


| Basic Information | |
|---|---|
| Family ID | F051284 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 144 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MPLEITQRETNGIYLLALKGRLVLGEESSGLLTVIDNLLASGAT |
| Number of Associated Samples | 121 |
| Number of Associated Scaffolds | 144 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 95.83 % |
| % of genes near scaffold ends (potentially truncated) | 96.53 % |
| % of genes from short scaffolds (< 2000 bps) | 91.67 % |
| Associated GOLD sequencing projects | 114 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.500 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.778 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.556 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.83% β-sheet: 19.44% Coil/Unstructured: 59.72% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 144 Family Scaffolds |
|---|---|---|
| PF07228 | SpoIIE | 6.25 |
| PF04264 | YceI | 2.08 |
| PF14534 | DUF4440 | 2.08 |
| PF02897 | Peptidase_S9_N | 2.08 |
| PF01738 | DLH | 1.39 |
| PF02954 | HTH_8 | 1.39 |
| PF01566 | Nramp | 1.39 |
| PF01850 | PIN | 1.39 |
| PF00144 | Beta-lactamase | 1.39 |
| PF14329 | DUF4386 | 1.39 |
| PF14520 | HHH_5 | 0.69 |
| PF00106 | adh_short | 0.69 |
| PF00719 | Pyrophosphatase | 0.69 |
| PF04255 | DUF433 | 0.69 |
| PF00582 | Usp | 0.69 |
| PF04471 | Mrr_cat | 0.69 |
| PF05016 | ParE_toxin | 0.69 |
| PF00199 | Catalase | 0.69 |
| PF16036 | Chalcone_3 | 0.69 |
| PF10027 | DUF2269 | 0.69 |
| PF01522 | Polysacc_deac_1 | 0.69 |
| PF07722 | Peptidase_C26 | 0.69 |
| PF02371 | Transposase_20 | 0.69 |
| PF07238 | PilZ | 0.69 |
| PF02661 | Fic | 0.69 |
| PF00589 | Phage_integrase | 0.69 |
| PF13581 | HATPase_c_2 | 0.69 |
| PF01904 | DUF72 | 0.69 |
| PF02517 | Rce1-like | 0.69 |
| PF01066 | CDP-OH_P_transf | 0.69 |
| PF09723 | Zn-ribbon_8 | 0.69 |
| PF12762 | DDE_Tnp_IS1595 | 0.69 |
| PF00691 | OmpA | 0.69 |
| PF07804 | HipA_C | 0.69 |
| PF02687 | FtsX | 0.69 |
| PF00933 | Glyco_hydro_3 | 0.69 |
| PF13858 | DUF4199 | 0.69 |
| PF00817 | IMS | 0.69 |
| PF13473 | Cupredoxin_1 | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
|---|---|---|---|
| COG1505 | Prolyl endopeptidase PreP, S9A serine peptidase family | Amino acid transport and metabolism [E] | 2.08 |
| COG1770 | Protease II | Amino acid transport and metabolism [E] | 2.08 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 2.08 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.39 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.39 |
| COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 1.39 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.39 |
| COG0221 | Inorganic pyrophosphatase | Energy production and conversion [C] | 0.69 |
| COG0389 | Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair | Replication, recombination and repair [L] | 0.69 |
| COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 0.69 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
| COG0753 | Catalase | Inorganic ion transport and metabolism [P] | 0.69 |
| COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 0.69 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.69 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.69 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.69 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.69 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.69 |
| COG3550 | Serine/threonine protein kinase HipA, toxin component of the HipAB toxin-antitoxin module | Signal transduction mechanisms [T] | 0.69 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.69 |
| COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.50 % |
| Unclassified | root | N/A | 12.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2040502001|FACENC_GAMC6GA01BVYHP | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 2170459023|GZGNO2B02I2G20 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300002917|JGI25616J43925_10026412 | All Organisms → cellular organisms → Bacteria | 2574 | Open in IMG/M |
| 3300004080|Ga0062385_11238242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 512 | Open in IMG/M |
| 3300005171|Ga0066677_10002461 | All Organisms → cellular organisms → Bacteria | 6953 | Open in IMG/M |
| 3300005178|Ga0066688_10022906 | All Organisms → cellular organisms → Bacteria | 3344 | Open in IMG/M |
| 3300005467|Ga0070706_101286026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium TAA 166 | 671 | Open in IMG/M |
| 3300005471|Ga0070698_100951798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 805 | Open in IMG/M |
| 3300005559|Ga0066700_10372162 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300005575|Ga0066702_10913414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300005591|Ga0070761_10158791 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
| 3300006034|Ga0066656_10909974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300006176|Ga0070765_101605387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 611 | Open in IMG/M |
| 3300007258|Ga0099793_10100074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1340 | Open in IMG/M |
| 3300007258|Ga0099793_10564146 | Not Available | 569 | Open in IMG/M |
| 3300007265|Ga0099794_10679070 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300009038|Ga0099829_10385595 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1157 | Open in IMG/M |
| 3300009038|Ga0099829_10495557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1014 | Open in IMG/M |
| 3300009089|Ga0099828_10403916 | Not Available | 1232 | Open in IMG/M |
| 3300010303|Ga0134082_10057855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1494 | Open in IMG/M |
| 3300010322|Ga0134084_10354060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300010359|Ga0126376_12664441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300010360|Ga0126372_11323087 | Not Available | 750 | Open in IMG/M |
| 3300010360|Ga0126372_12059500 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300010366|Ga0126379_11564083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 765 | Open in IMG/M |
| 3300010398|Ga0126383_10114558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2442 | Open in IMG/M |
| 3300011120|Ga0150983_10863732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300012189|Ga0137388_10319025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1428 | Open in IMG/M |
| 3300012205|Ga0137362_11656872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300012207|Ga0137381_10746931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 849 | Open in IMG/M |
| 3300012210|Ga0137378_10277250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1560 | Open in IMG/M |
| 3300012210|Ga0137378_11086948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 714 | Open in IMG/M |
| 3300012211|Ga0137377_11691818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300012351|Ga0137386_10393852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 997 | Open in IMG/M |
| 3300012357|Ga0137384_10915509 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
| 3300012359|Ga0137385_11127602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
| 3300012363|Ga0137390_10532706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1146 | Open in IMG/M |
| 3300012363|Ga0137390_10953546 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300012918|Ga0137396_10630668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
| 3300012925|Ga0137419_10218601 | Not Available | 1420 | Open in IMG/M |
| 3300012925|Ga0137419_10919906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 721 | Open in IMG/M |
| 3300012927|Ga0137416_10882537 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300012929|Ga0137404_11414184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300012929|Ga0137404_11535027 | Not Available | 617 | Open in IMG/M |
| 3300012930|Ga0137407_10898428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 838 | Open in IMG/M |
| 3300012944|Ga0137410_10917701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 741 | Open in IMG/M |
| 3300015052|Ga0137411_1078552 | All Organisms → cellular organisms → Bacteria | 1445 | Open in IMG/M |
| 3300015371|Ga0132258_11786371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1550 | Open in IMG/M |
| 3300016270|Ga0182036_10164746 | All Organisms → cellular organisms → Bacteria | 1592 | Open in IMG/M |
| 3300016270|Ga0182036_10902998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 724 | Open in IMG/M |
| 3300016294|Ga0182041_10795260 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300016357|Ga0182032_10066407 | All Organisms → cellular organisms → Bacteria | 2414 | Open in IMG/M |
| 3300016404|Ga0182037_10726427 | Not Available | 852 | Open in IMG/M |
| 3300016422|Ga0182039_12084416 | Not Available | 522 | Open in IMG/M |
| 3300017823|Ga0187818_10053327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium AB60 | 1738 | Open in IMG/M |
| 3300017955|Ga0187817_11047731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300017974|Ga0187777_10640064 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300017975|Ga0187782_11217788 | Not Available | 589 | Open in IMG/M |
| 3300017995|Ga0187816_10287996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium | 719 | Open in IMG/M |
| 3300018058|Ga0187766_10047957 | All Organisms → cellular organisms → Bacteria | 2505 | Open in IMG/M |
| 3300018058|Ga0187766_10429715 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300018085|Ga0187772_11458795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300018086|Ga0187769_10256069 | Not Available | 1303 | Open in IMG/M |
| 3300018088|Ga0187771_11877803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300018433|Ga0066667_10003321 | All Organisms → cellular organisms → Bacteria | 6618 | Open in IMG/M |
| 3300019278|Ga0187800_1062074 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300020006|Ga0193735_1025478 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1819 | Open in IMG/M |
| 3300020015|Ga0193734_1087908 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300020579|Ga0210407_10565283 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300020579|Ga0210407_10754948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
| 3300020579|Ga0210407_10805844 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
| 3300020579|Ga0210407_10961946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
| 3300020579|Ga0210407_11212220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300020579|Ga0210407_11371923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300020580|Ga0210403_10238825 | All Organisms → cellular organisms → Bacteria | 1491 | Open in IMG/M |
| 3300020581|Ga0210399_10386570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1167 | Open in IMG/M |
| 3300020583|Ga0210401_10454099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1144 | Open in IMG/M |
| 3300020583|Ga0210401_11476159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300021168|Ga0210406_10984194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300021178|Ga0210408_11394139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300021180|Ga0210396_10713069 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300021406|Ga0210386_10700385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae | 873 | Open in IMG/M |
| 3300021407|Ga0210383_10735094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 847 | Open in IMG/M |
| 3300021420|Ga0210394_11635718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300021432|Ga0210384_10341295 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
| 3300021474|Ga0210390_10220161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1606 | Open in IMG/M |
| 3300021474|Ga0210390_10657958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 875 | Open in IMG/M |
| 3300021475|Ga0210392_10771734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
| 3300021478|Ga0210402_11138509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 708 | Open in IMG/M |
| 3300021479|Ga0210410_10395445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1238 | Open in IMG/M |
| 3300021479|Ga0210410_10753098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 857 | Open in IMG/M |
| 3300021479|Ga0210410_10928523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 758 | Open in IMG/M |
| 3300021559|Ga0210409_10272072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1531 | Open in IMG/M |
| 3300021559|Ga0210409_10420232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1195 | Open in IMG/M |
| 3300024222|Ga0247691_1005505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2191 | Open in IMG/M |
| 3300024330|Ga0137417_1434642 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2194 | Open in IMG/M |
| 3300025910|Ga0207684_11009463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
| 3300025916|Ga0207663_10395020 | Not Available | 1056 | Open in IMG/M |
| 3300026304|Ga0209240_1124675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 872 | Open in IMG/M |
| 3300026314|Ga0209268_1175874 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300026315|Ga0209686_1003878 | All Organisms → cellular organisms → Bacteria | 6801 | Open in IMG/M |
| 3300026317|Ga0209154_1135548 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300026331|Ga0209267_1036239 | All Organisms → cellular organisms → Bacteria | 2318 | Open in IMG/M |
| 3300026527|Ga0209059_1339843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300026538|Ga0209056_10120143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2089 | Open in IMG/M |
| 3300026547|Ga0209156_10354347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
| 3300026548|Ga0209161_10169161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1246 | Open in IMG/M |
| 3300026548|Ga0209161_10365791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
| 3300026551|Ga0209648_10242716 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
| 3300026990|Ga0207824_1008760 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300027024|Ga0207819_1021810 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300027049|Ga0207806_1022958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
| 3300027070|Ga0208365_1051174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300027174|Ga0207948_1050059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300027590|Ga0209116_1131121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300027853|Ga0209274_10096419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1454 | Open in IMG/M |
| 3300028047|Ga0209526_10828790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300031057|Ga0170834_111554445 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300031231|Ga0170824_122120397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300031546|Ga0318538_10240632 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300031573|Ga0310915_10546130 | Not Available | 822 | Open in IMG/M |
| 3300031718|Ga0307474_10241641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1381 | Open in IMG/M |
| 3300031720|Ga0307469_11860116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300031753|Ga0307477_10824876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300031754|Ga0307475_10908151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
| 3300031820|Ga0307473_10487022 | Not Available | 829 | Open in IMG/M |
| 3300031823|Ga0307478_11169800 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium F42-01 | 641 | Open in IMG/M |
| 3300031833|Ga0310917_10148505 | All Organisms → cellular organisms → Bacteria | 1545 | Open in IMG/M |
| 3300031897|Ga0318520_11048799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300031945|Ga0310913_10817806 | Not Available | 657 | Open in IMG/M |
| 3300031947|Ga0310909_10823483 | Not Available | 766 | Open in IMG/M |
| 3300031962|Ga0307479_12046827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300032035|Ga0310911_10416685 | Not Available | 777 | Open in IMG/M |
| 3300032174|Ga0307470_10253923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1163 | Open in IMG/M |
| 3300032180|Ga0307471_102687095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
| 3300032782|Ga0335082_10804166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 802 | Open in IMG/M |
| 3300032782|Ga0335082_11557864 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300032954|Ga0335083_10604406 | Not Available | 903 | Open in IMG/M |
| 3300032955|Ga0335076_10383891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1289 | Open in IMG/M |
| 3300033158|Ga0335077_11143336 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
| 3300033158|Ga0335077_11615720 | Not Available | 616 | Open in IMG/M |
| 3300033289|Ga0310914_10826091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 825 | Open in IMG/M |
| 3300033289|Ga0310914_11812721 | Not Available | 514 | Open in IMG/M |
| 3300033983|Ga0371488_0396474 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.33% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.25% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.17% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.47% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.47% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.78% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.08% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.08% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.39% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.39% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.39% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.39% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.69% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.69% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.69% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.69% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2040502001 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2+ | Environmental | Open in IMG/M |
| 2170459023 | Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition) | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024222 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026990 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 73 (SPAdes) | Environmental | Open in IMG/M |
| 3300027024 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 42 (SPAdes) | Environmental | Open in IMG/M |
| 3300027049 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 72 (SPAdes) | Environmental | Open in IMG/M |
| 3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
| 3300027174 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes) | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACENCE_877040 | 2040502001 | Soil | MPLEITQREMNGIYLLALNGRLVLGQESGGLLTVIDNLLASGGTRIVINLEHV |
| FA3_11409560 | 2170459023 | Grass Soil | MPLEITQREMNGIYLLALNGRLVLGQESGGLLTVIDNLLASG |
| JGI25616J43925_100264121 | 3300002917 | Grasslands Soil | VPLEITQREMNGVCLLALKGRLALGEESTGLRTMIDNLLASGATRIVINL |
| Ga0062385_112382421 | 3300004080 | Bog Forest Soil | MPLEVTQREMNGIYVLALKGRLVLGQESNGFRTVIDNLLASG |
| Ga0066677_100024615 | 3300005171 | Soil | MSLEITQREMNGIYFLALKGRLVLGQQSSGLLTMTDNLFASGATRIVINLEQVKLC* |
| Ga0066688_100229062 | 3300005178 | Soil | MSLEITQREMNGIYLLALKGRLVLGQQSSGLLTMTDNLFASGATRIVINLEQVKLC* |
| Ga0070706_1012860261 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLEVTQREMNGICLLALKGRLVLGQESNGLHTVIDDLLASGATRIVINL |
| Ga0070698_1009517982 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLEVTQREMNGICLLALKGRLVLGQESNGLHTVIDDLLASGATRIVI |
| Ga0066700_103721622 | 3300005559 | Soil | MPLEITQREMNGIYLLALKGRLVLGEESSGLLAVIDNL |
| Ga0066702_109134142 | 3300005575 | Soil | MPLEITQREMNGIYLLALKGRLVLGEESSGLLAVIDNLLASGATRVV |
| Ga0070761_101587913 | 3300005591 | Soil | MSLEITQREMNGIYLLALKGRLVLGHESSGLRTMID |
| Ga0066656_109099741 | 3300006034 | Soil | EITQREMNGIYLLALKGRLVLGQQSSGLLTMTDNLFASGATRIVINLEQVKLC* |
| Ga0070765_1016053872 | 3300006176 | Soil | MPLEITQREIKGIYLLALKGRLVLGEESSGLRTMIDNLLASGATRIV |
| Ga0099793_101000741 | 3300007258 | Vadose Zone Soil | MPLEITQREMNGIYLLALKGRLVLGQESGGLLAMIDNLLASGATRIVINLEQVNY |
| Ga0099793_105641462 | 3300007258 | Vadose Zone Soil | VPLELTQREMSGIHVLALKGRLVLGPESVGLRTTVDDLLSSGVTRILIDLEHVS |
| Ga0099794_106790702 | 3300007265 | Vadose Zone Soil | MPLEITQRDMNGIYLLALKGRLVLGQESSGLLTVID |
| Ga0099829_103855951 | 3300009038 | Vadose Zone Soil | MPLEIAQREMNGIYLLALKGRLVLGEESSGLLTVIDNLLASGVTRIVVNLEHVN |
| Ga0099829_104955571 | 3300009038 | Vadose Zone Soil | MPLEITQRETNEIYLLALKGRLVLGEESSGLLTMIDNLL |
| Ga0099828_104039162 | 3300009089 | Vadose Zone Soil | MPLEITQRETNGIYLLALKGRLVLGEESSGLLTVIDNLLASGAT |
| Ga0134082_100578551 | 3300010303 | Grasslands Soil | MNGIYLLALKGRLVLGQESNGLRAMIDNLLASGGTRIVINLEHVNYVDS |
| Ga0134084_103540602 | 3300010322 | Grasslands Soil | MPLEITQREMNGIYLLALKGRLVLGEESSGLLAVIDNLL |
| Ga0126376_126644411 | 3300010359 | Tropical Forest Soil | VPLEITQRDANGIYILALRGRLVLGQESSGLRTTVNNLLSSGVTRLVINLEH |
| Ga0126372_113230872 | 3300010360 | Tropical Forest Soil | MPLEITQREMNGIYLLALNGRLVLGQESGGLLTMIDN |
| Ga0126372_120595002 | 3300010360 | Tropical Forest Soil | LEITQRETDGIHLLALKGRLVLGDESNGFRTTVENLLSSGATRIVVNFEH |
| Ga0126379_115640831 | 3300010366 | Tropical Forest Soil | VSLEITQREEDGIYRLALKGRLVLGDENIGFRTIVENLLAAGATRIVVNLEHVNY |
| Ga0126383_101145586 | 3300010398 | Tropical Forest Soil | VALEITQREVDGIYRLALKGRLVLGDENIGFRTAIDDLLG |
| Ga0150983_108637321 | 3300011120 | Forest Soil | MPLEITQREMNGIYLLALNGRLALGQESSGLLTMVDNLLASGATRIVINLE |
| Ga0137388_103190251 | 3300012189 | Vadose Zone Soil | MPLEITQRETKGIYLLALKGRLVLGEESSGLLTVIDNLLASGATRIVINLEQ |
| Ga0137362_116568722 | 3300012205 | Vadose Zone Soil | MPLEITQRETNGIYLLALKGRLVLGEESSGLLTMIDNLLASGATRMVINLE |
| Ga0137381_107469311 | 3300012207 | Vadose Zone Soil | MPLEITQREMNGIYLLALKGRLVLGQESSGLLTMTDNLLASAATRIV |
| Ga0137378_102772503 | 3300012210 | Vadose Zone Soil | MPLEITQRETNGIYLLALKGRLVLGEESSGLLTTIDNP |
| Ga0137378_110869482 | 3300012210 | Vadose Zone Soil | MPLEITQRETNGIYLLALKGRLVLGEESMGLLTVIDNLLASGATRMVV |
| Ga0137377_116918181 | 3300012211 | Vadose Zone Soil | MPLEITQRETNGIYLLALKGRLVLGEESSGLLTVIDNL |
| Ga0137386_103938523 | 3300012351 | Vadose Zone Soil | MNATFKVWTVALEITERELEGVYVLVLRGRLVLGEESSRFRTTVETLLSKGAA |
| Ga0137384_109155092 | 3300012357 | Vadose Zone Soil | MPLEITQRETNGIYLLALKGRLVLGEESSGLLTVIDNLLASG |
| Ga0137385_111276021 | 3300012359 | Vadose Zone Soil | VPLEITQREMNGIYLLALRGRLVLGEESSGFRTTVDNLLS |
| Ga0137390_105327062 | 3300012363 | Vadose Zone Soil | MPLEITQRETNGIYLLALKGRLVLGEESSGLLTTID |
| Ga0137390_109535462 | 3300012363 | Vadose Zone Soil | MPLEITQRDMNGIYLLALKGRLVLGQESSGLLTMI |
| Ga0137396_106306682 | 3300012918 | Vadose Zone Soil | MPLEITQREMNGIYLLALKGRLALGQESSGLLTMIDNLLASGA |
| Ga0137419_102186012 | 3300012925 | Vadose Zone Soil | VPLEITQRETNGVYVLTLSGRLVLGPESIGLRTTIDNLLSSGGAKIVV |
| Ga0137419_109199061 | 3300012925 | Vadose Zone Soil | MPLEITQRELNGIYLLALKGRLVLGQESSGLLTMIDNLLASGATRM |
| Ga0137416_108825372 | 3300012927 | Vadose Zone Soil | MPLEITQREMNGIYLLALKGRLVLGDESSGLLTMIDNLLASGATRMV |
| Ga0137404_114141841 | 3300012929 | Vadose Zone Soil | MPLEITQREMNGIYVLALKGRLVLGQESSGLLTMTDNLLASGATRIVINLEQVNY |
| Ga0137404_115350271 | 3300012929 | Vadose Zone Soil | LAQEEGCPVPLEITQRETNGIYVLTLSGRLVLGPESIGLRTTIDNLLSSGGAKIVVGLEHVNSVDSAGI |
| Ga0137407_108984282 | 3300012930 | Vadose Zone Soil | MPLEITQRETNGIYVLALKGRLVLGDESIGLLAMLDNLLASGAT |
| Ga0137410_109177013 | 3300012944 | Vadose Zone Soil | MPLEITQREMNGIYLLALKGRLVLGEESSGLRTTIDNLLAS |
| Ga0137411_10785523 | 3300015052 | Vadose Zone Soil | MPLEITQREMNGIYLLALKGRLVLGQESSGLLAMIDNLVASGAT |
| Ga0132258_117863713 | 3300015371 | Arabidopsis Rhizosphere | VPLEITQREINGVYLLALRGRLVLGEKSSGFRETVENLLSTRATKIVVNLERVTDVDSAG |
| Ga0182036_101647461 | 3300016270 | Soil | VALEITQREINGIYVLALTGRLVLGEESNGLRTTV |
| Ga0182036_109029982 | 3300016270 | Soil | VPLEITQREMNGIYLLTLKGRLVLGEESNGFRTTIDSLLSTGATRIVV |
| Ga0182041_107952602 | 3300016294 | Soil | VALDITQREVNGIYILALEGRLVLGEESNGLRTTVE |
| Ga0182032_100664074 | 3300016357 | Soil | VALEITQREINGIYVLALTGRLVLGEESNGLRTTVE |
| Ga0182037_107264272 | 3300016404 | Soil | MPLEITQREMNGIYLLALNGRLVLGQESSGLLTVIDNLLASGATRVVINLEHV |
| Ga0182039_120844162 | 3300016422 | Soil | VALEITQREVSGIYVLALEGRLVLGEESNGLRTTVENLLSAGA |
| Ga0187818_100533272 | 3300017823 | Freshwater Sediment | MPLEITQREVNGIYLLALKGRLVLGQESIGLLTMMDNLL |
| Ga0187817_110477311 | 3300017955 | Freshwater Sediment | MPLEITQREVNGIYLLALKGRLVLGQESSGLLTMMD |
| Ga0187777_106400641 | 3300017974 | Tropical Peatland | VSLEITQREINGIYLLALRGRLVLGEESNGLRTTVDNLLAAGATRVV |
| Ga0187782_112177882 | 3300017975 | Tropical Peatland | MRLEIQQKETQGIQVLDLTGRLVLGEEDLALRQRL |
| Ga0187816_102879961 | 3300017995 | Freshwater Sediment | MPLEITQREVNGIYLLALKGRLVLGQESSGLLTMM |
| Ga0187766_100479575 | 3300018058 | Tropical Peatland | MALEITQQESNGICVLALKGRLVLGEESTGFRATVEKLLSSGTK |
| Ga0187766_104297151 | 3300018058 | Tropical Peatland | MPLEITQREMNGIYLLALKGRLALGQESTGLRTVIDGLLASGATR |
| Ga0187772_114587952 | 3300018085 | Tropical Peatland | VPLEIIQRETNGIYLLGLNGRLVLGEESSGVRATVDNLLTSGA |
| Ga0187769_102560693 | 3300018086 | Tropical Peatland | VPLEITQRETNGVYLLALRGRLVLGDESSGFRTTIDSLLATGATRIVV |
| Ga0187771_118778032 | 3300018088 | Tropical Peatland | MALEITQQEANGICVLALKGRLVLGEESSGFRATVEKLLSSGT |
| Ga0066667_100033213 | 3300018433 | Grasslands Soil | MSLEITQREMNGIYLLALKGRLVLGQQSSGLLTMTDNLFASGATRIVINLEQVKLC |
| Ga0187800_10620742 | 3300019278 | Peatland | VSLEITQRETNGIYLLGLKGRLVLGDESTGVRATVETLLSSGATKII |
| Ga0193735_10254781 | 3300020006 | Soil | MPLEITQREMNGIYLLALKGRLVLGQESSGLLTMTDNLLASGATRIV |
| Ga0193734_10879082 | 3300020015 | Soil | MPLEITQREMNGIYLLALKGRLVLGQESSGLLTMTDNL |
| Ga0210407_105652833 | 3300020579 | Soil | MSLEITQRETNGIYLLALKGRLVLGEESRGLLTVIDRLLE |
| Ga0210407_107549482 | 3300020579 | Soil | MPLEITQRETNGIYLLALKGRLVLGEESSGLLTTIDHLLASGATRMVIN |
| Ga0210407_108058442 | 3300020579 | Soil | MPLEITQREMNGIYLLALKGRLVLGQESSGLRAMIDNLLA |
| Ga0210407_109619461 | 3300020579 | Soil | MPLEITQREMNGIYLLALNGRLALGQESSGLLTMVDKLLASSATRIVINLEH |
| Ga0210407_112122201 | 3300020579 | Soil | MPLEITQREMNGIYLLALKGRLVLGPESSGLLTVVDNLL |
| Ga0210407_113719232 | 3300020579 | Soil | MPLEITQRETNGIYLLALKGRLVLGQESSGLLSMI |
| Ga0210403_102388252 | 3300020580 | Soil | MPLEVTQREMNGTYLLALKGRLVLGQESNGLHTMIDNLLASGATRIVINLDQVN |
| Ga0210399_103865703 | 3300020581 | Soil | MPLEITQREMNGIYVLALKGRLVLGQESSGLRAMIDNLLAS |
| Ga0210401_104540992 | 3300020583 | Soil | MPLEVTQREMNGIYLLALNGRLALGQESSGLLTMID |
| Ga0210401_114761591 | 3300020583 | Soil | MPLEITQREINGIYLLALKGRLALGQESSGLRAMIDNLLASGVTRIVINLEHVNYV |
| Ga0210406_109841941 | 3300021168 | Soil | MPLEITQREMNGIYLLALNGRLALGQESSGLLTMVDKLLA |
| Ga0210408_113941391 | 3300021178 | Soil | MPLEITQREMNGIYLLALNGRLALGQESSGLLTMIDNLLASG |
| Ga0210396_107130691 | 3300021180 | Soil | VPLEITQRETDGIYLLTLKGRLVLGLENNGLRTVIDNLLVSGATKIVV |
| Ga0210386_107003852 | 3300021406 | Soil | VSLEITQRETKGVYLLSLSGRLVLGDESIGLRTMVDNLLTSGATRVVINLEHVHY |
| Ga0210383_107350941 | 3300021407 | Soil | MPLEITQREMNGVYLLALKGRLVLGQESRGLLTMSDNLVASGAARIVINLEQVNYVD |
| Ga0210394_116357181 | 3300021420 | Soil | VPLEITQRETDGIYLLTLKGRLVLGLENNGLRTVIDNLLVSGATKIVVN |
| Ga0210384_103412951 | 3300021432 | Soil | MPLEIVQREMNGIYLLALDGRLVLGKESTGLRTMIENLLETGATRIVI |
| Ga0210390_102201614 | 3300021474 | Soil | MPLEITQREMNGIYLLALKGRLVLGQESRGLLTMFDNLVASGAARIVINLEQ |
| Ga0210390_106579581 | 3300021474 | Soil | MPLEITQREMNGVYLLALKGRLVLGQESRGLLTMSDNLVASGAARIVINLEQV |
| Ga0210392_107717342 | 3300021475 | Soil | VPLEITQRETNGIYVLTLSGRLVLGPESIGLRTTIDNLLSSGAEKMVVG |
| Ga0210402_111385092 | 3300021478 | Soil | MPLEITQREMNGIYLLALNGRLALGQESSGLLTMIDNLL |
| Ga0210410_103954452 | 3300021479 | Soil | VPLEITQREANGIYLLTLKGRLVLGLENNGLRTMVDNLLVLGATKIVVNLERV |
| Ga0210410_107530982 | 3300021479 | Soil | MPLEITQREVNGIYLLALKGRLALGQESSGLRTMIDN |
| Ga0210410_109285231 | 3300021479 | Soil | VALEITQRETDGLYLLALRGRLALGEESAGFRSAIDNLL |
| Ga0210409_102720722 | 3300021559 | Soil | MPLEVTQREMNGIYLLALKGRLVLGQESNGLHTVVDNLLAS |
| Ga0210409_104202322 | 3300021559 | Soil | VPLEITQRETDGIYLLTLKGRLVLGLENNGLRTVIDNLLVSGATKIVVNLEHVNSVD |
| Ga0247691_10055051 | 3300024222 | Soil | VPLEITQRETNGIYILTLGGRLVLGPESIGLRTTVDNLLSSGAERIVVG |
| Ga0137417_14346424 | 3300024330 | Vadose Zone Soil | MPLEITQRETNGIYLLALKGRLVLGEESSGLLTMIDNLLHPRYTDGH |
| Ga0207684_110094631 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLEVTQREMNGICLLALKGRLVLGQESNGLHTVIDDLLASGATRIVINLEQV |
| Ga0207663_103950201 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VPLEITQREINGIYLLALRGRLVLGDESRGFRETVENLLST |
| Ga0209240_11246752 | 3300026304 | Grasslands Soil | VPLEITQREMNGVCLLALKGRLALGEESTGLRTMIDNLLA |
| Ga0209268_11758742 | 3300026314 | Soil | MPLEITQREMNGIYLLALKGRLVLGQENSGLLTMTDN |
| Ga0209686_10038783 | 3300026315 | Soil | MSLEITQREMNGIYFLALKGRLVLGQQSSGLLTMTDNLFASGATRIVINLEQVKLC |
| Ga0209154_11355482 | 3300026317 | Soil | MPLEITQREMNGIYLLALKGRLVLGEESSGLLAVIDNLLA |
| Ga0209267_10362393 | 3300026331 | Soil | ITQREMNGIYLLALKGRLVLGQQSSGLLTMTDNLFASGATRIVINLEQVKLC |
| Ga0209059_13398431 | 3300026527 | Soil | MPLEITQREMNGIYLLALKGRLVLGEESSGLLAVI |
| Ga0209056_101201433 | 3300026538 | Soil | MPLEITQREMNGIYLLALKGRLVLGEESSGLLAVIDNLLASGATRVVINLEQ |
| Ga0209156_103543472 | 3300026547 | Soil | MPLEITQRETNGIYLLALKGRLVLGEESSGLLTVIDNLLASGATRIVVNLE |
| Ga0209161_101691611 | 3300026548 | Soil | MPLEITQREMKGIYLLALKGRLVLGEESSGLLTTIDSLLA |
| Ga0209161_103657911 | 3300026548 | Soil | MPLEITQREMNGIYLLALKGRLVLGQESNGLRVMIDNLL |
| Ga0209648_102427161 | 3300026551 | Grasslands Soil | MPLEITQREMKGIYLLALNGRLALGQESSGLLTMVDNLLASGATRIVINLEHVN |
| Ga0207824_10087602 | 3300026990 | Tropical Forest Soil | VALEITQREINGIYVLALTGRLVLGEESNGLRTTVEKLLSVSATKIV |
| Ga0207819_10218101 | 3300027024 | Tropical Forest Soil | VALEITQREINGIYVLALTGRLVLGEESNGLRTTVEKLLSVSA |
| Ga0207806_10229582 | 3300027049 | Tropical Forest Soil | MPLELTQREMNGIYLLALSGRLVLGQESSGLRTTVDNLLSSGATRIVIN |
| Ga0208365_10511742 | 3300027070 | Forest Soil | MPLEITQREMNGIYLLALNGRLALGQESSGLLTMVDNLLASGATRIVIN |
| Ga0207948_10500591 | 3300027174 | Forest Soil | MPLEITQREMNGIYLLALKGRLVLGQESSGVLTMVDN |
| Ga0209116_11311212 | 3300027590 | Forest Soil | MSLEITQREMNGIYLLALKGRLVLGHESSGLRTMIDKLLACGV |
| Ga0209274_100964191 | 3300027853 | Soil | MSLEITQREMNGIYLLALKGRLVLGHESSGLRTMIDKLLAS |
| Ga0209526_108287902 | 3300028047 | Forest Soil | VPLEITQRETNGICLLTLKGRLVLGEESNGLRTTIDNLLS |
| Ga0170834_1115544452 | 3300031057 | Forest Soil | VSLEITQREINGIYLLALQGRLVLGEESNGFRATVENLLSTGATKL |
| Ga0170824_1221203971 | 3300031231 | Forest Soil | MPLEITQREMNGVYLLALKGRLVLGQESRGLLTMFDNLVASGAARIVINLEQVNY |
| Ga0318538_102406322 | 3300031546 | Soil | VALEITQREVNGIYVLALEGRLVLGEESNGLRTTVENLLSAGATK |
| Ga0310915_105461302 | 3300031573 | Soil | VALEITQREVNGIYVLALEGRLVLGEESNGLRTTVENLLSAGATKI |
| Ga0307474_102416411 | 3300031718 | Hardwood Forest Soil | MPLEITQREMNGIYLLALKGRLVLGQESRGLLTMFD |
| Ga0307469_118601161 | 3300031720 | Hardwood Forest Soil | MPLEITQREMNGIYLLALNGRLVLGQESGGLLTVIDNLLASGGTRIVI |
| Ga0307477_108248762 | 3300031753 | Hardwood Forest Soil | MPLEVTQREMNGIYLLALKGRLVLGEESNGLRTVIDNLLASGATRIVV |
| Ga0307475_109081511 | 3300031754 | Hardwood Forest Soil | MPLEITQREMNGIYLLALNGRLALGQESSGLLTTVDNLLASG |
| Ga0307473_104870221 | 3300031820 | Hardwood Forest Soil | MPLEITQREMNGIYLLALNGRLVLGQESSGLLTVIDNLLASGGNR |
| Ga0307478_111698002 | 3300031823 | Hardwood Forest Soil | MPLEITQREMNGIYLLALNGRLVLGQESSGLLTMIDNLLAS |
| Ga0310917_101485053 | 3300031833 | Soil | VALEITQREINGIYVLALTGRLVLGEESNGLRTTVEKLLSGSATK |
| Ga0318520_110487991 | 3300031897 | Soil | VPLEITQREMNGIYLLTLKGRLVLGEESNGFRTTIDSLLSTGATRIVVN |
| Ga0310913_108178061 | 3300031945 | Soil | MPLEITQREMNGIYLLALNGRLVLGQESSGLLTVI |
| Ga0310909_108234831 | 3300031947 | Soil | VALEITQREVSGIYVLALEGRLVLGEESNGLRTTVENLLSAGATKIVV |
| Ga0307479_120468271 | 3300031962 | Hardwood Forest Soil | MPLEVTQREMNGIYLLALKGRLVLGQESNGLHTVVDNLLASGATRIVINLE |
| Ga0310911_104166851 | 3300032035 | Soil | VALEITQREVNGIYVLALEGRLVLGEESNGLRTTVENLLSAGAT |
| Ga0307470_102539231 | 3300032174 | Hardwood Forest Soil | MPLEITQREMNGIYLLALNGRLVLGQESSGLLTMIDNLLASGATRIVINL |
| Ga0307471_1026870952 | 3300032180 | Hardwood Forest Soil | MPLEITQREMNGIHLLALKGRLVLGQESSGLLTTIDNLLASGGIRIVINLEQVNY |
| Ga0335082_108041661 | 3300032782 | Soil | VPLEITQREVNGIYLLALRGRLVLGAESDGLRATIESLLASGSTRIVVNLEH |
| Ga0335082_115578641 | 3300032782 | Soil | VSLEITQREMNGIYLLTLKGRLVLGLESNGLRTAIDDLL |
| Ga0335083_106044062 | 3300032954 | Soil | MSMEITQREHEGVYLLALKGRLALGQESDGLRAMVDK |
| Ga0335076_103838912 | 3300032955 | Soil | VSLEITQRETNGIYLLALSGRLALGDESAGFRSTIDNLLAAGATRI |
| Ga0335077_111433362 | 3300033158 | Soil | MPLEITQREMNGIYVLALNGRLVLGQESSGLLAVVDNLLGSGSAR |
| Ga0335077_116157201 | 3300033158 | Soil | VALEITQRETDGLYVLALSGRLALGDESAGFRSTIDNLLAAGATRIVVN |
| Ga0310914_108260911 | 3300033289 | Soil | VPLEITQREVNGIYVLALRGRLVLGEESNGLRTTID |
| Ga0310914_118127211 | 3300033289 | Soil | VALEITQREVNGIYVLALEGRLVLGEESNGLRTTVE |
| Ga0371488_0396474_3_185 | 3300033983 | Peat Soil | MPLEITQHETNGIYLLALKGRLALGLESNGLRTVIDDLLASGATRIIINLEHVDYVDSAG |
| ⦗Top⦘ |