


| Basic Information | |
|---|---|
| Family ID | F051236 |
| Family Type | Metagenome |
| Number of Sequences | 144 |
| Average Sequence Length | 48 residues |
| Representative Sequence | IFDLHGNYSAAIWGLIVISALMVPLSLAMASPAELAKRIGQQRIRE |
| Number of Associated Samples | 130 |
| Number of Associated Scaffolds | 144 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.92 % |
| % of genes from short scaffolds (< 2000 bps) | 86.81 % |
| Associated GOLD sequencing projects | 122 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.056 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (11.111 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.944 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (36.806 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 144 Family Scaffolds |
|---|---|---|
| PF04909 | Amidohydro_2 | 11.11 |
| PF00753 | Lactamase_B | 6.94 |
| PF09084 | NMT1 | 4.17 |
| PF01124 | MAPEG | 2.78 |
| PF00701 | DHDPS | 2.78 |
| PF03401 | TctC | 2.08 |
| PF01738 | DLH | 2.08 |
| PF01593 | Amino_oxidase | 2.08 |
| PF01042 | Ribonuc_L-PSP | 1.39 |
| PF13532 | 2OG-FeII_Oxy_2 | 1.39 |
| PF01717 | Meth_synt_2 | 1.39 |
| PF00528 | BPD_transp_1 | 1.39 |
| PF05990 | DUF900 | 1.39 |
| PF00296 | Bac_luciferase | 1.39 |
| PF07690 | MFS_1 | 1.39 |
| PF13193 | AMP-binding_C | 1.39 |
| PF01797 | Y1_Tnp | 1.39 |
| PF02515 | CoA_transf_3 | 1.39 |
| PF00496 | SBP_bac_5 | 0.69 |
| PF04392 | ABC_sub_bind | 0.69 |
| PF05635 | 23S_rRNA_IVP | 0.69 |
| PF00903 | Glyoxalase | 0.69 |
| PF01402 | RHH_1 | 0.69 |
| PF01609 | DDE_Tnp_1 | 0.69 |
| PF02371 | Transposase_20 | 0.69 |
| PF11154 | DUF2934 | 0.69 |
| PF14518 | Haem_oxygenas_2 | 0.69 |
| PF12146 | Hydrolase_4 | 0.69 |
| PF01850 | PIN | 0.69 |
| PF02449 | Glyco_hydro_42 | 0.69 |
| PF00075 | RNase_H | 0.69 |
| PF00990 | GGDEF | 0.69 |
| PF09994 | DUF2235 | 0.69 |
| PF05973 | Gp49 | 0.69 |
| PF13343 | SBP_bac_6 | 0.69 |
| PF16864 | Dimerisation2 | 0.69 |
| PF01425 | Amidase | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
|---|---|---|---|
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 5.56 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 4.17 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 4.17 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 2.08 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 1.39 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 1.39 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 1.39 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 1.39 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.39 |
| COG4782 | Esterase/lipase superfamily enzyme | General function prediction only [R] | 1.39 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| COG1874 | Beta-galactosidase GanA | Carbohydrate transport and metabolism [G] | 0.69 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.69 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.69 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.69 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.69 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.69 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.69 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.69 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.69 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.69 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.06 % |
| Unclassified | root | N/A | 6.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000559|F14TC_102730547 | All Organisms → cellular organisms → Bacteria | 1603 | Open in IMG/M |
| 3300002407|C687J29651_10092500 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300003987|Ga0055471_10107520 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300004009|Ga0055437_10209614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Sinimarinibacterium → unclassified Sinimarinibacterium → Sinimarinibacterium sp. CAU 1509 | 627 | Open in IMG/M |
| 3300004012|Ga0055464_10093275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 829 | Open in IMG/M |
| 3300004114|Ga0062593_100834000 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300004778|Ga0062383_10221032 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300005166|Ga0066674_10129117 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1186 | Open in IMG/M |
| 3300005172|Ga0066683_10109042 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1683 | Open in IMG/M |
| 3300005178|Ga0066688_10567402 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300005187|Ga0066675_11067148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 604 | Open in IMG/M |
| 3300005289|Ga0065704_10355683 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300005294|Ga0065705_10218272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1329 | Open in IMG/M |
| 3300005327|Ga0070658_11023323 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300005353|Ga0070669_100036622 | All Organisms → cellular organisms → Bacteria | 3556 | Open in IMG/M |
| 3300005355|Ga0070671_100981944 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 739 | Open in IMG/M |
| 3300005440|Ga0070705_101239652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 616 | Open in IMG/M |
| 3300005456|Ga0070678_101775222 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300005457|Ga0070662_101708443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300005558|Ga0066698_10114360 | All Organisms → cellular organisms → Bacteria | 1793 | Open in IMG/M |
| 3300005829|Ga0074479_10991654 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300005841|Ga0068863_101831352 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300005888|Ga0075289_1001334 | All Organisms → cellular organisms → Bacteria | 3204 | Open in IMG/M |
| 3300006058|Ga0075432_10056918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1387 | Open in IMG/M |
| 3300006224|Ga0079037_102257465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300006755|Ga0079222_10178506 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300006794|Ga0066658_10641071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 581 | Open in IMG/M |
| 3300006797|Ga0066659_10081166 | All Organisms → cellular organisms → Bacteria | 2152 | Open in IMG/M |
| 3300006845|Ga0075421_100942830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 982 | Open in IMG/M |
| 3300006845|Ga0075421_101258318 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300006846|Ga0075430_100117210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2219 | Open in IMG/M |
| 3300006847|Ga0075431_101200128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 721 | Open in IMG/M |
| 3300006852|Ga0075433_10142409 | All Organisms → cellular organisms → Bacteria | 2131 | Open in IMG/M |
| 3300006903|Ga0075426_10419571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 989 | Open in IMG/M |
| 3300006904|Ga0075424_100969773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Sinimarinibacterium → unclassified Sinimarinibacterium → Sinimarinibacterium sp. CAU 1509 | 906 | Open in IMG/M |
| 3300006904|Ga0075424_101163019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 822 | Open in IMG/M |
| 3300006914|Ga0075436_100063845 | All Organisms → cellular organisms → Bacteria | 2545 | Open in IMG/M |
| 3300009100|Ga0075418_12857253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300009147|Ga0114129_10689337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1314 | Open in IMG/M |
| 3300009148|Ga0105243_10420060 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
| 3300009156|Ga0111538_10775426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1214 | Open in IMG/M |
| 3300009162|Ga0075423_10918211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 928 | Open in IMG/M |
| 3300009162|Ga0075423_12302609 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300009168|Ga0105104_10118978 | All Organisms → cellular organisms → Bacteria | 1423 | Open in IMG/M |
| 3300009444|Ga0114945_10091961 | Not Available | 1697 | Open in IMG/M |
| 3300009553|Ga0105249_12659756 | Not Available | 572 | Open in IMG/M |
| 3300009609|Ga0105347_1023146 | All Organisms → cellular organisms → Bacteria | 2144 | Open in IMG/M |
| 3300009609|Ga0105347_1134614 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300009609|Ga0105347_1136052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 952 | Open in IMG/M |
| 3300009610|Ga0105340_1451803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 574 | Open in IMG/M |
| 3300010040|Ga0126308_10677280 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300010043|Ga0126380_10682583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 823 | Open in IMG/M |
| 3300010047|Ga0126382_11774393 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300010329|Ga0134111_10041846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1637 | Open in IMG/M |
| 3300010336|Ga0134071_10087502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1466 | Open in IMG/M |
| 3300010336|Ga0134071_10382628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 715 | Open in IMG/M |
| 3300010362|Ga0126377_10121117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2417 | Open in IMG/M |
| 3300010362|Ga0126377_13393875 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
| 3300010362|Ga0126377_13411004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300010376|Ga0126381_104645428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300010391|Ga0136847_11902580 | Not Available | 2263 | Open in IMG/M |
| 3300010396|Ga0134126_10762641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1096 | Open in IMG/M |
| 3300011417|Ga0137326_1042483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 982 | Open in IMG/M |
| 3300011440|Ga0137433_1100026 | Not Available | 905 | Open in IMG/M |
| 3300012038|Ga0137431_1017619 | All Organisms → cellular organisms → Bacteria | 1949 | Open in IMG/M |
| 3300012175|Ga0137321_1093683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 675 | Open in IMG/M |
| 3300012198|Ga0137364_10473724 | Not Available | 940 | Open in IMG/M |
| 3300012200|Ga0137382_10566051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Sinimarinibacterium → unclassified Sinimarinibacterium → Sinimarinibacterium sp. CAU 1509 | 810 | Open in IMG/M |
| 3300012349|Ga0137387_10552273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 835 | Open in IMG/M |
| 3300012350|Ga0137372_10088157 | All Organisms → cellular organisms → Bacteria | 2628 | Open in IMG/M |
| 3300012514|Ga0157330_1067959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300012517|Ga0157354_1014026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 850 | Open in IMG/M |
| 3300012673|Ga0137339_1015484 | Not Available | 752 | Open in IMG/M |
| 3300012922|Ga0137394_10210297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1663 | Open in IMG/M |
| 3300012922|Ga0137394_11001075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 695 | Open in IMG/M |
| 3300012929|Ga0137404_11638918 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300012930|Ga0137407_12216843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 525 | Open in IMG/M |
| 3300012948|Ga0126375_11719195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300012964|Ga0153916_10377585 | All Organisms → cellular organisms → Bacteria | 1472 | Open in IMG/M |
| 3300012975|Ga0134110_10629139 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 501 | Open in IMG/M |
| 3300012976|Ga0134076_10559818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300014272|Ga0075327_1028547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1662 | Open in IMG/M |
| 3300014324|Ga0075352_1265779 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 534 | Open in IMG/M |
| 3300014968|Ga0157379_10583095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1043 | Open in IMG/M |
| 3300015264|Ga0137403_10218797 | All Organisms → cellular organisms → Bacteria | 1828 | Open in IMG/M |
| 3300015357|Ga0134072_10379499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 551 | Open in IMG/M |
| 3300015372|Ga0132256_101045356 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 932 | Open in IMG/M |
| 3300015372|Ga0132256_101527442 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300015373|Ga0132257_100314965 | All Organisms → cellular organisms → Bacteria | 1883 | Open in IMG/M |
| 3300015374|Ga0132255_101763141 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300015374|Ga0132255_104528675 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300015374|Ga0132255_105298754 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300015374|Ga0132255_106194651 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300016294|Ga0182041_10358784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1228 | Open in IMG/M |
| 3300018028|Ga0184608_10112232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1148 | Open in IMG/M |
| 3300018072|Ga0184635_10000154 | All Organisms → cellular organisms → Bacteria | 14604 | Open in IMG/M |
| 3300018074|Ga0184640_10510683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300018075|Ga0184632_10158618 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300018083|Ga0184628_10003207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 7801 | Open in IMG/M |
| 3300018422|Ga0190265_10357703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1548 | Open in IMG/M |
| 3300018433|Ga0066667_10814400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 795 | Open in IMG/M |
| 3300018466|Ga0190268_10233738 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300022563|Ga0212128_10072396 | Not Available | 2222 | Open in IMG/M |
| 3300025157|Ga0209399_10205230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 786 | Open in IMG/M |
| 3300025159|Ga0209619_10409257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 694 | Open in IMG/M |
| 3300025313|Ga0209431_10518249 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300025327|Ga0209751_10791197 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300025791|Ga0210115_1010395 | All Organisms → cellular organisms → Bacteria | 2211 | Open in IMG/M |
| 3300025792|Ga0210143_1001678 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5005 | Open in IMG/M |
| 3300025911|Ga0207654_10584151 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300025935|Ga0207709_10447980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 997 | Open in IMG/M |
| 3300026067|Ga0207678_10025973 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5111 | Open in IMG/M |
| 3300026547|Ga0209156_10072653 | All Organisms → cellular organisms → Bacteria | 1759 | Open in IMG/M |
| 3300026550|Ga0209474_10712326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300027163|Ga0209878_1032381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 679 | Open in IMG/M |
| 3300027462|Ga0210000_1036317 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300027511|Ga0209843_1075466 | Not Available | 579 | Open in IMG/M |
| 3300027513|Ga0208685_1012821 | All Organisms → cellular organisms → Bacteria | 1996 | Open in IMG/M |
| 3300027775|Ga0209177_10077941 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300027819|Ga0209514_10088374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1878 | Open in IMG/M |
| 3300027840|Ga0209683_10509378 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300027907|Ga0207428_10669512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 744 | Open in IMG/M |
| 3300028381|Ga0268264_10444370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum → Herbaspirillum lusitanum | 1255 | Open in IMG/M |
| 3300028784|Ga0307282_10487332 | Not Available | 599 | Open in IMG/M |
| 3300030006|Ga0299907_11260846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300031229|Ga0299913_10510387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1188 | Open in IMG/M |
| 3300031547|Ga0310887_10657223 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300031716|Ga0310813_11521807 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 623 | Open in IMG/M |
| 3300031719|Ga0306917_10279456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1286 | Open in IMG/M |
| 3300031720|Ga0307469_10998944 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 781 | Open in IMG/M |
| 3300031740|Ga0307468_100556755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Sinimarinibacterium → unclassified Sinimarinibacterium → Sinimarinibacterium sp. CAU 1509 | 925 | Open in IMG/M |
| 3300031824|Ga0307413_10034957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2878 | Open in IMG/M |
| 3300031824|Ga0307413_10480326 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300031854|Ga0310904_11284256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 530 | Open in IMG/M |
| 3300031949|Ga0214473_11273385 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300032001|Ga0306922_10534861 | Not Available | 1247 | Open in IMG/M |
| 3300032004|Ga0307414_11067162 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300032122|Ga0310895_10106498 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1151 | Open in IMG/M |
| 3300032132|Ga0315336_1302817 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300032157|Ga0315912_10286538 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
| 3300032892|Ga0335081_10712053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1216 | Open in IMG/M |
| 3300033417|Ga0214471_11002462 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 643 | Open in IMG/M |
| 3300034354|Ga0364943_0007469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3211 | Open in IMG/M |
| 3300034690|Ga0364923_0008342 | All Organisms → cellular organisms → Bacteria | 2228 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.11% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 6.94% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.17% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.47% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.47% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.47% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 2.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 2.08% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 2.08% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.08% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.08% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.39% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.39% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.39% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.39% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.39% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.39% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.39% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.39% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.39% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.39% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.69% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.69% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.69% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.69% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.69% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.69% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.69% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.69% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.69% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.69% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.69% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.69% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300002407 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 | Environmental | Open in IMG/M |
| 3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004009 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004012 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005888 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011417 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2 | Environmental | Open in IMG/M |
| 3300011440 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2 | Environmental | Open in IMG/M |
| 3300012038 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2 | Environmental | Open in IMG/M |
| 3300012175 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT399_2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012514 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510 | Environmental | Open in IMG/M |
| 3300012517 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610 | Environmental | Open in IMG/M |
| 3300012673 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT399_2 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014272 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
| 3300025157 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
| 3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025791 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025792 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027163 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027511 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027513 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027819 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032132 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - ASW #5 | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| 3300034690 | Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TC_1027305472 | 3300000559 | Soil | GVVGPLVMGLIFDLNGNYSTAIWGLIVISALMIPLSLAMASPAELAERIAGC* |
| C687J29651_100925003 | 3300002407 | Soil | SVAIWGLIVISALMIPMSLAMASPAELANRIGQQRISDKGS* |
| Ga0055471_101075203 | 3300003987 | Natural And Restored Wetlands | IAAGVIGPMVMGIIFDLNGSYSVAIWGLIVISALMVPLSLAMASPAELAKRIGRV* |
| Ga0055437_102096141 | 3300004009 | Natural And Restored Wetlands | GVIGPLVMGMIFDLNGNYSVAIWGLIVTSALMMPVSLAMASPAELAKRIGQRID* |
| Ga0055464_100932752 | 3300004012 | Natural And Restored Wetlands | DINGNYSAAIWGLIVVGALMVPFSLAMSAPAELANRIERQ* |
| Ga0062593_1008340001 | 3300004114 | Soil | VVGPMVMGMIFDLHGNYSAAIWGLIVISAFMIPLSLAMASPAALAIRIEQQPISEKNH* |
| Ga0062383_102210322 | 3300004778 | Wetland Sediment | VGAGVVGPLVMGIIFDINGNYSVAIWGLIVISALMVPMSLAMASPAELARRLGQLRTGDQGT* |
| Ga0066674_101291173 | 3300005166 | Soil | VMGLIFDLHGNYSAAIWGLIVISALMVPLSLAMASPAELAKRIGKG* |
| Ga0066683_101090424 | 3300005172 | Soil | GVIGPLVMGLIFDLHGNYSAAIWGLIVISALMVPLSLAMASPAELAKRIGKG* |
| Ga0066688_105674021 | 3300005178 | Soil | QGGSIAAGVIGPMVMGLIFDLHGNYSAAIWGLIVISALMVPLSLAMASPAELAKRIGKG* |
| Ga0066675_110671481 | 3300005187 | Soil | IFDLHGNYSAAIWGLIVISALMVPLSLAMASPAELAKRIGQQRIRE* |
| Ga0065704_103556832 | 3300005289 | Switchgrass Rhizosphere | AGVVGPMVMGMIFDLHGNYSAAIWGLIVISAVMVPLSLAMASPAELIKRIEQQRIS* |
| Ga0065705_102182723 | 3300005294 | Switchgrass Rhizosphere | GLIFDLHGNYSAAIWGLIAISAFMIPLSLAMASPTELAKRIERQPISDKGS* |
| Ga0070658_110233233 | 3300005327 | Corn Rhizosphere | DLHGNYSAAIWGLIVISAVMVPLSLAMASPAELTKRIEQQRIS* |
| Ga0070669_1000366224 | 3300005353 | Switchgrass Rhizosphere | VVGPMVMGMIFDLHGNYSAAIWGLIVISAVMVPLSLAMASPAELIKRIEQQRIS* |
| Ga0070671_1009819441 | 3300005355 | Switchgrass Rhizosphere | MVMGMIFDLHGNYSAAIWGLIVISAVMVPLSLAMASPAELTKRIEQERIS* |
| Ga0070705_1012396521 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | FDLHGNYSAAIWGLIVISAAMVPLSLAMASPAELTKRIEQQRIS* |
| Ga0070678_1017752222 | 3300005456 | Miscanthus Rhizosphere | MIFDLHGNYSAAIWGLIVISAFMIPLSLAMASPAALAMRLAQQRISEKNL* |
| Ga0070662_1017084431 | 3300005457 | Corn Rhizosphere | IFDLHGNYSAAIWGLIVISAVMVPLSLAMASPAELTKRIEQQRIS* |
| Ga0066698_101143601 | 3300005558 | Soil | VMGLIFDLHGNYSAAIWGLIVISALMVPLSLAMASPAELANRIERQQIGDKGG* |
| Ga0074479_109916541 | 3300005829 | Sediment (Intertidal) | GIWGLIIISALMMPISLAMAAPAELAKRLGQEPI* |
| Ga0068863_1018313521 | 3300005841 | Switchgrass Rhizosphere | GMIFDLHGNYSAAIWGLIVISAFMIPLSLAMASPAALAIRIEQQPISEKNH* |
| Ga0075289_10013341 | 3300005888 | Rice Paddy Soil | PMVMGIIFDLNGSYSVAIWGLIVISALMVPLSLAMASPAELAKRIGRV* |
| Ga0075432_100569181 | 3300006058 | Populus Rhizosphere | GMIFDLNGNYSVAIWGLIVISALMVPLSLAMASPAALAKRIGAAANQRYE* |
| Ga0079037_1022574651 | 3300006224 | Freshwater Wetlands | IGPFVMGIIFDLDGNYSTAIWGLIVISALMMPLSLAMASPAELAKRIGQQPIGNTGS* |
| Ga0079222_101785061 | 3300006755 | Agricultural Soil | GNYSAAIWGLIVVGALMVPLSLAMTSPAELANRVAR* |
| Ga0066658_106410712 | 3300006794 | Soil | GLIFDLHGNYSAAIWGLIVISALMVPLSLAMASPAELAKRIGQQRIRE* |
| Ga0066659_100811664 | 3300006797 | Soil | MIFDLNGNYSAAIWGLIIISAFMMPLSLAMSSPAELAKRIGQQRIGDK |
| Ga0075421_1009428302 | 3300006845 | Populus Rhizosphere | LHGNYSAAIWGLIAISAFMVPLSLAMASPAELAKRIGQQPIN* |
| Ga0075421_1012583182 | 3300006845 | Populus Rhizosphere | NGNYSVGIWGLIVISAFMMPVSLAMASPADLAKRIGKQRIDEQV* |
| Ga0075430_1001172101 | 3300006846 | Populus Rhizosphere | LIVISALMVPLSLAMASPAALAKRIGAAANQRYE* |
| Ga0075431_1012001281 | 3300006847 | Populus Rhizosphere | LNGNYSVAIWGLIVISALMVPLSLAMASPAALAKRIGAAANQRYE* |
| Ga0075433_101424091 | 3300006852 | Populus Rhizosphere | VVGPMVMGMIFDLHGNYSAAIWGLIVTSAFMIPLSLAMASPAELALRIEQQMNKVGD* |
| Ga0075426_104195711 | 3300006903 | Populus Rhizosphere | AGVVGPMVMGMIFDLHGNYSAAIWGLIVTSAFMIPLSLAMASPAELALRIEQQMNKVGD* |
| Ga0075424_1009697731 | 3300006904 | Populus Rhizosphere | IFDLHGNYSAAIWGLIAISALMVPLSLAMASPTELAKRIERQ* |
| Ga0075424_1011630194 | 3300006904 | Populus Rhizosphere | AGVIGPFVMGMIFDLHGNYSAAIWGLIVISALMVPLSLAMASPAALAKRIGAARRL* |
| Ga0075436_1000638454 | 3300006914 | Populus Rhizosphere | GNYSAAIWGLIVISAFMIPLSLAMASPAALAMRIEQQRISEKNL* |
| Ga0075418_128572532 | 3300009100 | Populus Rhizosphere | YSAAIWGLIAISAFMVPLSLAMASPAELAKRIGQQPIN* |
| Ga0114129_106893371 | 3300009147 | Populus Rhizosphere | MGLIFDLHGNYSAAIWGLIVISALMVPLSLAMASPAELANRIEHQASEQPC* |
| Ga0105243_104200601 | 3300009148 | Miscanthus Rhizosphere | VVGPMVMGMIFDLHGNYSAAIWGLIVISAFMIPLSLAMASPAALAMRIEQQRISEKNL* |
| Ga0111538_107754262 | 3300009156 | Populus Rhizosphere | MGMIFDLNGNYSVAIWGLIVISGLMVPLSLAMASPAALAKRIGAAVDQR* |
| Ga0075423_109182111 | 3300009162 | Populus Rhizosphere | IGPFVMGMIFDLNGNYSVAIWGLIVISALMVPLSLAMASPAALAKRIGAAANQRYE* |
| Ga0075423_123026092 | 3300009162 | Populus Rhizosphere | GVVGPMVMGMIFDLHGNYSAAIWGLIVISAFMIPLSLAMASPAALAMRIEQQRISEKNL* |
| Ga0105104_101189781 | 3300009168 | Freshwater Sediment | LNGNYSVAIWGIIVISALMVPLSLAMASPAALAKRIGSAAGNS* |
| Ga0114945_100919614 | 3300009444 | Thermal Springs | GPLVMGIIFDLNGNYSVAIWGLIVISALMVPLSLAMASPAELAKRIGQRRTSDRGS* |
| Ga0105249_126597561 | 3300009553 | Switchgrass Rhizosphere | NYSAAIWGLIVTSALMVPLSLAMASPTELATRIEQQQRI* |
| Ga0105347_10231462 | 3300009609 | Soil | VMGIIFDLDGNYSTAIWGLIVISALMMPLSLAMASPAELANRIGQQPIGDTGS* |
| Ga0105347_11346141 | 3300009609 | Soil | IWGLIVISAFMIPLSLAMASPAELAKRIGQQRIN* |
| Ga0105347_11360522 | 3300009609 | Soil | VMGIIFDLDGNYSTAIWGLIVISALMMPLSLAMASPAELAKRIGQQPIGDTGS* |
| Ga0105340_14518032 | 3300009610 | Soil | VMGLIFDLHGNYSAAIWGLIAISAFMVPLSLAMASPAELAKRIGQQPIN* |
| Ga0126308_106772802 | 3300010040 | Serpentine Soil | PFIMGLIFDLNGNYSVAIWGLIVLGALMVPLSLAMGSPAELAKRIGQQPTS* |
| Ga0126380_106825831 | 3300010043 | Tropical Forest Soil | MGVIFDMKGNYSIGIWGLIIISALMVPLSLAMASPAELARRIEQRQ* |
| Ga0126382_117743932 | 3300010047 | Tropical Forest Soil | VMGVIFDMKGNYSIGIWGLIIISALMVPLSLAMASPAELARRVEQRQ* |
| Ga0134111_100418462 | 3300010329 | Grasslands Soil | LVMGIIFDLDGNYSVAIWALIVISALMVPLSLAMASPAELAKRIGQQRIRE* |
| Ga0134071_100875021 | 3300010336 | Grasslands Soil | YSAAIWGLIVIGALMMPLSLAMASPAELAKRIGQQRIRE* |
| Ga0134071_103826281 | 3300010336 | Grasslands Soil | IWGLIVISALMVPLSLAMASPAELANRIERQQIGDKGG* |
| Ga0126377_101211173 | 3300010362 | Tropical Forest Soil | YSAAIWGLIVISAFMVPLSLAMASPAELAKRIEQHHLA* |
| Ga0126377_133938751 | 3300010362 | Tropical Forest Soil | PIAAGVIGPLVMGMIFDLNGNYSAAIWGLIVISAFMVPLSLAMASPAELAERIEQHHLA* |
| Ga0126377_134110042 | 3300010362 | Tropical Forest Soil | GPLVMGVIFDMKGNYSIAIWGLIIISALMVPLSLAMASPAELARRIEQRQ* |
| Ga0126381_1046454281 | 3300010376 | Tropical Forest Soil | LQGAPVAAGVIGPLVMGVIFDMKGNYSIAIWGLIIISALMVPLSLAMASPAELARRIEQRQ* |
| Ga0136847_119025804 | 3300010391 | Freshwater Sediment | LIVISAFMMPLSLAMASPAELAKRIGQQRINDKDS* |
| Ga0134126_107626411 | 3300010396 | Terrestrial Soil | HGNYSAAIWGLIVISAVMVPLSLAMASPAELTKRIEQQRIS* |
| Ga0137326_10424832 | 3300011417 | Soil | APIAAGVIGPLVMGIIFDLNGNYSVAIWGLIVISALMVPLSLAMASPAALAKRIGAAAD* |
| Ga0137433_11000261 | 3300011440 | Soil | SVAICGLIVISALMVPLSLAMASPAALAKRIGAAAD* |
| Ga0137431_10176191 | 3300012038 | Soil | GVIGPLVMGIIFDLNGNYSVAICGLIVISALMVPLSLAMASPAALAKRIGAAAD* |
| Ga0137321_10936832 | 3300012175 | Soil | MGIIFDLNGNYSTAIWGLIVVSALMIPMSLAMASPAELAKRIEQQRT* |
| Ga0137364_104737241 | 3300012198 | Vadose Zone Soil | LIVISALMVPLSLAMASPAELANRIERQQIGDKGS* |
| Ga0137382_105660511 | 3300012200 | Vadose Zone Soil | LHGNYSAAIWGLIAISTLMVPLSLAMASPAELAKRIAGC* |
| Ga0137387_105522731 | 3300012349 | Vadose Zone Soil | IFDLHGNYSAAIWGLIVISALMVPLSLAMASPAELANRIERQQIGDKGG* |
| Ga0137372_100881571 | 3300012350 | Vadose Zone Soil | NGNYSVAIWGLIVISALMVPLSLAMASPTELAKRIGAAANQR* |
| Ga0157330_10679591 | 3300012514 | Soil | GPLVMGLIFDLHGNYSAAIWGLIAISALMVPLSLVMASPTELAKRIERQ* |
| Ga0157354_10140261 | 3300012517 | Unplanted Soil | PLVMGLIFDLHGNYSAAIWGLIAISAFMVPLSLAMASPAELAKRIERQ* |
| Ga0137339_10154842 | 3300012673 | Soil | AGIWGLIVISAFMMPLSLAMASPAELAKRIGQQRISDKGS* |
| Ga0137394_102102971 | 3300012922 | Vadose Zone Soil | HGNYSAAIWGLIVISALMVPLSLAMASPAVLAKRIGAARSL* |
| Ga0137394_110010752 | 3300012922 | Vadose Zone Soil | GLIFDLHGNYSAAIWGLIAISDLMVPLSLAMASPSELDKRIGQQPISNDKGS* |
| Ga0137404_116389181 | 3300012929 | Vadose Zone Soil | MIGPMVMGIIFDLNGSYSVAIWGLIVISALMVPLSLAMASPAALAKRIGAAVDQR* |
| Ga0137407_122168431 | 3300012930 | Vadose Zone Soil | LVMGLIFDLHGNYSAAIWGLIAISAFMVPLSLAMASPAELAKRIAGC* |
| Ga0126375_117191951 | 3300012948 | Tropical Forest Soil | VIFDMKGNYSIGIWGLIIISALMVPLSLAMASPAELARRIEQRQ* |
| Ga0153916_103775853 | 3300012964 | Freshwater Wetlands | GNYSAAIWGLIVVGALMVPLSLAMSSPAELANRIERQRF* |
| Ga0134110_106291391 | 3300012975 | Grasslands Soil | NGNYSTAIWGLIVISALMVPLSLAMASPAELAKRIGKG* |
| Ga0134076_105598181 | 3300012976 | Grasslands Soil | AIWGFIVISALMVPLSLAMASPAELANRIERQQIGDKGS* |
| Ga0075327_10285472 | 3300014272 | Natural And Restored Wetlands | IIFDLNGNYSVAIWGLIVISALMVPLSLAMASPAALAKRMGAAKDQG* |
| Ga0075352_12657791 | 3300014324 | Natural And Restored Wetlands | MIFDLNGNYSVAIWGLIVTSAMMMPVSLAMASPAELAKRIGQRID* |
| Ga0157379_105830952 | 3300014968 | Switchgrass Rhizosphere | PMVMGMIFDLHGNYSAAIWGLIVISAVMVPLSLAMASPAELTKRIEQQRIS* |
| Ga0137403_102187972 | 3300015264 | Vadose Zone Soil | QGGPIAAGVIGPFVMGMIFDLDGYSVAIWGLIVISALMVPLSLAMASPAALAQRIGAAASQRYE* |
| Ga0134072_103794991 | 3300015357 | Grasslands Soil | DLNGNYSTAIWGLIVISALMVPLSLAMASPAELAKRIGQQRIRE* |
| Ga0132256_1010453562 | 3300015372 | Arabidopsis Rhizosphere | VIFDLNGNYSVAIWGLVVIGALMVPLSLAMASPAELTNRIELQRIAAE* |
| Ga0132256_1015274421 | 3300015372 | Arabidopsis Rhizosphere | IWGLIVISAFMIPLSLAMASPAALAIRIEQQPEE* |
| Ga0132257_1003149651 | 3300015373 | Arabidopsis Rhizosphere | SAAIWGLIVISAFMIPLSLAMASPAALAMRIEQQRISEKNL* |
| Ga0132255_1017631412 | 3300015374 | Arabidopsis Rhizosphere | GNYSAAIWGLIVISAFMIPLSLAMASPAALAMRIEQQPISEKNY* |
| Ga0132255_1045286752 | 3300015374 | Arabidopsis Rhizosphere | AAIWGLIVISAFMIPLSLAMASPAALAIRIEQQPEE* |
| Ga0132255_1052987542 | 3300015374 | Arabidopsis Rhizosphere | AAIWGLIVISAFMIPLSLAMASPAALAIRIEQQPISEKKNH* |
| Ga0132255_1061946512 | 3300015374 | Arabidopsis Rhizosphere | APVAAGGIGPLVMGIIFDLRGNYSVAIWGLIIISALMVPLSLAMASPAALAKRIGAAASQR* |
| Ga0182041_103587841 | 3300016294 | Soil | MGMIFDLNGNYSAAIWGLIVISAVMMPLSLAMAPPGELAKRIGQQRISDKSSWPS |
| Ga0184608_101122322 | 3300018028 | Groundwater Sediment | IIFDLNGNYSTAIWGLIVISALMVPLSLAMASPAELAKRIGQQRNDDKGS |
| Ga0184635_1000015424 | 3300018072 | Groundwater Sediment | IFDLNGNYSVAIWGLIVISALMVPLSLAMASPAALAKRIGAAADQR |
| Ga0184640_105106832 | 3300018074 | Groundwater Sediment | VMGLIFDLNGNYSVAIWGLIVISAFMIPLSLAMASPAELARRIGQQRTSDRGS |
| Ga0184632_101586181 | 3300018075 | Groundwater Sediment | VAAGVIGPFVMGMIFDLHGNYSAAIWGLIVISALMVPLSLAMASPAALAKRIGAAVVEHAAR |
| Ga0184628_100032071 | 3300018083 | Groundwater Sediment | VMGIIFDLNGNYSAAIWGLAIISALMMPVSLAMASPAELAKRIGQ |
| Ga0190265_103577031 | 3300018422 | Soil | AAGVIGPFVMGVIFDLDGNYSAAIWGLVVISALMMPVSLAMASPAELAKRIGH |
| Ga0066667_108144001 | 3300018433 | Grasslands Soil | MGLIFDLHGNYSAAIWGLIVIGALMMPLSLAMASPAELAKRIGQQRIRE |
| Ga0190268_102337381 | 3300018466 | Soil | FDLHGNYSAAIWGLIAISAFMIPLSLAMASPAELAKRIERQPID |
| Ga0212128_100723961 | 3300022563 | Thermal Springs | VAAGVIGPLVMGIIFDLNGNYSVAIWGLIVISSLMVPLSLAMASPSELAKRIGQQQTSDKAS |
| Ga0209399_102052301 | 3300025157 | Thermal Springs | GPLVMGIIFDLNGNYSVAIWGLIVISALMVPLSLAMASPAELAKRIGQRRTSDRGS |
| Ga0209619_104092572 | 3300025159 | Soil | IAAGVIGPLVMGIIFDLNGNYSVGIWGLIVISALMVPLSLAMASPTELAKRIAQQPINDDDI |
| Ga0209431_105182491 | 3300025313 | Soil | PLVMGIIFDLNGNYSVAIWGLIVISALMIPMSLAMASPAELANRIGQQRISDKGS |
| Ga0209751_107911971 | 3300025327 | Soil | GGSIAAGVIGPLVMGIIFDLNGNYSAAIWGLIVISALMIPMSLAMASPAELANRIGQQRISDKGS |
| Ga0210115_10103955 | 3300025791 | Natural And Restored Wetlands | IAAGVIGPMVMGIIFDLNGSYSVAIWGLIVISALMVPLSLAMASPAELAKRIGRV |
| Ga0210143_10016781 | 3300025792 | Natural And Restored Wetlands | LIFDLNGNYSVAIWGLVVISALMVPVSVVMASPAELAKRVGQQRASNTKS |
| Ga0207654_105841511 | 3300025911 | Corn Rhizosphere | MIFDLHGNYSAAIWGLIVISAVMVPLSLAMASPAELTKRIEQQRIS |
| Ga0207709_104479801 | 3300025935 | Miscanthus Rhizosphere | GNYSAAIWGLIAISAFMVPLSLAMASPAELAKRIERQ |
| Ga0207678_100259736 | 3300026067 | Corn Rhizosphere | VGPMVMGMIFDLHGNYSAAIWGLIVISAVMVPLSLAMASPAELTKRIEQERIS |
| Ga0209156_100726533 | 3300026547 | Soil | GVIGPLVMGLIFDLHGNYSTAIWGLIVISAFMIPLSLAMASPAELAKRIGKDFL |
| Ga0209474_107123261 | 3300026550 | Soil | AGVIGPMVMGLIFDLHGNYSAAIWGLIVISALMVPLSLAMASPAELAKRIGQQRIRE |
| Ga0209878_10323811 | 3300027163 | Groundwater Sand | GVIGPLVMGIIFDLNGNYSVAIWGLIVISALMVPLSLAMATPAALAKRIGAAADQR |
| Ga0210000_10363172 | 3300027462 | Arabidopsis Thaliana Rhizosphere | MGIIFDLNGSYSVAIWGLIVISALMVPLSLAMASPAELAKRIGRL |
| Ga0209843_10754661 | 3300027511 | Groundwater Sand | VAIWGLIVISALMVPLSLAMATPAALAKRIGAAADQR |
| Ga0208685_10128212 | 3300027513 | Soil | WGLIVISALMMPLSLAMASPAELANRIGQQPIGDTGS |
| Ga0209177_100779411 | 3300027775 | Agricultural Soil | LHGNYSAAIWGLIVISAFMIPLSLAMASPAALAIRIEQQREE |
| Ga0209514_100883741 | 3300027819 | Groundwater | DLNGNYSAAIWGLIVISALMIPMSLAMASPAELAKRIGQQRISDKGS |
| Ga0209683_105093781 | 3300027840 | Wetland Sediment | GVGGPLVMGIIFDINGNYSVAIWGLIVISALMVPMSLAMASPAELARRLGQLRTGDQGT |
| Ga0207428_106695121 | 3300027907 | Populus Rhizosphere | GMIFDLNGNYSVAIWGLIVISALMVPLSLAMASPAALAKRIGAAANQRYE |
| Ga0268264_104443702 | 3300028381 | Switchgrass Rhizosphere | GNYSAAIWGLIVISAVMVPLSLAMASPAELTKRIEQQRIS |
| Ga0307282_104873322 | 3300028784 | Soil | GLIAISALMVPLSLAMASPSELDKRIGQQPISDKGS |
| Ga0299907_112608461 | 3300030006 | Soil | DLNGHYSVAIWGLIVLSALMVPLSLAMASPADLAKRIGQRRTG |
| Ga0299913_105103871 | 3300031229 | Soil | FDLNGNYSVGIWGLIVISALMVPLSLAMASPADLAKRIGRAPDQR |
| Ga0310887_106572232 | 3300031547 | Soil | LQGGPIAAGVIGPLVMGLIFDLNGNYSTAIWGLIVISALMIPLSLAMGSPADLAKRIGASDQR |
| Ga0310813_115218071 | 3300031716 | Soil | YSVAIWGLVVIGALMVPLSLAMASPAELTNRIELQRIAAE |
| Ga0306917_102794561 | 3300031719 | Soil | FVMGMIFDLNGNYSAAIWGLIVISALMMPLSLAMASPAELAKRIGQQRISDKGS |
| Ga0307469_109989441 | 3300031720 | Hardwood Forest Soil | NYSVAIWGLIAISALVMPLSLAMASPAELAKRIGQQRINDKGS |
| Ga0307468_1005567551 | 3300031740 | Hardwood Forest Soil | AGVVGPLVMGLIFDLHGNYSAAIWGLIAISALMVPLSLAMASPAELAKRIERQ |
| Ga0307413_100349573 | 3300031824 | Rhizosphere | LNGNYSTAIWGLIVISALMIPLSLAMGAPADLAKRIGATDQR |
| Ga0307413_104803261 | 3300031824 | Rhizosphere | NGNYSTAIWGLIVISALMIPMSLAMGSPADLARRIRAADSDRRS |
| Ga0310904_112842561 | 3300031854 | Soil | FDLHGNYSAAIWGLIVTSALMVPLSLAMASPTELATRIEQQRI |
| Ga0214473_112733851 | 3300031949 | Soil | SVAIWGLIVISALMVPLSLAMASPAELAKRIGAAAEQR |
| Ga0306922_105348611 | 3300032001 | Soil | MGLIFDLHGNYSAAIWGLIVISALMVPLSLAMASPAELAKRIEQPAGPNKDS |
| Ga0307414_110671623 | 3300032004 | Rhizosphere | GNYSTAIWGLIVISALMIPMSLAMGSPADLAMRIRAADSDRRS |
| Ga0310895_101064981 | 3300032122 | Soil | LHGNYSVAIWGLIIISALMVPLSLAMASPAALAKRVGAAASQR |
| Ga0315336_13028172 | 3300032132 | Seawater | VMGIIFDLDGNYSVGIWGLMALSALMVPVSLAMASPADLAQRIESDRRSKATSLSVS |
| Ga0315912_102865381 | 3300032157 | Soil | DLHGNYSAAIWGLIVTSALMVPLSLAMASPTELATRIEQQRI |
| Ga0335081_107120532 | 3300032892 | Soil | IFDLNGNYSAAIWGLVAIGALMVPLSLAMASPAELTTRIER |
| Ga0214471_110024621 | 3300033417 | Soil | AGVIGPLVMGIIFDLNGNYSVAIWGLIVISALMVPLSLAMASPAALAKRIGAAAEQR |
| Ga0364943_0007469_3029_3196 | 3300034354 | Sediment | MIGPLVMGIIFDLNGNYSVAIWGLIVISALMVPLSLAMASPAALAKRIGAAADQR |
| Ga0364923_0008342_2081_2224 | 3300034690 | Sediment | MGIIFDLNGNYSVAIWGLIVISALMVPLSLAMASPAALATRIGAAAD |
| ⦗Top⦘ |