


| Basic Information | |
|---|---|
| Family ID | F051342 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 144 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MGSVLSKPDRLPVESLLLDVADVLATSLDLDTTVRRVAEVVRKV |
| Number of Associated Samples | 131 |
| Number of Associated Scaffolds | 144 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 15.97 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 90.28 % |
| Associated GOLD sequencing projects | 125 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.139 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.889 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.222 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.556 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.06% β-sheet: 0.00% Coil/Unstructured: 56.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 144 Family Scaffolds |
|---|---|---|
| PF00156 | Pribosyltran | 69.44 |
| PF13483 | Lactamase_B_3 | 20.83 |
| PF01596 | Methyltransf_3 | 2.78 |
| PF02585 | PIG-L | 1.39 |
| PF13302 | Acetyltransf_3 | 0.69 |
| PF00561 | Abhydrolase_1 | 0.69 |
| PF02641 | DUF190 | 0.69 |
| PF00962 | A_deaminase | 0.69 |
| PF08445 | FR47 | 0.69 |
| PF01578 | Cytochrom_C_asm | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
|---|---|---|---|
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 2.78 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 2.78 |
| COG4123 | tRNA1(Val) A37 N6-methylase TrmN6 | Translation, ribosomal structure and biogenesis [J] | 2.78 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 1.39 |
| COG1816 | Adenosine/6-amino-6-deoxyfutalosine deaminase | Nucleotide transport and metabolism [F] | 0.69 |
| COG1993 | PII-like signaling protein | Signal transduction mechanisms [T] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.14 % |
| Unclassified | root | N/A | 4.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101412710 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101412843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 604 | Open in IMG/M |
| 3300000567|JGI12270J11330_10080916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1536 | Open in IMG/M |
| 3300001166|JGI12694J13545_1003971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1875 | Open in IMG/M |
| 3300001356|JGI12269J14319_10081560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1708 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101636899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 542 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101667443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 536 | Open in IMG/M |
| 3300004091|Ga0062387_100574667 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300004092|Ga0062389_103093715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 622 | Open in IMG/M |
| 3300004635|Ga0062388_102157062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 579 | Open in IMG/M |
| 3300005179|Ga0066684_10251233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1161 | Open in IMG/M |
| 3300005329|Ga0070683_101753009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 597 | Open in IMG/M |
| 3300005434|Ga0070709_11263069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 595 | Open in IMG/M |
| 3300005445|Ga0070708_100452822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1211 | Open in IMG/M |
| 3300005526|Ga0073909_10488133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 594 | Open in IMG/M |
| 3300005526|Ga0073909_10531594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 572 | Open in IMG/M |
| 3300005538|Ga0070731_10014899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 5535 | Open in IMG/M |
| 3300005541|Ga0070733_11172877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 514 | Open in IMG/M |
| 3300005545|Ga0070695_101717622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 525 | Open in IMG/M |
| 3300005568|Ga0066703_10307699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 958 | Open in IMG/M |
| 3300005712|Ga0070764_10704704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 622 | Open in IMG/M |
| 3300005764|Ga0066903_102901303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 930 | Open in IMG/M |
| 3300005995|Ga0066790_10394453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 591 | Open in IMG/M |
| 3300006028|Ga0070717_10486506 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300006175|Ga0070712_100065972 | All Organisms → cellular organisms → Bacteria | 2571 | Open in IMG/M |
| 3300006176|Ga0070765_100331360 | All Organisms → cellular organisms → Bacteria | 1412 | Open in IMG/M |
| 3300006176|Ga0070765_100457774 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
| 3300006755|Ga0079222_11135365 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300006755|Ga0079222_11356263 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300006806|Ga0079220_11767959 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300006893|Ga0073928_10730569 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 689 | Open in IMG/M |
| 3300009518|Ga0116128_1168474 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300009521|Ga0116222_1095467 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
| 3300009524|Ga0116225_1144275 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
| 3300009624|Ga0116105_1042256 | Not Available | 1024 | Open in IMG/M |
| 3300009633|Ga0116129_1020308 | All Organisms → cellular organisms → Bacteria | 2338 | Open in IMG/M |
| 3300009665|Ga0116135_1004042 | All Organisms → cellular organisms → Bacteria | 6075 | Open in IMG/M |
| 3300009698|Ga0116216_10683807 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300009700|Ga0116217_10662018 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300010048|Ga0126373_10212362 | All Organisms → cellular organisms → Bacteria | 1882 | Open in IMG/M |
| 3300010379|Ga0136449_100359438 | All Organisms → cellular organisms → Bacteria | 2611 | Open in IMG/M |
| 3300010379|Ga0136449_103863125 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300011067|Ga0138594_1022459 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300012096|Ga0137389_10042156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3397 | Open in IMG/M |
| 3300012203|Ga0137399_11408601 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300012350|Ga0137372_10092114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2559 | Open in IMG/M |
| 3300012361|Ga0137360_11813530 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300012918|Ga0137396_10893066 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300012948|Ga0126375_11713953 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300012971|Ga0126369_12096679 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300014169|Ga0181531_10634239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 663 | Open in IMG/M |
| 3300014199|Ga0181535_10369870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 844 | Open in IMG/M |
| 3300014200|Ga0181526_10037860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3101 | Open in IMG/M |
| 3300014657|Ga0181522_10696212 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300017955|Ga0187817_10615373 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300017955|Ga0187817_10730145 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300017961|Ga0187778_10518791 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300018006|Ga0187804_10595995 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300018007|Ga0187805_10447800 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300018008|Ga0187888_1195124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 807 | Open in IMG/M |
| 3300018012|Ga0187810_10428578 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300018023|Ga0187889_10150462 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1104 | Open in IMG/M |
| 3300018038|Ga0187855_10234561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1078 | Open in IMG/M |
| 3300018043|Ga0187887_10178079 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300018044|Ga0187890_10781628 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300018046|Ga0187851_10177121 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
| 3300018047|Ga0187859_10497993 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300018058|Ga0187766_10588300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 758 | Open in IMG/M |
| 3300018085|Ga0187772_10268364 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
| 3300018090|Ga0187770_11158106 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300020580|Ga0210403_10296681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1324 | Open in IMG/M |
| 3300020581|Ga0210399_10527368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 980 | Open in IMG/M |
| 3300021168|Ga0210406_10367866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1157 | Open in IMG/M |
| 3300021170|Ga0210400_11375294 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300021171|Ga0210405_10571546 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300021180|Ga0210396_11433576 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300021181|Ga0210388_10414361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1184 | Open in IMG/M |
| 3300021181|Ga0210388_10552361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1009 | Open in IMG/M |
| 3300021401|Ga0210393_10204750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1596 | Open in IMG/M |
| 3300021406|Ga0210386_10930854 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300021407|Ga0210383_10340807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1291 | Open in IMG/M |
| 3300021420|Ga0210394_10243464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1574 | Open in IMG/M |
| 3300021432|Ga0210384_11184801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 668 | Open in IMG/M |
| 3300021433|Ga0210391_10156482 | All Organisms → cellular organisms → Bacteria | 1794 | Open in IMG/M |
| 3300021477|Ga0210398_11118373 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300021559|Ga0210409_11359362 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300021560|Ga0126371_10291464 | All Organisms → cellular organisms → Bacteria | 1756 | Open in IMG/M |
| 3300022528|Ga0242669_1042657 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300022728|Ga0224566_108928 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300024220|Ga0224568_1009123 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300024225|Ga0224572_1027665 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1086 | Open in IMG/M |
| 3300024225|Ga0224572_1080007 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300025404|Ga0208936_1016008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 948 | Open in IMG/M |
| 3300025898|Ga0207692_10138493 | All Organisms → cellular organisms → Bacteria | 1382 | Open in IMG/M |
| 3300025910|Ga0207684_10418976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1151 | Open in IMG/M |
| 3300025917|Ga0207660_10683494 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300025945|Ga0207679_10604552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 988 | Open in IMG/M |
| 3300026333|Ga0209158_1049848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1716 | Open in IMG/M |
| 3300027072|Ga0208238_1007458 | Not Available | 906 | Open in IMG/M |
| 3300027168|Ga0208239_1005744 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300027648|Ga0209420_1023643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1968 | Open in IMG/M |
| 3300027738|Ga0208989_10212268 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300027803|Ga0209910_10009729 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300027824|Ga0209040_10118737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1469 | Open in IMG/M |
| 3300027826|Ga0209060_10150642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1079 | Open in IMG/M |
| 3300027855|Ga0209693_10496160 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300027867|Ga0209167_10036360 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2382 | Open in IMG/M |
| 3300027874|Ga0209465_10497616 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300027898|Ga0209067_10871264 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300027905|Ga0209415_10377704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1160 | Open in IMG/M |
| 3300027915|Ga0209069_10893869 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300028746|Ga0302233_10347151 | Not Available | 561 | Open in IMG/M |
| 3300028747|Ga0302219_10169361 | Not Available | 839 | Open in IMG/M |
| 3300028800|Ga0265338_10749914 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300028874|Ga0302155_10026964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2766 | Open in IMG/M |
| 3300028906|Ga0308309_10385391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1200 | Open in IMG/M |
| 3300028906|Ga0308309_10485145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1067 | Open in IMG/M |
| 3300029917|Ga0311326_10111860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1501 | Open in IMG/M |
| 3300029917|Ga0311326_10268821 | Not Available | 873 | Open in IMG/M |
| 3300029939|Ga0311328_10417767 | Not Available | 960 | Open in IMG/M |
| 3300029943|Ga0311340_10100882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3178 | Open in IMG/M |
| 3300030054|Ga0302182_10004089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6745 | Open in IMG/M |
| 3300030518|Ga0302275_10113756 | Not Available | 1775 | Open in IMG/M |
| 3300030520|Ga0311372_12656724 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300030617|Ga0311356_10609027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1056 | Open in IMG/M |
| 3300030738|Ga0265462_10927133 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300030738|Ga0265462_12125610 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300030848|Ga0075388_10877224 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300031231|Ga0170824_113720739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1329 | Open in IMG/M |
| 3300031234|Ga0302325_12437911 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300031753|Ga0307477_10164372 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1547 | Open in IMG/M |
| 3300031754|Ga0307475_10033686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3744 | Open in IMG/M |
| 3300031754|Ga0307475_10471999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1008 | Open in IMG/M |
| 3300031823|Ga0307478_10399918 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
| 3300031890|Ga0306925_11918348 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300031938|Ga0308175_101233147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 832 | Open in IMG/M |
| 3300032770|Ga0335085_11965179 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300032805|Ga0335078_10465010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1637 | Open in IMG/M |
| 3300032828|Ga0335080_11246564 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300032892|Ga0335081_10000123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 152944 | Open in IMG/M |
| 3300032954|Ga0335083_10318118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1360 | Open in IMG/M |
| 3300033158|Ga0335077_10386152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1508 | Open in IMG/M |
| 3300033977|Ga0314861_0286222 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300034282|Ga0370492_0236997 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.89% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.94% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.86% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.86% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.17% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.47% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.47% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.47% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.47% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.78% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.78% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.78% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.08% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.39% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.39% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.39% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.39% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.39% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.69% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.69% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.69% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.69% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.69% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001166 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011067 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 41 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022728 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU2 | Environmental | Open in IMG/M |
| 3300024220 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU5 | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300025404 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300027072 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027168 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF037 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027803 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712S3S | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028874 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029917 | I_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
| 3300030848 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1014127101 | 3300000364 | Soil | MGSVVSKPDRLPVESLLLDVADVLATSLDLDTTLRRVAEVV |
| INPhiseqgaiiFebDRAFT_1014128432 | 3300000364 | Soil | MDSVLSKPDRLPIESLMLDVADVLATSLDLDTTLRRVAELVRKVIDYEI |
| JGI12270J11330_100809161 | 3300000567 | Peatlands Soil | MGSVLSKPERLPVESLLLDVADVLATSLDLDTTVRRVAEVVRKVIDYEIF |
| JGI12694J13545_10039711 | 3300001166 | Forest Soil | MSSVISKPDRLPVESLLLDVADVLATSLDLDTTLSRVAEVVRKVID |
| JGI12269J14319_100815601 | 3300001356 | Peatlands Soil | MKRMGSVLTKPDQLPGESLLLDVADVLATSLDLDTTVRRVAEVVRKVIDYEIFAILL |
| JGIcombinedJ26739_1016368991 | 3300002245 | Forest Soil | VGSVLSKPDRLPVESLLLDVADVLATSLDLDTTVRRVSEVVRRVIDYEIF |
| JGIcombinedJ26739_1016674431 | 3300002245 | Forest Soil | MGSALNTTGSQLQVEPLLLEIADVLATSLDLDTTLRRVAEVVRKVIDYEIF |
| Ga0062387_1005746672 | 3300004091 | Bog Forest Soil | MPQTPRRRTRLLSYKRMGSVLSKPDRLPVESLLLDVADVLATSLDLDTTVRRVAEVVR |
| Ga0062389_1030937152 | 3300004092 | Bog Forest Soil | MGSITSKSDRLPVESLLLDVADALATSLDLDTTVRRVAEVVRRVIDYEI |
| Ga0062388_1021570622 | 3300004635 | Bog Forest Soil | MGSALSKPAHALQIEPLLLEVADVLATSLDLDTTLRRVAEVV |
| Ga0066684_102512333 | 3300005179 | Soil | MRLLSLTSMSSVVSKPDPSPAESLLLDVADVLATSLDLDTTLRRVAEVVRKV |
| Ga0070683_1017530092 | 3300005329 | Corn Rhizosphere | MSSVVSKPDPSPAESLLLDVADVLATSLDLDTTLRRVAEVVRKV |
| Ga0070709_112630691 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MGSVLSKPDRLPVESLLLDVADVLATSLDLDTTVSRVAEVVRKVIDYEIFAIL |
| Ga0070708_1004528223 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MNSVLSKPDRLPVESLLLDVADVLATSLDLDTTVRRVAEVV |
| Ga0073909_104881332 | 3300005526 | Surface Soil | MDSVLSKPDRLPVESLLLDVADVLATSLDLDTTVRRVAEVVRKVIDY |
| Ga0073909_105315942 | 3300005526 | Surface Soil | MDSVISKSDRLPVESLLLDVADVLATSLDLDTTLRRVAEVVR |
| Ga0070731_100148991 | 3300005538 | Surface Soil | MSSVVSKPDRLPVESLLLDVADVLATSLDLDTTLRRVAEVVRKVIDYEIF |
| Ga0070733_111728771 | 3300005541 | Surface Soil | MGSVVSKPDRLPAESLLLDVADVLATSLDLDTTLRRVAEVVRKVID |
| Ga0070695_1017176221 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MGSAVSKPDRLPVESLLLDVADVLATSLDLDTTLSRVAEVVSK |
| Ga0066703_103076991 | 3300005568 | Soil | MGSVISKPDRLPVEALLLDVADVLATSLDLDTTVRRVAEVVRKVIDYEIFAIL |
| Ga0070764_107047041 | 3300005712 | Soil | MGSILSKSDRPLPVEPLLLEVADVLATSLDLDTTLRRVAEVVRKV |
| Ga0066903_1029013031 | 3300005764 | Tropical Forest Soil | MGSVVSKPDRLPAEALLLDVADVLATSLDLDTTLRRVAEVVRKVI |
| Ga0066790_103944532 | 3300005995 | Soil | VDSVLNKPERPLAVEPLLLEVADVVNTSLDLDTTLRRV |
| Ga0070717_104865061 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MESVLTKPERQLPIEPLLLEVADVLSTSLDLDTTLRRVSEVVRKV |
| Ga0070712_1000659721 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MDSVISKSDRLPVESLLLDVADVLATSLDLDTTLRRVAEVVRKVIDYEIF |
| Ga0070765_1003313601 | 3300006176 | Soil | MGSVLSKHEKHVAVDPLLIEVSDVMSTSLDLDTTLRRVA |
| Ga0070765_1004577743 | 3300006176 | Soil | MGSVLSKHEKHVAVDPLLLEVADVMATSLDLDTTLRR |
| Ga0079222_111353652 | 3300006755 | Agricultural Soil | MSSVVAKPDRLPVESLLLDVADVLATSLDLDTTVRRVAEV |
| Ga0079222_113562631 | 3300006755 | Agricultural Soil | MDSVLTKPDRLPVESLLLDVADVLATSLDLDTTLRRV |
| Ga0079220_117679592 | 3300006806 | Agricultural Soil | MGSVLSKPDRLPVESLLLDVADVLATSLDLDTTVRRVAEVVRKVI |
| Ga0073928_107305691 | 3300006893 | Iron-Sulfur Acid Spring | MGSVLSKHEKHLQVEPLLLEVADVMATSLDLDTTLRRVAEVVRKVIDY |
| Ga0116128_11684742 | 3300009518 | Peatland | MGSALSKPVNQLPVEPLLLEVADVLATSLDLDTTLRRVAEVVR |
| Ga0116222_10954671 | 3300009521 | Peatlands Soil | MGSVQSKPSRLPVESLLLDVADVLATSLDLDTTVRRVAEVVRKVIDYEIFAIL |
| Ga0116225_11442751 | 3300009524 | Peatlands Soil | MGSVLSKHEKHLQVEPLLLEVADVMATSLDLDTTL |
| Ga0116105_10422561 | 3300009624 | Peatland | MGSVLSKPENQFHVEPLLLEVADVMSTSLDLDTTLR |
| Ga0116129_10203081 | 3300009633 | Peatland | MGSVLSKSANQLPVEPLLLEVSDVLATSLDLDTTLRRVAEIVR |
| Ga0116135_10040421 | 3300009665 | Peatland | MGSVQTNLDNLRVESLLLEVSDILATSLDLDTTLRRVAEVVRSVIDYEIF |
| Ga0116216_106838071 | 3300009698 | Peatlands Soil | MGSVLTKPDQLPGESLLLDVADVLATSLDLDTTVRRVAEVVRKVIDYEIFA |
| Ga0116217_106620181 | 3300009700 | Peatlands Soil | MESVLSTTGNHLNVEPLLLEVSDVLATSLDLDTTLRRVAEVVRKVI |
| Ga0126373_102123621 | 3300010048 | Tropical Forest Soil | VDSVTSKPEPQIKVEPLLLEVADVVNTTLDLDTTLRRVAEL |
| Ga0136449_1003594385 | 3300010379 | Peatlands Soil | MRTNRTHPDQLPGESLLLDVADVLATSLDLDTTVRRVAEVVR |
| Ga0136449_1038631252 | 3300010379 | Peatlands Soil | MGSVLSKPDRLPVESLLLDVADVLATSLDLDTTVRRVAEVVRKV |
| Ga0138594_10224591 | 3300011067 | Peatlands Soil | MGSVLTKPDQLPGESLLLDVADVLATSLDLDTTVRRVAEVVRK |
| Ga0137389_100421565 | 3300012096 | Vadose Zone Soil | MESVLTKPERQLPIEPLLLEVADVLSTSLDLDTTLRRVSVVVRKVI |
| Ga0137399_114086011 | 3300012203 | Vadose Zone Soil | MGSVISKPEGTLPIEPLLLEVADVLATSLDLDTTLRRVA |
| Ga0137372_100921141 | 3300012350 | Vadose Zone Soil | MMSSVISKPDRLPVESLLLDVADVLATSLDLDTTVRRVAEVVRKVIDY |
| Ga0137360_118135302 | 3300012361 | Vadose Zone Soil | MGSVISKPDRLPVESLLLDVADVLATSLDLDTTLRRV |
| Ga0137396_108930662 | 3300012918 | Vadose Zone Soil | MGTLLSKAEKPLPVEPLLLEVADVLATSLDLDTTLKRVA |
| Ga0126375_117139531 | 3300012948 | Tropical Forest Soil | MGSVVSKADRLPVESLLLDVADVLATSLDLDTTLRRVAEVVRKVIDY |
| Ga0126369_120966792 | 3300012971 | Tropical Forest Soil | LKEQYCKTNVGSIVSKPDRLPVESLLLDVADVLATSLDLDTTLRRVAEVVRKVIDY |
| Ga0181531_106342392 | 3300014169 | Bog | MGTVVSKPDRLPAESLLLDVADVLATSLDLDTTLRRVAEVVRKVIDYEIFAIL |
| Ga0181535_103698701 | 3300014199 | Bog | MGSVLSKPVSHLSVEPLLLEVGDVLATSLDLDTTLRRVAEVVRKVIDYEIFAI |
| Ga0181526_100378601 | 3300014200 | Bog | MESVLSETENHLPVEPLLLEVADVLATSLDLDTTLRRVAEVVRKVIDY |
| Ga0181522_106962121 | 3300014657 | Bog | MGSVITKPDRLPVESLLLDVADVLATSLDLDTTVRRVAE |
| Ga0187817_106153731 | 3300017955 | Freshwater Sediment | MGSVISKPDRLPVESLLLDVADVLATSLDMDTTLRRVAEVVRKVID |
| Ga0187817_107301451 | 3300017955 | Freshwater Sediment | MSSVISKPDRLPVESLLLDVADVLATSLDLDTTLRRVAEVVRK |
| Ga0187778_105187912 | 3300017961 | Tropical Peatland | MKRMGSALAKPDQLPGESLLLDVADVLATSLDLDTTVRRVAEV |
| Ga0187804_105959951 | 3300018006 | Freshwater Sediment | MGSVLSKPDRLPVESLLLDVADVLATSLDLDTTLRRVAE |
| Ga0187805_104478002 | 3300018007 | Freshwater Sediment | MGSVLTKPEVDKPGRHLQVDPLLLEVADVLATSLDLD |
| Ga0187888_11951241 | 3300018008 | Peatland | MGSPLSKPVDHLPVEPLLLEVADVLATSLDLDTTLRRVAEVVRKVIDYE |
| Ga0187810_104285781 | 3300018012 | Freshwater Sediment | MRLLSYQAMGSVVSKPDRLPVESLLLDVADVLATSLDLDTTVRRVGEVVRKVID |
| Ga0187889_101504623 | 3300018023 | Peatland | MGSVLSKSGKHLPVEPLLLEVADVLATSLDLDTTLRRVAEVVRKVI |
| Ga0187855_102345611 | 3300018038 | Peatland | MGSVLSKPTQHLQIEPLLLEVADVLATSLDLDTTLRRIAEVVRKVID |
| Ga0187887_101780794 | 3300018043 | Peatland | MGSTLSKHEKTLHVEPLLLEVADVMATSLDLDTTLRRVAE |
| Ga0187890_107816281 | 3300018044 | Peatland | MGSVLSKPTQHLQIEPLLLEVADVLATSLDLDTTLRRI |
| Ga0187851_101771211 | 3300018046 | Peatland | MGSVLSKPERLPVESLLLDVADVLATSLDLDTTVRR |
| Ga0187859_104979932 | 3300018047 | Peatland | MESVLSETENHLPVEPLLLEVADVLATSLDLDTTLRRVAEVVRKV |
| Ga0187766_105883001 | 3300018058 | Tropical Peatland | MGSVLTKPERLPVESLLLDVADVLATSLDLDTTVRRVAEVVRKVIDYEIFA |
| Ga0187772_102683641 | 3300018085 | Tropical Peatland | MGSVLTKAERLPVESLLLDVADVLATSLDLDTTVRRVAEVVRKVID |
| Ga0187770_111581062 | 3300018090 | Tropical Peatland | MGSVLSHPGNLQVEPLLLEVSDVLATSLDLDTTLRRIAEAVRKVINYEIF |
| Ga0210403_102966811 | 3300020580 | Soil | MSSVISKPDRLPVESLLLDVADVLATSLDLDTTLSRVAEVVRKVIDYEIFAIL |
| Ga0210399_105273681 | 3300020581 | Soil | MGSVISKPERLPVESLLLDVADVLATSLDLDTTVSRVAEVVRKVIDY |
| Ga0210406_103678661 | 3300021168 | Soil | MDSVLSKPGRLPLESLMLDVADVLATSLDLDTTLSRVAELVRKV |
| Ga0210400_113752943 | 3300021170 | Soil | MSTVISKPERHLPIEPLLLEVADVLATSLDLDTTLRGV |
| Ga0210405_105715461 | 3300021171 | Soil | MESVLSKPEHQLPIEPLLLEVADVLSTSLDLDTTLRRVSEVVRKVI |
| Ga0210396_114335762 | 3300021180 | Soil | MGSVLSKQEKHLHVEPLLLEVSDVMATSLDLDTTLRRVAE |
| Ga0210388_104143611 | 3300021181 | Soil | MGSVLSKPDRLPVESLLLDVADVLATSLDLDTTVRRVAEVVRKVIDYE |
| Ga0210388_105523611 | 3300021181 | Soil | MGSVVSKPDRLPAESLLLDVADVLATSLDLDTTLRRVAEV |
| Ga0210393_102047501 | 3300021401 | Soil | MGSVLFQPDRLPVESLLLDVADVLSTSLDLDTTVRRIAELVRKVIEYEIFA |
| Ga0210386_109308541 | 3300021406 | Soil | MGSILSKSDRPLPVEPLLLEVADVLATSLDLDTTLRRVAEVVRK |
| Ga0210383_103408073 | 3300021407 | Soil | MGSVLSKHEKHVPVDPLLLEVSDVMSTSLDLDTTLRRVAEVVRKVIDYE |
| Ga0210394_102434641 | 3300021420 | Soil | MGSVLSKPDRLPVEALLLDVADVLATSLDLDTTLRRVAEVVRKVID |
| Ga0210384_111848011 | 3300021432 | Soil | MGSVLSKPDRLPVESLLLDVADVLATSLDLDTTVRRVAEVVRKVIDYEIF |
| Ga0210391_101564821 | 3300021433 | Soil | MGSVLSKPAQPLQIEPLLLEVADVLATSLDLDTTLRRVAEVVRKVIDY |
| Ga0210398_111183731 | 3300021477 | Soil | MSSVLSKPDRLPVESLLLDVADVLATSLDLDTTVRRVAEVVRKV |
| Ga0210409_113593621 | 3300021559 | Soil | MGSALTKHDKQLHVEPLLLEVADVMATSLDLDTTLRRIAEVVRKVI |
| Ga0126371_102914641 | 3300021560 | Tropical Forest Soil | MGSVISKPDRLPVESLLLDVADVLATSLDLDTTLRRVAEVVRRVID |
| Ga0242669_10426571 | 3300022528 | Soil | MGSVISKPDRLPVESLLLDVADVLATSLDLDTTLRRVAEVVRKVI |
| Ga0224566_1089281 | 3300022728 | Plant Litter | MGSVLSKPGQNLPIEPLLLEVADVLSTSLDLDTTLRRVAEVVR |
| Ga0224568_10091232 | 3300024220 | Plant Litter | MGSVLSKPDRLPGESLLLDVADVLATSLDLDTTVRRVAEVVRKVID |
| Ga0224572_10276653 | 3300024225 | Rhizosphere | MGSVLSKHEKHVAVDPLLIEVSDVMSTSLDLDTTLRRVAEVVRKVIDYEIF |
| Ga0224572_10800071 | 3300024225 | Rhizosphere | MGSVLSKPGQNLPIEPLLLEVADVLSTSLDLDTTLRRVAEVVRKVIDY |
| Ga0208936_10160083 | 3300025404 | Peatland | MGSTLSKHEKTLHVEPLLLEVADVMATSLDLDTTLRRVAEVVRKVIDYE |
| Ga0207692_101384932 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MGSTVFKPDRLAVESLLLDVADVLATSLDLDTTLRRVAEVVRKVIDYEIFA |
| Ga0207684_104189763 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTVISKPERHLPIEPLLLEVADVLATSLDLDTTLRRVSEVVRKVIDY |
| Ga0207660_106834941 | 3300025917 | Corn Rhizosphere | MSSVVSKPDPSPAESLLLDVADVLATSLDLDTTLRRVAEVVR |
| Ga0207679_106045521 | 3300025945 | Corn Rhizosphere | MSSVVSKPDPSPAESLLLDVADVLATSLDLDTTLRRVAEVVRKVINYEIFAI |
| Ga0209158_10498481 | 3300026333 | Soil | MGSVISKPDRLPVESLLLDVADVLATSLDLDTTLRRVAEVV |
| Ga0208238_10074581 | 3300027072 | Forest Soil | MGSVLSKPEKHVQVDPLLLEVSDVMATSLDLDTTLRRVSEVVRKVIDY |
| Ga0208239_10057441 | 3300027168 | Forest Soil | MGSVLSKSDRLPVESLLLDVADVLATSLDLDTTVRRVAE |
| Ga0209420_10236434 | 3300027648 | Forest Soil | METALSQPESHLPVEPLLLEVADVLATSLDLDTTLR |
| Ga0208989_102122681 | 3300027738 | Forest Soil | MDSVLTKPERQLPIEPLLLEVADVLSTSLDLDTTLRR |
| Ga0209910_100097291 | 3300027803 | Thawing Permafrost | MGSDPNKNDKHVPIDPLLLEVSDVMSTSLDLDTTLRRVAEVV |
| Ga0209040_101187373 | 3300027824 | Bog Forest Soil | MGSGLTKSEISPAESLLLDVADVLATSLDLDTTLRRVAEVVHKVINYEIFAIL |
| Ga0209060_101506421 | 3300027826 | Surface Soil | MGSVVSKPERLPVESLLLDVADVLATSLDLDTTLRRVAEVVRKVI |
| Ga0209693_104961602 | 3300027855 | Soil | MESVLSKHEKHVAVDPLLLEVADVMATSLDLDTTL |
| Ga0209167_100363605 | 3300027867 | Surface Soil | MGTALSKQEKHLHVEPLLIEVSDVMSTSLDLDTTLRRVAEVVR |
| Ga0209465_104976162 | 3300027874 | Tropical Forest Soil | VSAVVSKADRLPVESLLLDVADVLATSLDLDTTLRRVAEVVRK |
| Ga0209067_108712641 | 3300027898 | Watersheds | MGSVVSKPDRLPVESLLLDVADVLATSLDLETTVRRVAEVVRK |
| Ga0209415_103777041 | 3300027905 | Peatlands Soil | MGSVLSKPDRLPVESLLLDVADVLATSLDLDTTVRRVAEVVRKVIDYEIFAILL |
| Ga0209069_108938692 | 3300027915 | Watersheds | MGSVLSKSDRLPVESLLLDVADVLATSLDIDTTLRR |
| Ga0302233_103471511 | 3300028746 | Palsa | MIRNMESVISKPTSFPAESLLLDVADVLATSLDLDTTLRRVAEVVRK |
| Ga0302219_101693611 | 3300028747 | Palsa | MGSVLSNHEKHVAVDPLLLEVADVMATSLDLDTTLR |
| Ga0265338_107499141 | 3300028800 | Rhizosphere | MIRAMGSVISKPDRLPVESLLLDVADVLATSLDLDTTLRRVAEV |
| Ga0302155_100269645 | 3300028874 | Bog | MGSDPNKNDKHVPIDPLLLEVSDVMSTSLDLDTTL |
| Ga0308309_103853913 | 3300028906 | Soil | MGSVLSKHEKHVPVDPLLLEVSDVMSTSLDLDTTLRRVAEV |
| Ga0308309_104851451 | 3300028906 | Soil | MGSVLSKHEKHVAVDPLLLEVSDVMATSLDLDTTLRRV |
| Ga0311326_101118603 | 3300029917 | Bog | MEKLMASAGNNFESSLHVEPLLLEVSDVLATSLDLDTTLSRIAEVVRKVI |
| Ga0311326_102688211 | 3300029917 | Bog | MGSDPNKNDKHVPIDPLLLEVSDVMSTSLDLDTTLRRVAEVVR |
| Ga0311328_104177672 | 3300029939 | Bog | MASVLTKAGKTHEKLVQIDPLLLEVADVMSTSLDLDTTLRRVAEVVR |
| Ga0311340_101008821 | 3300029943 | Palsa | MIRNMESVISKPTSFPAESLLLDVADVLATSLDLDTTLRRVAEVVRKVIDYEIFAIL |
| Ga0302182_1000408910 | 3300030054 | Palsa | MGSVLSKPEKYLHVEPLLLEVSDVLATSLDLDTTLRRVAEVVRKVIDYEI |
| Ga0302275_101137564 | 3300030518 | Bog | MGSDPNKNDKHVPIDPLLLEVSDVMSTSLDLDTTLRRVA |
| Ga0311372_126567242 | 3300030520 | Palsa | MGSVLSKPDRLPVESLLLDVADVLATSLDLDTTVRRVAEVVRK |
| Ga0311356_106090271 | 3300030617 | Palsa | MIRNMESVISKPTSFPAESLLLDVADVLATSLDLDTTLRRVAEVVRKVIDYEIFAI |
| Ga0265462_109271331 | 3300030738 | Soil | MGSALSKPETHLPVERLLLEVADVLATSLDLDTTLRR |
| Ga0265462_121256101 | 3300030738 | Soil | MGSVLSKHEKHLQVEPLLLEVADVMATSLDLDTTLRRVAEVVRKVIDEKKVI |
| Ga0075388_108772242 | 3300030848 | Soil | MSSVLSKPDRLPVESLLLDVADVLATSLDLDTTVRR |
| Ga0170824_1137207393 | 3300031231 | Forest Soil | MSSVLSKPDRLPVESLLLDVADVLATSLDLDTTLRRVAEVV |
| Ga0302325_124379111 | 3300031234 | Palsa | MGSVLSKHETHLQVEPLLLEVADVMATSLDLDTTLRRVAEVVRKVIDY |
| Ga0307477_101643723 | 3300031753 | Hardwood Forest Soil | MGSVISKPDRLPVESLLLDVADIVATSLDLDTTVRRVADV |
| Ga0307475_100336866 | 3300031754 | Hardwood Forest Soil | MGTVLSKQEKHLHVEPLLIEVSDVMSTSLDLDTTLRRVAEVVRKVIDYEIFAIL |
| Ga0307475_104719991 | 3300031754 | Hardwood Forest Soil | MGPVLSKHEKHLHVEPLLLEVADVLATSLDLDTTLRRVAEI |
| Ga0307478_103999183 | 3300031823 | Hardwood Forest Soil | MGSALNTTGGQLQVEPLLLEVADVLATSLDLDTTLRRVAEVVRK |
| Ga0306925_119183481 | 3300031890 | Soil | MDSVLSKPGRLPVESLLLDVADALATSLDLDTTLRRVAEV |
| Ga0308175_1012331472 | 3300031938 | Soil | MSSVVSKTDPSPAESLLLDVADVLATSLDLDTTLRRVAEVVRKVIDYEIFAILL |
| Ga0335085_119651792 | 3300032770 | Soil | MDSVVSKPDRSPAEALLLDVADVLATSLDLDTTLRRVAEVVHKV |
| Ga0335078_104650101 | 3300032805 | Soil | MGSVLVKPERLPVESLLLDVADVLATSLDLDTTVRRVAEVV |
| Ga0335080_112465642 | 3300032828 | Soil | MGSIIAKPERLPVESLLLDVADVLATSLDLDTTVRRVAEVVRKVI |
| Ga0335081_10000123152 | 3300032892 | Soil | MGSVVSKPEKLPVESLMLDVADVLATSLDLETTLRRVA |
| Ga0335083_103181183 | 3300032954 | Soil | MDSVLSKPERLPVESLLLDVADVLATSLDLDTTVRRVAEV |
| Ga0335077_103861521 | 3300033158 | Soil | MGSVVSKPDRLPVESLLVYVADVHATSLDLDTPLRRVAEVVR |
| Ga0314861_0286222_2_124 | 3300033977 | Peatland | MGSVLTKPERLPVESLLLDVADVLATSLDLDTTVRRVAEVV |
| Ga0370492_0236997_638_742 | 3300034282 | Untreated Peat Soil | MGSVLTKADKHMQIDPFLLEVADVLATSLDLDTTL |
| ⦗Top⦘ |