


| Basic Information | |
|---|---|
| Family ID | F051217 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 144 |
| Average Sequence Length | 45 residues |
| Representative Sequence | VRASYFPNKAALPASTLLQISRLANPAYLVEVEAIAILPPKA |
| Number of Associated Samples | 120 |
| Number of Associated Scaffolds | 143 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.56 % |
| % of genes near scaffold ends (potentially truncated) | 84.03 % |
| % of genes from short scaffolds (< 2000 bps) | 95.14 % |
| Associated GOLD sequencing projects | 113 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.24 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.750 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (16.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.083 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.250 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.29% β-sheet: 0.00% Coil/Unstructured: 95.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 143 Family Scaffolds |
|---|---|---|
| PF01042 | Ribonuc_L-PSP | 6.99 |
| PF01425 | Amidase | 2.10 |
| PF00903 | Glyoxalase | 1.40 |
| PF06707 | DUF1194 | 1.40 |
| PF03069 | FmdA_AmdA | 1.40 |
| PF01799 | Fer2_2 | 1.40 |
| PF07298 | NnrU | 1.40 |
| PF08840 | BAAT_C | 1.40 |
| PF01432 | Peptidase_M3 | 1.40 |
| PF14087 | DUF4267 | 1.40 |
| PF01804 | Penicil_amidase | 1.40 |
| PF12680 | SnoaL_2 | 1.40 |
| PF01124 | MAPEG | 0.70 |
| PF17172 | GST_N_4 | 0.70 |
| PF00497 | SBP_bac_3 | 0.70 |
| PF04392 | ABC_sub_bind | 0.70 |
| PF10691 | DUF2497 | 0.70 |
| PF01738 | DLH | 0.70 |
| PF00805 | Pentapeptide | 0.70 |
| PF09084 | NMT1 | 0.70 |
| PF03544 | TonB_C | 0.70 |
| PF01609 | DDE_Tnp_1 | 0.70 |
| PF02371 | Transposase_20 | 0.70 |
| PF11533 | DUF3225 | 0.70 |
| PF01717 | Meth_synt_2 | 0.70 |
| PF14821 | Thr_synth_N | 0.70 |
| PF00248 | Aldo_ket_red | 0.70 |
| PF07731 | Cu-oxidase_2 | 0.70 |
| PF05638 | T6SS_HCP | 0.70 |
| PF07702 | UTRA | 0.70 |
| PF11604 | CusF_Ec | 0.70 |
| PF13683 | rve_3 | 0.70 |
| PF00690 | Cation_ATPase_N | 0.70 |
| PF00753 | Lactamase_B | 0.70 |
| PF07883 | Cupin_2 | 0.70 |
| PF07690 | MFS_1 | 0.70 |
| PF10009 | DUF2252 | 0.70 |
| PF04545 | Sigma70_r4 | 0.70 |
| PF01527 | HTH_Tnp_1 | 0.70 |
| PF00326 | Peptidase_S9 | 0.70 |
| PF13924 | Lipocalin_5 | 0.70 |
| PF01935 | DUF87 | 0.70 |
| PF04002 | RadC | 0.70 |
| COG ID | Name | Functional Category | % Frequency in 143 Family Scaffolds |
|---|---|---|---|
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 6.99 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 2.10 |
| COG0339 | Zn-dependent oligopeptidase, M3 family | Posttranslational modification, protein turnover, chaperones [O] | 1.40 |
| COG1164 | Oligoendopeptidase F | Amino acid transport and metabolism [E] | 1.40 |
| COG2366 | Acyl-homoserine lactone (AHL) acylase PvdQ | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.40 |
| COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 1.40 |
| COG4094 | Uncharacterized membrane protein | Function unknown [S] | 1.40 |
| COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 0.70 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.70 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.70 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.70 |
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.70 |
| COG2003 | DNA repair protein RadC, contains a helix-hairpin-helix DNA-binding motif | Replication, recombination and repair [L] | 0.70 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.70 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.70 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.70 |
| COG3157 | Type VI protein secretion system component Hcp (secreted cytotoxin) | Intracellular trafficking, secretion, and vesicular transport [U] | 0.70 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.70 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.70 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.70 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.70 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.70 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.70 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.70 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.75 % |
| Unclassified | root | N/A | 31.25 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001431|F14TB_100946743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1478 | Open in IMG/M |
| 3300001686|C688J18823_10853358 | Not Available | 578 | Open in IMG/M |
| 3300004480|Ga0062592_101898799 | Not Available | 585 | Open in IMG/M |
| 3300004633|Ga0066395_10469962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Cp5.3 | 720 | Open in IMG/M |
| 3300005332|Ga0066388_101577154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1154 | Open in IMG/M |
| 3300005332|Ga0066388_103224756 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 833 | Open in IMG/M |
| 3300005332|Ga0066388_107621975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300005332|Ga0066388_107922523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 531 | Open in IMG/M |
| 3300005364|Ga0070673_100617759 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 990 | Open in IMG/M |
| 3300005436|Ga0070713_100657242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 999 | Open in IMG/M |
| 3300005447|Ga0066689_10557724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 724 | Open in IMG/M |
| 3300005576|Ga0066708_10543135 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 749 | Open in IMG/M |
| 3300005591|Ga0070761_10928543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 551 | Open in IMG/M |
| 3300005719|Ga0068861_101707132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 623 | Open in IMG/M |
| 3300005764|Ga0066903_103846464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 806 | Open in IMG/M |
| 3300005764|Ga0066903_107782556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 551 | Open in IMG/M |
| 3300006046|Ga0066652_100695645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Cp5.3 | 967 | Open in IMG/M |
| 3300006237|Ga0097621_101748392 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300006800|Ga0066660_10407172 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300006853|Ga0075420_101527136 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300006893|Ga0073928_10740970 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300006904|Ga0075424_102881905 | Not Available | 500 | Open in IMG/M |
| 3300006953|Ga0074063_12938049 | Not Available | 844 | Open in IMG/M |
| 3300007076|Ga0075435_101809671 | Not Available | 536 | Open in IMG/M |
| 3300009090|Ga0099827_10015929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 5069 | Open in IMG/M |
| 3300009090|Ga0099827_11857400 | Not Available | 525 | Open in IMG/M |
| 3300009100|Ga0075418_10140206 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2572 | Open in IMG/M |
| 3300009100|Ga0075418_12332796 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300009143|Ga0099792_10242219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1046 | Open in IMG/M |
| 3300009143|Ga0099792_10420564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 822 | Open in IMG/M |
| 3300009553|Ga0105249_12190069 | Not Available | 626 | Open in IMG/M |
| 3300009789|Ga0126307_10440436 | Not Available | 1051 | Open in IMG/M |
| 3300009792|Ga0126374_11248141 | Not Available | 598 | Open in IMG/M |
| 3300009792|Ga0126374_11491857 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300009840|Ga0126313_10820345 | Not Available | 757 | Open in IMG/M |
| 3300010037|Ga0126304_11203921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300010041|Ga0126312_10188191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1441 | Open in IMG/M |
| 3300010043|Ga0126380_11852119 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300010046|Ga0126384_10902310 | Not Available | 798 | Open in IMG/M |
| 3300010046|Ga0126384_11549124 | Not Available | 622 | Open in IMG/M |
| 3300010358|Ga0126370_10727806 | Not Available | 875 | Open in IMG/M |
| 3300010358|Ga0126370_11614988 | Not Available | 621 | Open in IMG/M |
| 3300010358|Ga0126370_12379231 | Not Available | 526 | Open in IMG/M |
| 3300010359|Ga0126376_10220790 | Not Available | 1588 | Open in IMG/M |
| 3300010359|Ga0126376_12693469 | Not Available | 546 | Open in IMG/M |
| 3300010359|Ga0126376_12855008 | Not Available | 533 | Open in IMG/M |
| 3300010360|Ga0126372_11876433 | Not Available | 644 | Open in IMG/M |
| 3300010361|Ga0126378_11054207 | Not Available | 915 | Open in IMG/M |
| 3300010361|Ga0126378_11959449 | Not Available | 667 | Open in IMG/M |
| 3300010362|Ga0126377_11771508 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300010362|Ga0126377_13536537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300010366|Ga0126379_13025706 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300010366|Ga0126379_13672082 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300010376|Ga0126381_104222766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 557 | Open in IMG/M |
| 3300010398|Ga0126383_11744316 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300010398|Ga0126383_13657340 | Not Available | 502 | Open in IMG/M |
| 3300010399|Ga0134127_12077171 | Not Available | 647 | Open in IMG/M |
| 3300010400|Ga0134122_12823428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 539 | Open in IMG/M |
| 3300011269|Ga0137392_10409557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. WSM3873 | 1126 | Open in IMG/M |
| 3300011332|Ga0126317_10865713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 663 | Open in IMG/M |
| 3300011423|Ga0137436_1059633 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 982 | Open in IMG/M |
| 3300012207|Ga0137381_11068787 | Not Available | 695 | Open in IMG/M |
| 3300012212|Ga0150985_114373562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 630 | Open in IMG/M |
| 3300012285|Ga0137370_10900468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300012359|Ga0137385_10339829 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
| 3300012360|Ga0137375_10220586 | Not Available | 1776 | Open in IMG/M |
| 3300012911|Ga0157301_10283433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 597 | Open in IMG/M |
| 3300012924|Ga0137413_10366814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1026 | Open in IMG/M |
| 3300012927|Ga0137416_11471038 | Not Available | 618 | Open in IMG/M |
| 3300012929|Ga0137404_11190428 | Not Available | 701 | Open in IMG/M |
| 3300012948|Ga0126375_11660177 | Not Available | 552 | Open in IMG/M |
| 3300012955|Ga0164298_11142086 | Not Available | 586 | Open in IMG/M |
| 3300012960|Ga0164301_10010237 | All Organisms → cellular organisms → Bacteria | 3751 | Open in IMG/M |
| 3300012961|Ga0164302_10362621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 973 | Open in IMG/M |
| 3300012971|Ga0126369_10678775 | Not Available | 1106 | Open in IMG/M |
| 3300012971|Ga0126369_12804593 | Not Available | 570 | Open in IMG/M |
| 3300012985|Ga0164308_10996150 | Not Available | 744 | Open in IMG/M |
| 3300014166|Ga0134079_10676995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300014501|Ga0182024_10320147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2040 | Open in IMG/M |
| 3300014969|Ga0157376_11132234 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300015054|Ga0137420_1391901 | All Organisms → cellular organisms → Bacteria | 5774 | Open in IMG/M |
| 3300015371|Ga0132258_11179186 | Not Available | 1936 | Open in IMG/M |
| 3300015371|Ga0132258_11750616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1567 | Open in IMG/M |
| 3300015372|Ga0132256_100678311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1146 | Open in IMG/M |
| 3300015374|Ga0132255_105153483 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300016294|Ga0182041_10777966 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 854 | Open in IMG/M |
| 3300016357|Ga0182032_11320368 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 623 | Open in IMG/M |
| 3300016371|Ga0182034_11608297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 570 | Open in IMG/M |
| 3300016387|Ga0182040_11572579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300017972|Ga0187781_10261335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1226 | Open in IMG/M |
| 3300017997|Ga0184610_1261130 | Not Available | 574 | Open in IMG/M |
| 3300018076|Ga0184609_10315293 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300018081|Ga0184625_10084048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1631 | Open in IMG/M |
| 3300018466|Ga0190268_11950654 | Not Available | 537 | Open in IMG/M |
| 3300020582|Ga0210395_11131454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 577 | Open in IMG/M |
| 3300021168|Ga0210406_11326749 | Not Available | 517 | Open in IMG/M |
| 3300021170|Ga0210400_10210373 | Not Available | 1583 | Open in IMG/M |
| 3300021171|Ga0210405_10056863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3091 | Open in IMG/M |
| 3300021180|Ga0210396_10313751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 1387 | Open in IMG/M |
| 3300021403|Ga0210397_10536593 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300022557|Ga0212123_10614939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 683 | Open in IMG/M |
| 3300025927|Ga0207687_11121206 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300025928|Ga0207700_10276600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1443 | Open in IMG/M |
| 3300025928|Ga0207700_11361520 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300025939|Ga0207665_11030406 | Not Available | 655 | Open in IMG/M |
| 3300025960|Ga0207651_11046510 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300026035|Ga0207703_11426167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 666 | Open in IMG/M |
| 3300026088|Ga0207641_12461062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300027654|Ga0209799_1024230 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1335 | Open in IMG/M |
| 3300027654|Ga0209799_1024230 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1335 | Open in IMG/M |
| 3300027824|Ga0209040_10115172 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1499 | Open in IMG/M |
| 3300027862|Ga0209701_10530519 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300027903|Ga0209488_10007799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → Bosea lathyri | 8005 | Open in IMG/M |
| 3300028718|Ga0307307_10180431 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 665 | Open in IMG/M |
| 3300028819|Ga0307296_10307789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae | 864 | Open in IMG/M |
| 3300028880|Ga0307300_10193926 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 656 | Open in IMG/M |
| 3300030617|Ga0311356_12022519 | Not Available | 509 | Open in IMG/M |
| 3300031538|Ga0310888_10756670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 599 | Open in IMG/M |
| 3300031726|Ga0302321_101430876 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300031731|Ga0307405_11390765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 613 | Open in IMG/M |
| 3300031740|Ga0307468_101575631 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300031744|Ga0306918_10802109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 735 | Open in IMG/M |
| 3300031744|Ga0306918_11340668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 550 | Open in IMG/M |
| 3300031770|Ga0318521_10276415 | Not Available | 985 | Open in IMG/M |
| 3300031771|Ga0318546_10721726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 701 | Open in IMG/M |
| 3300031780|Ga0318508_1247501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300031833|Ga0310917_11095472 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 532 | Open in IMG/M |
| 3300031879|Ga0306919_11320356 | Not Available | 546 | Open in IMG/M |
| 3300031890|Ga0306925_11361473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 702 | Open in IMG/M |
| 3300031910|Ga0306923_10291547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1865 | Open in IMG/M |
| 3300031912|Ga0306921_11323528 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300031954|Ga0306926_11513475 | Not Available | 774 | Open in IMG/M |
| 3300032003|Ga0310897_10030492 | Not Available | 1815 | Open in IMG/M |
| 3300032012|Ga0310902_10380653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 893 | Open in IMG/M |
| 3300032013|Ga0310906_10824019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 657 | Open in IMG/M |
| 3300032044|Ga0318558_10496192 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300032060|Ga0318505_10475886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 590 | Open in IMG/M |
| 3300032063|Ga0318504_10118047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1202 | Open in IMG/M |
| 3300032068|Ga0318553_10385765 | Not Available | 734 | Open in IMG/M |
| 3300032180|Ga0307471_102715487 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300032180|Ga0307471_103613669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 547 | Open in IMG/M |
| 3300032261|Ga0306920_100819606 | Not Available | 1365 | Open in IMG/M |
| 3300032261|Ga0306920_101927728 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300032828|Ga0335080_11333987 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 16.67% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.25% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.25% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.47% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.78% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.08% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.08% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.08% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.08% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.39% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.39% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.39% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.39% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.69% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.69% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.69% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.69% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.69% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.69% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.69% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.69% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.69% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011423 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2 | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TB_1009467431 | 3300001431 | Soil | NAAEYRTVRASYFPNRSALPASTLLQVPRLANPAYLLEVEGIAVLPPRA* |
| C688J18823_108533582 | 3300001686 | Soil | RASYFPNRSALPASTLLQVPRLANTAYLLEVEVIAVLPPRA* |
| Ga0062592_1018987992 | 3300004480 | Soil | LEANAAAYREVRAMYFKNKAALPGHTLLQISRLANPAYQIELEFIAILPPKA* |
| Ga0066395_104699621 | 3300004633 | Tropical Forest Soil | AEVYREVRASFFSNKSTLPASTLLQITRLANPSYLIEVDATAILPPRT* |
| Ga0066388_1015771541 | 3300005332 | Tropical Forest Soil | YREVRASFFPNKSALPASTLLQITRLANPSYLIEVDATAILPPRT* |
| Ga0066388_1032247562 | 3300005332 | Tropical Forest Soil | GSYFPNKAALPGHTLLQISRLANPAYQLEVEIIAILPPKA* |
| Ga0066388_1076219752 | 3300005332 | Tropical Forest Soil | AEFREVRASYFPNRSALPASTLLQVPRLASPAYLLEVEVIAVLPPRA* |
| Ga0066388_1079225232 | 3300005332 | Tropical Forest Soil | LLGSVGVGFEHVIKMTAYHTNLDANAAIYREVRGSYVPNTLLQILRLANPAYQLEVEIIAILPPKA* |
| Ga0070673_1006177591 | 3300005364 | Switchgrass Rhizosphere | QQDADAYREVRASFLPNKSALPASTLLQVVRLADPSYLIEVDAIAILPPAT* |
| Ga0070713_1006572423 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | AEFREVRNSYFPNKAGLPPSTVLQISRLANPNYLVEVDVIAAVPRL* |
| Ga0066689_105577241 | 3300005447 | Soil | EANGAEFREVRGSYFPNKAALPASTLLQISRLANAAYLVEVEVIAVIPRL* |
| Ga0066708_105431352 | 3300005576 | Soil | RASYFPNKAALPASTLLQISRLANPAYLLEVEAIAILPPKT* |
| Ga0070761_109285432 | 3300005591 | Soil | VRASFFANKATLPASTLLQITRLANPSYLIEVEAMAVLPPKA* |
| Ga0068861_1017071322 | 3300005719 | Switchgrass Rhizosphere | NKAALPASTLLQVSRLANPAYLVEIDVVAVLPPKA* |
| Ga0066903_1038464641 | 3300005764 | Tropical Forest Soil | NKSALPASTLLQITRLANPSYLIEVDATAILPPRA* |
| Ga0066903_1077825562 | 3300005764 | Tropical Forest Soil | SNKSALPASTLLQITRLANPSYLIEVDATAILPPRA* |
| Ga0066652_1006956451 | 3300006046 | Soil | VRASYFPNKAALPASTLLQVSRLANPAYLLEIDVIAVLPPKA* |
| Ga0097621_1017483922 | 3300006237 | Miscanthus Rhizosphere | NKSALPASTLLQVVRLADPAYRIEVDAVAILPPTA* |
| Ga0066660_104071721 | 3300006800 | Soil | TDIEQNADIYREVRASTFANKSTLPASTLVQVTRLADPSYLVEVDAIAILPPRA* |
| Ga0075420_1015271362 | 3300006853 | Populus Rhizosphere | REVRGSYFPNQAALPASTLLQISRLANPTYLVEVEVIAVIPPL* |
| Ga0073928_107409701 | 3300006893 | Iron-Sulfur Acid Spring | NKGALPASTLLQVTRLANPSYFIEVDATAILPPSA* |
| Ga0075424_1028819052 | 3300006904 | Populus Rhizosphere | RASYFPNRSALPASTLLQVPRLANAAYLLEVEVIAVLPPRAS* |
| Ga0074063_129380493 | 3300006953 | Soil | LDEHGAVYREVRASYFPNKAALPASTLLQISRLANPAYLLEVEVIAILPPRT* |
| Ga0075435_1018096711 | 3300007076 | Populus Rhizosphere | NRSALPASTLLQVPRLANTAYLLEVEVIAVLPPRA* |
| Ga0099827_100159291 | 3300009090 | Vadose Zone Soil | KAALPASTLVQVPRLANPAFLLEIEAIAILPPKG* |
| Ga0099827_118574002 | 3300009090 | Vadose Zone Soil | EVRASYFPNRSALPASTLLQVPRLANPAYLLEVEVIAVLPPRA* |
| Ga0075418_101402061 | 3300009100 | Populus Rhizosphere | SYLVDLERDGVVFREVRASYFPNKAALPASTLLQVSRLANPAYLVEIDVIAVLPPKG* |
| Ga0075418_123327961 | 3300009100 | Populus Rhizosphere | QNADVYREVRASFLSNKSALPASTLVQVTRLADPSYLIEVDAIAILPPRA* |
| Ga0099792_102422192 | 3300009143 | Vadose Zone Soil | LARSIEANADVFREVRASYFPNKAALPASTLLQISRLANSAYLLEVDAIAILPPRA* |
| Ga0099792_104205641 | 3300009143 | Vadose Zone Soil | MTAYHTNLDANAVIYREVRGCSFPNKAALPGHTLLQISRLANPAYQLEVEIIAILPPKA* |
| Ga0105249_121900691 | 3300009553 | Switchgrass Rhizosphere | EFRDVRALYFKKGTLPTATLLQVVRLANPAYLLEVEAIAVLPPKG* |
| Ga0126307_104404361 | 3300009789 | Serpentine Soil | REVRALYFPNKSALPAATLVQVPRLANTAYLLEVEAIAVLPPKA* |
| Ga0126374_112481411 | 3300009792 | Tropical Forest Soil | EVRGSYFPNKAALPGHTLLQISRLANPAYQLEVEIIAILPPRA* |
| Ga0126374_114918571 | 3300009792 | Tropical Forest Soil | YHTNLDANAAIYREVRGSYFPNKAALPGHTLLQISRLANPAYQLEVEIIAILPPKA* |
| Ga0126313_108203451 | 3300009840 | Serpentine Soil | FREVRALYFTNKSALPAATLVQVPRLANAAYLLEVEAIAVLPPKA* |
| Ga0126304_112039211 | 3300010037 | Serpentine Soil | TNLEADGAVFREIRASYFPNKAALPASTLLQVPRLANPAYLVEIDVIAVLPPKA* |
| Ga0126312_101881911 | 3300010041 | Serpentine Soil | EFREVRALYFTNKSALPAATLVQVPRLANAAYLLEVEAIAVLPPKA* |
| Ga0126380_118521192 | 3300010043 | Tropical Forest Soil | MPKVRQRRHLFREVRGSSFPNKAALPGHTLLQISRLANPAYQLEVEIIAILPPRA* |
| Ga0126384_109023101 | 3300010046 | Tropical Forest Soil | LDANAAIYREVRGSYFPNKAALPGHTLLQISRLANPAYQLEVEIIAILPSKA* |
| Ga0126384_115491242 | 3300010046 | Tropical Forest Soil | VRASYFPNRSALPASTLLQVPRLANSAYLLEVEVIAVLPPRA* |
| Ga0126370_107278061 | 3300010358 | Tropical Forest Soil | VRGSDFPNKAALPGHTLLQISRLANPAYQLEVEIVAVLPPKA* |
| Ga0126370_116149881 | 3300010358 | Tropical Forest Soil | QNAEVYREVRASFFSNKSTLPASTLLQITRLANPSYLIEVDATAILPPRT* |
| Ga0126370_123792312 | 3300010358 | Tropical Forest Soil | FPNKSALPASTLLQVPRLANSAYLLEVEVIAVLPPRA* |
| Ga0126376_102207901 | 3300010359 | Tropical Forest Soil | VRGSDFPNKAALPGHTLLQISRLANPAYQLEVEIIAILPPKA* |
| Ga0126376_126934691 | 3300010359 | Tropical Forest Soil | KSALPASTLLQVPRLANWAYLLEVEVIAVLPPRA* |
| Ga0126376_128550082 | 3300010359 | Tropical Forest Soil | TYLTDIQQDADAYREVRASFLPNKSALPASTLLQVTRLADPSYLIEVDAIAILPPIA* |
| Ga0126372_118764332 | 3300010360 | Tropical Forest Soil | VRGSDFPNKAALPGHTLLQISRLANPAYQLEVEIIAILPAKA* |
| Ga0126378_110542071 | 3300010361 | Tropical Forest Soil | SYFSNKAALPASTLLQVSRLANPEYLLEVEALAILPPKA* |
| Ga0126378_119594492 | 3300010361 | Tropical Forest Soil | FPNKSALPASTLVQVARLSNPAFLLEVEAVAVLPSKA* |
| Ga0126377_117715081 | 3300010362 | Tropical Forest Soil | LDANAAIYREVRGSYFPNKAALPGHTLLQISRLANPAYQLEVEIIAILPPKA* |
| Ga0126377_135365373 | 3300010362 | Tropical Forest Soil | ANAAIYREVRGSYFPNKAALPGHTLLQISRLANPAYQLEVEIIAILPAKA* |
| Ga0126379_130257061 | 3300010366 | Tropical Forest Soil | NIEANADEYRQVRASYFPNKSRLPASTLLQVPRLAQPGYMLEVEVVAVLPPKQA* |
| Ga0126379_136720821 | 3300010366 | Tropical Forest Soil | NLDANAAIYREVRGSYFPNKAALPGHTLLQISRLANPAYQLEVEIIAILPPKA* |
| Ga0126381_1042227662 | 3300010376 | Tropical Forest Soil | EQNADVYREVRTSFFANKNALPASTLLQVTRLANPSYLIEVEATAILPPRA* |
| Ga0126383_117443161 | 3300010398 | Tropical Forest Soil | TDIQQDADVYREVRASFLPNKSALPASTQLQVVRLADPSYLIEVDVIAILPPK* |
| Ga0126383_136573401 | 3300010398 | Tropical Forest Soil | TNIEANADEYRQVRASYFPNKSRLPASTLLQVPRLAQPGYMLEVEVVAVLPPKQA* |
| Ga0134127_120771712 | 3300010399 | Terrestrial Soil | YREVRASFLTNKSALPASTLVQVTRLADPSYLIEVEVMAILPPRA* |
| Ga0134122_128234282 | 3300010400 | Terrestrial Soil | LDRDGATFREVRGSYFPNKAALPASTLLQVSRLANPAYLVEIDVVAVLPPKA* |
| Ga0137392_104095573 | 3300011269 | Vadose Zone Soil | GSYFPNKAALPASTLVQVPRLANPAFLLEIEAIAILPPKA* |
| Ga0126317_108657131 | 3300011332 | Soil | TNLDANAAIYREVRSSYFPNKAALPGHTLLQISRLANPAYQLEVEIIAILPPKA* |
| Ga0137436_10596331 | 3300011423 | Soil | LTNLEADGAVFREVRGSYFPNKAALPASTLLQVPRLANPAYLVEVEVIAVLPPKA* |
| Ga0137381_110687872 | 3300012207 | Vadose Zone Soil | FREVRASYFPNRSALPASTLLQVPRLANPAYLLEVEVIAVLPPRA* |
| Ga0150985_1143735622 | 3300012212 | Avena Fatua Rhizosphere | MTAYHTNLDANAAIYREVRSSYFPNKAALPGHTLLQISRLANPAYQLEVEVIAILPARA* |
| Ga0137370_109004682 | 3300012285 | Vadose Zone Soil | YLINIEANAPEFREVRGSYFPNKSALPASTLVQVPRLANPAFLLEVEAIAVLPPKA* |
| Ga0137385_103398291 | 3300012359 | Vadose Zone Soil | YFTNKAALPAATLMQVVRLANPAYLLEVEAIAILPPKT* |
| Ga0137375_102205861 | 3300012360 | Vadose Zone Soil | RGSYFPNKAALPGHTLLQISRLANPAYQLEVEIIAILPPKA* |
| Ga0157301_102834331 | 3300012911 | Soil | LERDGGGFREVRGSYFLNKAALPASTLLQVSRLANPAYLVEIDVVAVLPPKA* |
| Ga0137413_103668142 | 3300012924 | Vadose Zone Soil | VNAAEFREVRASYFPNRSALPASTLLQVPRLANPAYLLEVEVIAVLPPRA* |
| Ga0137416_114710381 | 3300012927 | Vadose Zone Soil | RASFFANKATLPASTLLQITRLANPSYLIEVEAMAVLPPKA* |
| Ga0137404_111904281 | 3300012929 | Vadose Zone Soil | SYFPNKTALPASTLLQISRLANPTYLVEVEVIAVIPRL* |
| Ga0126375_116601771 | 3300012948 | Tropical Forest Soil | AATYREVRMSYFPNKAALPGHTLLQISRLANPAYQLEVEIIAILPAKA* |
| Ga0164298_111420861 | 3300012955 | Soil | NAAEFRDVRALYFKKGTLPTATLLQVSRLANPAYLLEVEAIAVLPPKG* |
| Ga0164301_100102376 | 3300012960 | Soil | VRGSYFQNKQSLPASTLVQVPRLANPAFLLEIEAIAILPPKA* |
| Ga0164302_103626213 | 3300012961 | Soil | VRGSYFPNKQSLPASTLVQVPRLANPAFLLEIEAIAILPPKA* |
| Ga0126369_106787754 | 3300012971 | Tropical Forest Soil | NLEANGAEFREVRGSYFPNEAALPASTLLQISRLANAAYLVEVEVIAVIPRL* |
| Ga0126369_128045931 | 3300012971 | Tropical Forest Soil | NKSALPPSTLVQVARLSNPAFLLEVEAVAVLPSKA* |
| Ga0164308_109961501 | 3300012985 | Soil | SYFSDKTGLPASTLLEVSRLANPAYLIEVEAIAVLPPA* |
| Ga0134079_106769951 | 3300014166 | Grasslands Soil | VRASYFPNKAALPASTLLQVSRLANPAYLVEIDVIAVLPPK* |
| Ga0182024_103201472 | 3300014501 | Permafrost | VRALFFANRATLPASTLLQITRLANPSYLIEVEAMAVLPPKA* |
| Ga0157376_111322341 | 3300014969 | Miscanthus Rhizosphere | ADMYREVRASFLANKSALPASTLVQVTRLADPAYLIEVDATAILPPGA* |
| Ga0137420_13919019 | 3300015054 | Vadose Zone Soil | VRASYFPNKAVLPASTLLQVPRLANAAYLLEVEVVAILPLRA* |
| Ga0132258_111791861 | 3300015371 | Arabidopsis Rhizosphere | SYFPNKAALPASTLLQISRLANPSYLVEVEVIAMIPRL* |
| Ga0132258_117506161 | 3300015371 | Arabidopsis Rhizosphere | LDEHGAVYREVRASYFPNKAALPASTLLQISRLANPAYLLEVEVIAILPPKT* |
| Ga0132256_1006783111 | 3300015372 | Arabidopsis Rhizosphere | EHGTVYREVRASYFPNKAALPASTLLQVVRLADPAYRIEVDAVAILPPK* |
| Ga0132255_1051534831 | 3300015374 | Arabidopsis Rhizosphere | TDIQQDADAYREVRASFLPNKSALPASTLLQVVRLADPSYLIEVDAIAILPPAT* |
| Ga0182041_107779662 | 3300016294 | Soil | VRGSYFPNKAALPASTLLQISRLANPACLVEVEVIAAIPRL |
| Ga0182032_113203681 | 3300016357 | Soil | DVYREVRASFFANKSALPASTLLQITRLANPSFLIEVDATAVLPPRA |
| Ga0182034_116082971 | 3300016371 | Soil | VRGSYFPNKAALPASTLLQMSRLANAAYLVEVEVI |
| Ga0182040_115725791 | 3300016387 | Soil | NGAEFREVRGSYFPNKNALPASTLLQISRLANPAYLVEVEAIAILPPKA |
| Ga0187781_102613352 | 3300017972 | Tropical Peatland | FFPNKSALPASTLLQITRLANPSYLIEVDATAILPPRA |
| Ga0184610_12611302 | 3300017997 | Groundwater Sediment | EVRASYFPNRSALPASTLLQVPRLANPAYLLEVEVIAVLPLRA |
| Ga0184609_103152931 | 3300018076 | Groundwater Sediment | NAAEYRTVRASYFTNRSALPASTLLQIPRLANAAYLLEVEVVAVLPPKA |
| Ga0184625_100840481 | 3300018081 | Groundwater Sediment | TNRSALPASTLLQIPRLANAAYLLEVEVVAVLPPKA |
| Ga0190268_119506542 | 3300018466 | Soil | AAYRDVRAMYFKNKAALPGHTLLQISRLANPAYQIELEFIAILPPKA |
| Ga0210395_111314541 | 3300020582 | Soil | IYREVRASFFTNKNALPASTLLQITRLASPSFLIEVEATAILPPRA |
| Ga0210406_113267491 | 3300021168 | Soil | HGPAYREVRASYFSNKAALPASTLLQVSRLANPMFLLEVEALAILPPRA |
| Ga0210400_102103732 | 3300021170 | Soil | PNKAALPASTLLQISRLANPAYLVEVEVIAILPPKA |
| Ga0210405_100568634 | 3300021171 | Soil | ANAAAYREVRASYFPNKAALPASTLLQISRLANSAYLLEVEAVAILPPKA |
| Ga0210396_103137513 | 3300021180 | Soil | TNKSALPASTLLQITRLANPSFLIEVDATAILPPRT |
| Ga0210397_105365932 | 3300021403 | Soil | NKSALPASTLLQITRLANPSFLIEVDATAILPPRT |
| Ga0212123_106149391 | 3300022557 | Iron-Sulfur Acid Spring | NKGALPASTLLQVTRLANPSYFIEVDATAILPPSA |
| Ga0207687_111212063 | 3300025927 | Miscanthus Rhizosphere | SYFANKAALPASTLLQVPRLANAAYLLEVEVVAVLPPRA |
| Ga0207700_102766003 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | EFRETRNSYFPNKAGLPPSTVLQISRLANPNYLVEVDVIAAVPRL |
| Ga0207700_113615202 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | YFPNKQALPAATLLQVPRLANPAFLLEVEAIAILPPKA |
| Ga0207665_110304062 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VRASYFPNRSALPASTLLQVPRLANTAYLLEVEVMAILPPKA |
| Ga0207651_110465102 | 3300025960 | Switchgrass Rhizosphere | TDIQQDADAYREVRASFLPNKSALPASTLLQVVRLADPSYLIEVDAIAILPPAT |
| Ga0207703_114261672 | 3300026035 | Switchgrass Rhizosphere | RASFLPNKSALPASTLLQVVRLADPAYRIEVDAVAILPPK |
| Ga0207641_124610621 | 3300026088 | Switchgrass Rhizosphere | GSYFPNKQGLPASTLVQVPRLANPAFLLEIEAVAILPPKA |
| Ga0209799_10242301 | 3300027654 | Tropical Forest Soil | YFPNKAALPGHTLLQISRLANPAYQLEVEIIAILSPKA |
| Ga0209799_10242303 | 3300027654 | Tropical Forest Soil | VIRSKCRKSGNAAIYREVRGSYFPNKAALPGHTLLQISRLANPAYQLEVEIIA |
| Ga0209040_101151721 | 3300027824 | Bog Forest Soil | NLEANGAEFREVRGSYFPNKTALPASTLLQISRLANPAYLVEVEVIAILPPKA |
| Ga0209701_105305192 | 3300027862 | Vadose Zone Soil | APEFREVHGSYFPNKSALPASTLVQVPRLSNPAFLLEVEAVAVLPPKA |
| Ga0209488_100077998 | 3300027903 | Vadose Zone Soil | LARSIEANADVFREVRASYFPNKAALPASTLLQISRLANSAYLLEVDAIAILPPRA |
| Ga0307307_101804311 | 3300028718 | Soil | VRGSYFLNKQALPASTLVQVPRLANLAFLLEIEAIAILPPKA |
| Ga0307296_103077893 | 3300028819 | Soil | REVRASYFANKAALPASTLLQVSRLANPAYLVEIDVIAVLPPKA |
| Ga0307300_101939262 | 3300028880 | Soil | NGAEFREVRGSYFLNKQALPASTLVQVPRLANLAFLLEIEAIAILPPKA |
| Ga0311356_120225191 | 3300030617 | Palsa | PAYREIRASYFSNKVALPASTLLQVSRLADPQYLIEVEATAILPPKS |
| Ga0310888_107566701 | 3300031538 | Soil | ATFREVRGSYFPNKAALPASTLLQVSRLANPAYLVEIDVVAVLPPKA |
| Ga0302321_1014308761 | 3300031726 | Fen | EVRASYFPNKATLPASTLLQVPRLANADYLLEVEVVAILPPRA |
| Ga0307405_113907651 | 3300031731 | Rhizosphere | NKSALPASTLVQVTRLADPSYLIEVDAIAILPASA |
| Ga0307468_1015756312 | 3300031740 | Hardwood Forest Soil | REVRASFLANKNALPASTLVQVTRLADPSYLIEVDATAILPPRA |
| Ga0306918_108021091 | 3300031744 | Soil | VRGSYFPNKAALPASTLLQMSRLANAAYLVEVEVIAVIPRL |
| Ga0306918_113406681 | 3300031744 | Soil | REVRGSYFPNKDALPASTLLQISRLANPAYLVEVEAIAILPPKA |
| Ga0318521_102764151 | 3300031770 | Soil | FSNKSALPASTLLQVSRLANPDYLLEVEALAILPPKA |
| Ga0318546_107217262 | 3300031771 | Soil | VRASYFPNKAALPASTLLQISRLANPAYLVEVEAIAILPPKA |
| Ga0318508_12475012 | 3300031780 | Soil | REVRGSYFPNKAALPASTLLQMSRLANAAYLVEVEVIAVIPRL |
| Ga0310917_110954722 | 3300031833 | Soil | YFPNKAALPASTLLQISRLANPACLVEVEVIAAIPRL |
| Ga0306919_113203561 | 3300031879 | Soil | QNADAYREVRASFFANKSALPASTLLQITRLANPSFLIEVDATAVLPPRA |
| Ga0306925_113614731 | 3300031890 | Soil | FANKSALPASTLLQITRLANPSFLIEVDATAILPPRA |
| Ga0306923_102915473 | 3300031910 | Soil | PNKAALPASTLLQISRLANPAYLVEVEAIAILPPKA |
| Ga0306921_113235281 | 3300031912 | Soil | IEQNAEAYREVRASFFANKGALPASTLLQITRLADPSYLIEVDATAILPPLA |
| Ga0306926_115134752 | 3300031954 | Soil | TNKSTLPAATLVQVARLANPNFLLEVEVIAVLPPKV |
| Ga0310897_100304921 | 3300032003 | Soil | ITSNPTAIAANATDFRDVRALYFKTGTLPTATQLQVSRLANPAYLLEVEAIAVLPPKG |
| Ga0310902_103806533 | 3300032012 | Soil | NKAALPASTLLQVSRLANPAYLVEIDVVAVLPPKA |
| Ga0310906_108240192 | 3300032013 | Soil | NKQALPASTLVQVPRLANPAFLLEIEAIAILPPKA |
| Ga0318558_104961922 | 3300032044 | Soil | DCAAYREIRASYFSNKAALPASTLLQVSRLANPEYLLEVEALAILPPKA |
| Ga0318505_104758861 | 3300032060 | Soil | EFREVRGSYFPNKAALPASTLLQVPRLANPAFLLEVEAIAVLPPKA |
| Ga0318504_101180471 | 3300032063 | Soil | YLINIEANAPEFREVRGSFFPNKAALPASWLLQVPRLANPAFLLEVEAIAVLPPKA |
| Ga0318553_103857651 | 3300032068 | Soil | ASYFSNKAALPASTLLQVSRLANPEYLLEVEALAILPPKA |
| Ga0307471_1027154872 | 3300032180 | Hardwood Forest Soil | MAVIAEPFSANADVFREVRASYFPNKAALPASSLLQISRLANSSYLLEVEAIAILAPGA |
| Ga0307471_1036136691 | 3300032180 | Hardwood Forest Soil | TFREVRGSYFPNKAALPASTLLQVSRLANPAYLVEIDVVAVLPPKA |
| Ga0306920_1008196061 | 3300032261 | Soil | YREVRTSFFTNKSALPASTLLQIARLANPSYLIEVEATAILPPRA |
| Ga0306920_1019277282 | 3300032261 | Soil | LVTYLTDIEQNAEAYREVRASFFANKGALPASTLLQITRLADPSYLIEVDATAILPPLA |
| Ga0335080_113339872 | 3300032828 | Soil | REVRASFFANKGALPASTLLQITRLADPSYLIEVDATAILPPLA |
| ⦗Top⦘ |