIEDIKPFTAEDEYVEYQNDMQSQVKKDLEEASA* |
| Ga0098056_12812351 | 3300010150 | Marine | KEIEDIKPFTAEDEYVEYQNDMQSQAIKDVEEAQA* |
| Ga0098061_11162371 | 3300010151 | Marine | MEKEIEDIEPFTTEDEYVEYQKDMQSQFKKDLEEASA* |
| Ga0098047_100871601 | 3300010155 | Marine | MEKEIEDIEPFKPEEEYVEYLNDMQSQVIKDLEEASA* |
| Ga0098047_103310322 | 3300010155 | Marine | NMEKETIEDIKPFTPEDEYVEYQNDMQSQVQKDWEEASA* |
| Ga0181372_10198752 | 3300017705 | Marine | MEKEKIEDIKPFIAEDEYVEYQNDMQSQLKKDLEEASA |
| Ga0181377_10440842 | 3300017706 | Marine | MEKENIEDIEPFKPEDEYVEYQNDMQSQTIKDVEEAQA |
| Ga0181370_10186012 | 3300017715 | Marine | MEKEIEDIKSLTPEEMARLEYVEYLNDMQSQVIKDLEEANA |
| Ga0181432_10262502 | 3300017775 | Seawater | MEKEIEDIEPFNPEDEYIEYQNDMQSQVVKDIEEASA |
| Ga0211579_100882141 | 3300020472 | Marine | MEKEIEDIKPFTAEDEYEEYQNDMQSQFKKDLEEASA |
| Ga0226832_100049183 | 3300021791 | Hydrothermal Vent Fluids | MEKENLEDIKPFTAEDEYVEYQNDMQSQLKKDLEEASA |
| Ga0226832_100306572 | 3300021791 | Hydrothermal Vent Fluids | MEKEIEDIKPFTAEDEYVEYQNDMQSQAIKDVEEAQA |
| (restricted) Ga0255050_100458952 | 3300024052 | Seawater | MEKEIEDIEPFTAEEEYVEYQNDMQSQAIKDVEEAQA |
| (restricted) Ga0255050_101354991 | 3300024052 | Seawater | MEKENIEELEPYTPYEEYVDYQNDMQSQVQKDIEEASA |
| (restricted) Ga0255049_102637782 | 3300024517 | Seawater | MEKEIEDIEPFKPEDEYAEYQNDMQSQVIKDVEEAQA |
| (restricted) Ga0255049_103180761 | 3300024517 | Seawater | MENKKIEELEPYTPDDDYVEYQNDMQSQVIKDLEEASA |
| (restricted) Ga0255048_102937401 | 3300024518 | Seawater | MENKKIEELEPYTPDEEYVEYQNDMQSQVQKDIEEASA |
| (restricted) Ga0255048_103609401 | 3300024518 | Seawater | MEKEIEDIEPFKPEDEYAEYQNDMQSQAIKDVEEAQA |
| (restricted) Ga0255047_102697881 | 3300024520 | Seawater | MEKEIEDIKPFNPEDEYAEYQNDMQSQAIKDVEEAQA |
| Ga0207900_1061732 | 3300025029 | Marine | MEKENLEDLKPFTPEEEYAEYQNEMQSQVIKDLEEASA |
| Ga0207889_10045412 | 3300025042 | Marine | MEKENLEDIEPFKPEDEYVEYQNDMQSQAMKDVEEASA |
| Ga0207889_10130812 | 3300025042 | Marine | MEKEIEDIEPFTPEDAYVEYQNDMQSQLIKDLEEASA |
| Ga0207889_10163301 | 3300025042 | Marine | MRNNMEKEIEDIEPFNPEDEYVEYQNDMQSQLIKDLEEAGNSA |
| Ga0207889_10170761 | 3300025042 | Marine | MEKENIEDLKPFTPEDEYVEYQNDMQSQVKKDLEEASA |
| Ga0207889_10294482 | 3300025042 | Marine | MEKENLEDIEPFTAEDEYVEYQNDMQSQLKKDIEEASA |
| Ga0207907_1135462 | 3300025043 | Marine | MEKEIEDIEPFTPEDAYAEYQNDMQSQLIKDLEEASA |
| Ga0207901_10139662 | 3300025045 | Marine | MEKENLEDLKPFTPEDEYVEYQNEMQSQVIKDLEEASA |
| Ga0207901_10144121 | 3300025045 | Marine | MEKEIEDIKPFTPEDEYAEYLNDMQSQVIKDLEEASA |
| Ga0207901_10225733 | 3300025045 | Marine | MKKEIEDIEPFKPEDEYVEYQNDMQSQAIKDVEEAQA |
| Ga0207901_10277722 | 3300025045 | Marine | MEKEIEDIEPFTAEEEYVEYQNDMQSQLKKDLEEASA |
| Ga0207901_10345441 | 3300025045 | Marine | MEKENLEDLKPFTPEDEYVKYQNDMQSQVKKDLEEASA |
| Ga0207901_10591631 | 3300025045 | Marine | MEKEIEDIEPFTAEEEYAEYQNDMQSQLIKDLEEASA |
| Ga0207902_10088612 | 3300025046 | Marine | MEKEIEDIEPFKPEDEYVEYQNDMQSQVKKDLEEAGNSA |
| Ga0207898_10085463 | 3300025049 | Marine | MEKENLEDIEPFKPEDEYVEYQNDMQSQAIKDVEEAQA |
| Ga0207898_10137261 | 3300025049 | Marine | MEKENLEDIEPFTPEDAYVEYQNDMQSQLIKDLEEASA |
| Ga0207892_10085623 | 3300025050 | Marine | MEKEIEDIEPFTPEDEYAEYQNDMQSQLIKDLEEASA |
| Ga0207892_10126331 | 3300025050 | Marine | MEKENIEDIEPFKPEDEYVEYQNDMQSQLKKDLEEASA |
| Ga0207892_10174832 | 3300025050 | Marine | MEKENLEDLKPFTAEDEYVEYQNDMQSQVIKDVEEAQA |
| Ga0207892_10480801 | 3300025050 | Marine | NMEKEIEDIEPFKPEDEYAEYQNEMQSQVIKDLEEASA |
| Ga0207906_10071361 | 3300025052 | Marine | MEKEIEDIKPFKPEDEYAEYLNDMQSQVKKDLEEASA |
| Ga0207906_10111802 | 3300025052 | Marine | MEKEIEDIKPFTAEDAYVEYQNDMQSQAIKDVEEAQA |
| Ga0207906_10266141 | 3300025052 | Marine | MEKENIEDIEPFTAEDEYVEYQNDMQSQAIKDVEEAQA |
| Ga0207887_10200673 | 3300025069 | Marine | MEKENIEELEPYTPEDEYVEYQNDMQSQLIKDLEEAGNSA |
| Ga0207887_10539311 | 3300025069 | Marine | MEKEIEDIKPFTPEDEYVEYQNDMQSQLKKDLEEAQA |
| Ga0208668_10025118 | 3300025078 | Marine | MEKEIEDIKSLTPEEMARLEYVEYLNDMQSQVIKDLEEASA |
| Ga0208011_11053331 | 3300025096 | Marine | MEKEIEDIKPFTAEDEYVEYQNDMQTQVKKDLEEASA |
| Ga0208013_10854463 | 3300025103 | Marine | MEKETIEDIKPFTPEDEYVEYQNDMQSQVQKDWEEASA |
| Ga0209349_10108948 | 3300025112 | Marine | MEKEIEDIKPFTPEDEYAEYQNDMQSQVIKDLEEVSA |
| Ga0209349_10136535 | 3300025112 | Marine | MEKEIEDIKPFTPEDEYVEYQNDMQSQLKKDLEEASA |
| Ga0209349_10582102 | 3300025112 | Marine | MEKEIEDIEPFKPEDEYVEYLNDMQSQVIKDLEEASA |
| Ga0208790_10144074 | 3300025118 | Marine | MEKEIEDIKPFKPEDEYVEYQNDMQSQAIKDVEEAQA |
| Ga0209434_10138701 | 3300025122 | Marine | MEKEIEDIKPLTPEEMARLEYVEYLNDMQSQVIKDLEEASA |
| Ga0209434_10350692 | 3300025122 | Marine | MEKENLEDIKPFTPEDEYVEYQNDMQSQVKKDIEEASA |
| Ga0209644_10071961 | 3300025125 | Marine | MEKENLEDIKPFTAEDEYVEYQNDMQSQVIKDLEEASA |
| Ga0209644_10204272 | 3300025125 | Marine | MEKENLEDLKPFTPEDEYVEYQNDMQSQTIKDVEEASA |
| Ga0209644_10337171 | 3300025125 | Marine | MEKENLEDIKPFTAEDEYVEYQNDMQSQAIKDVEEASA |
| Ga0209644_10344501 | 3300025125 | Marine | MEKENIEDIEPFKPEDEYVEYQNDMQSQVKKDIEEISI |
| Ga0209644_10446371 | 3300025125 | Marine | MEKENLEDINPFHPEHEHEYYKYWEYQNEMQSQVIKDLEEASA |
| Ga0209644_10561592 | 3300025125 | Marine | MEKEIEDIKPFTAEDEYAEYLNDMQSQVIKDLEEASA |
| Ga0209644_10618941 | 3300025125 | Marine | MEKEIEDIKPFTPEDEYVEYLNDMQTQVKKDLEEASA |
| Ga0209644_11422711 | 3300025125 | Marine | MEKENLEDLKPFTPEDEYVEYQNDMQSQVKKDLEEASA |
| Ga0208919_10149484 | 3300025128 | Marine | MEKEIEDIKPFTAEDEYEEYQNDMQSQFVKDIEEAQA |
| Ga0208919_11343471 | 3300025128 | Marine | MEKEIEDIKPFTAEDEYAEYQNDMQSQAIKDVEEAQA |
| Ga0209756_10224793 | 3300025141 | Marine | MEKETIEDIKPFTPEDEYVEYQNDMHTQLKKDWEEASA |
| Ga0209756_10525135 | 3300025141 | Marine | IMEKEIEDIKPFTAEDEYAEYQNDMQSQLKKDLEEASA |
| Ga0209337_10377541 | 3300025168 | Marine | MENKKVEELEPYTPDEEYVEYQNDMQSQVQKDLEEASA |
| Ga0208029_10060933 | 3300025264 | Deep Ocean | MEKEIEDIKPFKPEDEYIEYQNDMQSQVKKDLEEASA |
| Ga0208179_10108671 | 3300025267 | Deep Ocean | MEKENLEDLKPFTPEDEYAEYQNDMQSQVKKDLEEASA |
| Ga0209757_100035668 | 3300025873 | Marine | MKKENLEDIKPFTPEDEYAEYLNDMQSQVIKDLEEASA |
| Ga0209757_100615672 | 3300025873 | Marine | MEKENLEDIEPFTTEDEYVEYQNDMQSQVKKDIEEISI |
| Ga0209757_100721932 | 3300025873 | Marine | MEKENLEDLKPFTPEDEYAEYQNDMQTQLKKDLEEASA |
| Ga0209757_100734152 | 3300025873 | Marine | MKKENLEEIKPFAPEDEYVEYQNDMQSQAIKDVEEAQA |
| Ga0209757_100959262 | 3300025873 | Marine | MEKENLEDIKPFTPEDEYVEYQNDMQSQLKKDLEEASA |
| Ga0209757_101059581 | 3300025873 | Marine | MEKEIEDIEPFKPEDEYVEYQNDMQSQVKKDLEEASA |
| Ga0209757_101334821 | 3300025873 | Marine | KEIEDIKPFTPEDEYAEYLNDMQSQVIKDLEEASA |
| Ga0209757_101448781 | 3300025873 | Marine | MEKENLEDIKPFTAEDEYVEYQNDMQSQVKKDLEEASA |
| Ga0209757_101814803 | 3300025873 | Marine | MEKEIEDLKPFTPEEEYAEYQNEMQSQVIKDLEEASA |
| Ga0209757_102127351 | 3300025873 | Marine | MKKEIEDIEPFKPEDEYAEYQNDMQTQLKKDLEEASA |
| Ga0209757_102992161 | 3300025873 | Marine | MEKEIEDIKPFTPEDEYAEYQNDMQSQAIKDVEEAQA |
| Ga0209089_103704132 | 3300027838 | Marine | METESIEELEPYTPDEEYVDYQNDMQSQVQKDIEEASA |
| Ga0256382_10460763 | 3300028022 | Seawater | MEKETIEDIKPFTSEDEYVEYQNDMQSQLKKDLEEASA |
| Ga0256382_11301731 | 3300028022 | Seawater | MEKEIEDIKPFNPEDEYVEYQNDMQSQLMKDVEEAQA |
| Ga0302119_102509252 | 3300031606 | Marine | MEKENIEELEPYTPDEEYVDYQNDMQSQVQKDIEEASA |
| Ga0302120_103227641 | 3300031701 | Marine | MEKENIEDIEPFTAEEEYVEYQNDMQSQLKKDLEEASA |
| Ga0315332_101457282 | 3300031773 | Seawater | MEKEIEDIKPFTSEDEYVEYQNDMQSQFVKDIEEAQA |
| Ga0310123_103307621 | 3300031802 | Marine | MEKENFEEIEPFYSEKEYVEYQNDMQSQLKKDLEEASA |
| Ga0310123_103745922 | 3300031802 | Marine | MEKENFEDIEPFYSEKEYVEYQNDMQDQLKQDLEEASA |
| Ga0310125_100860462 | 3300031811 | Marine | MEKENIEDIEPFTAEEEYVEYQNDMQTQLIKDLEEASA |
| Ga0326755_019849_389_502 | 3300034628 | Filtered Seawater | MEKEIEDIKPFTPEEEYIEYQNDMQSQVKKDLEEASA |
| Ga0326756_051305_122_238 | 3300034629 | Filtered Seawater | MEKKYFEEIKPFTPDEEYVEYQNDMQSQVIKDLEEASA |
| ⦗Top⦘ |