


| Basic Information | |
|---|---|
| Family ID | F051201 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 144 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MTITEAAQKKVDQTLNGEGFLGVHLEGGGCSGYQIKLS |
| Number of Associated Samples | 81 |
| Number of Associated Scaffolds | 144 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 68.75 % |
| % of genes near scaffold ends (potentially truncated) | 99.31 % |
| % of genes from short scaffolds (< 2000 bps) | 94.44 % |
| Associated GOLD sequencing projects | 65 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (43.056 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean (39.583 % of family members) |
| Environment Ontology (ENVO) | Unclassified (92.361 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (86.111 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.67% β-sheet: 15.15% Coil/Unstructured: 68.18% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 144 Family Scaffolds |
|---|---|---|
| PF01883 | FeS_assembly_P | 3.47 |
| PF01521 | Fe-S_biosyn | 1.39 |
| PF04448 | DUF551 | 1.39 |
| PF13392 | HNH_3 | 1.39 |
| PF13640 | 2OG-FeII_Oxy_3 | 1.39 |
| PF13759 | 2OG-FeII_Oxy_5 | 1.39 |
| PF03692 | CxxCxxCC | 0.69 |
| PF05869 | Dam | 0.69 |
| PF03167 | UDG | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
|---|---|---|---|
| COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 1.39 |
| COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 1.39 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.69 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.69 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.28 % |
| Unclassified | root | N/A | 34.72 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001735|JGI24520J20079_1006753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 671 | Open in IMG/M |
| 3300002511|JGI25131J35506_1013488 | All Organisms → Viruses → Predicted Viral | 1124 | Open in IMG/M |
| 3300002511|JGI25131J35506_1017672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 981 | Open in IMG/M |
| 3300002511|JGI25131J35506_1031122 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300002514|JGI25133J35611_10003054 | All Organisms → cellular organisms → Bacteria | 8517 | Open in IMG/M |
| 3300002760|JGI25136J39404_1029945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 995 | Open in IMG/M |
| 3300002760|JGI25136J39404_1070715 | Not Available | 651 | Open in IMG/M |
| 3300002760|JGI25136J39404_1072308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 643 | Open in IMG/M |
| 3300002760|JGI25136J39404_1083728 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 598 | Open in IMG/M |
| 3300003981|Ga0063042_134173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 843 | Open in IMG/M |
| 3300006076|Ga0081592_1092550 | All Organisms → Viruses → Predicted Viral | 1219 | Open in IMG/M |
| 3300006076|Ga0081592_1203844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 633 | Open in IMG/M |
| 3300006310|Ga0068471_1638445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 995 | Open in IMG/M |
| 3300006325|Ga0068501_1480101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 711 | Open in IMG/M |
| 3300006335|Ga0068480_1564602 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 639 | Open in IMG/M |
| 3300006336|Ga0068502_1202740 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 952 | Open in IMG/M |
| 3300006338|Ga0068482_1922020 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 604 | Open in IMG/M |
| 3300006338|Ga0068482_1925028 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 506 | Open in IMG/M |
| 3300006339|Ga0068481_1543347 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 1539 | Open in IMG/M |
| 3300006340|Ga0068503_10390213 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 1664 | Open in IMG/M |
| 3300006340|Ga0068503_11078111 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 548 | Open in IMG/M |
| 3300006341|Ga0068493_10205659 | All Organisms → Viruses → Predicted Viral | 1866 | Open in IMG/M |
| 3300006751|Ga0098040_1164246 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300006753|Ga0098039_1158343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 773 | Open in IMG/M |
| 3300006754|Ga0098044_1250311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 687 | Open in IMG/M |
| 3300006793|Ga0098055_1224420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 710 | Open in IMG/M |
| 3300006793|Ga0098055_1363434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 537 | Open in IMG/M |
| 3300007514|Ga0105020_1082019 | All Organisms → Viruses → Predicted Viral | 2555 | Open in IMG/M |
| 3300007515|Ga0105021_1240190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 946 | Open in IMG/M |
| 3300007758|Ga0105668_1146820 | All Organisms → Viruses → Predicted Viral | 1271 | Open in IMG/M |
| 3300007963|Ga0110931_1270828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 504 | Open in IMG/M |
| 3300008050|Ga0098052_1260420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 662 | Open in IMG/M |
| 3300008050|Ga0098052_1302736 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 604 | Open in IMG/M |
| 3300008051|Ga0098062_1057400 | Not Available | 551 | Open in IMG/M |
| 3300008216|Ga0114898_1212735 | Not Available | 532 | Open in IMG/M |
| 3300008216|Ga0114898_1228146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 507 | Open in IMG/M |
| 3300008217|Ga0114899_1139412 | Not Available | 795 | Open in IMG/M |
| 3300008217|Ga0114899_1214800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 605 | Open in IMG/M |
| 3300008217|Ga0114899_1237012 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia maris | 566 | Open in IMG/M |
| 3300008219|Ga0114905_1054562 | Not Available | 1461 | Open in IMG/M |
| 3300008219|Ga0114905_1086317 | All Organisms → Viruses → Predicted Viral | 1103 | Open in IMG/M |
| 3300008219|Ga0114905_1104855 | Not Available | 977 | Open in IMG/M |
| 3300008219|Ga0114905_1288663 | Not Available | 505 | Open in IMG/M |
| 3300008220|Ga0114910_1021943 | Not Available | 2229 | Open in IMG/M |
| 3300008220|Ga0114910_1129595 | Not Available | 731 | Open in IMG/M |
| 3300008220|Ga0114910_1197293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 555 | Open in IMG/M |
| 3300009412|Ga0114903_1114236 | Not Available | 595 | Open in IMG/M |
| 3300009413|Ga0114902_1067140 | All Organisms → Viruses → Predicted Viral | 1003 | Open in IMG/M |
| 3300009413|Ga0114902_1182528 | Not Available | 516 | Open in IMG/M |
| 3300009414|Ga0114909_1162092 | Not Available | 587 | Open in IMG/M |
| 3300009418|Ga0114908_1033086 | All Organisms → Viruses → Predicted Viral | 1942 | Open in IMG/M |
| 3300009418|Ga0114908_1257513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 527 | Open in IMG/M |
| 3300009602|Ga0114900_1087794 | Not Available | 871 | Open in IMG/M |
| 3300009602|Ga0114900_1110536 | Not Available | 744 | Open in IMG/M |
| 3300009602|Ga0114900_1116455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 718 | Open in IMG/M |
| 3300009602|Ga0114900_1143407 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 623 | Open in IMG/M |
| 3300009603|Ga0114911_1050697 | Not Available | 1289 | Open in IMG/M |
| 3300009603|Ga0114911_1140008 | Not Available | 683 | Open in IMG/M |
| 3300009604|Ga0114901_1234101 | Not Available | 518 | Open in IMG/M |
| 3300009605|Ga0114906_1016526 | All Organisms → Viruses → Predicted Viral | 3084 | Open in IMG/M |
| 3300009605|Ga0114906_1251904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 575 | Open in IMG/M |
| 3300009620|Ga0114912_1096803 | Not Available | 711 | Open in IMG/M |
| 3300010153|Ga0098059_1333994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 577 | Open in IMG/M |
| 3300010155|Ga0098047_10220527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 724 | Open in IMG/M |
| 3300010155|Ga0098047_10322022 | Not Available | 582 | Open in IMG/M |
| 3300017775|Ga0181432_1149787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 717 | Open in IMG/M |
| 3300017775|Ga0181432_1230166 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 583 | Open in IMG/M |
| 3300019054|Ga0192992_10348350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 521 | Open in IMG/M |
| 3300021442|Ga0206685_10301452 | Not Available | 545 | Open in IMG/M |
| 3300021791|Ga0226832_10039728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1599 | Open in IMG/M |
| 3300021791|Ga0226832_10277525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 677 | Open in IMG/M |
| 3300021791|Ga0226832_10535940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 508 | Open in IMG/M |
| 3300021978|Ga0232646_1187218 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300023500|Ga0257021_1053095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 950 | Open in IMG/M |
| (restricted) 3300024052|Ga0255050_10138957 | Not Available | 583 | Open in IMG/M |
| (restricted) 3300024517|Ga0255049_10011221 | Not Available | 4156 | Open in IMG/M |
| (restricted) 3300024517|Ga0255049_10580350 | Not Available | 522 | Open in IMG/M |
| (restricted) 3300024518|Ga0255048_10579417 | Not Available | 542 | Open in IMG/M |
| 3300025038|Ga0208670_102262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3483 | Open in IMG/M |
| 3300025044|Ga0207891_1036898 | Not Available | 585 | Open in IMG/M |
| 3300025045|Ga0207901_1038283 | Not Available | 645 | Open in IMG/M |
| 3300025046|Ga0207902_1004122 | All Organisms → Viruses → Predicted Viral | 1378 | Open in IMG/M |
| 3300025046|Ga0207902_1015180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 873 | Open in IMG/M |
| 3300025049|Ga0207898_1019124 | Not Available | 866 | Open in IMG/M |
| 3300025050|Ga0207892_1011590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 934 | Open in IMG/M |
| 3300025050|Ga0207892_1044514 | Not Available | 520 | Open in IMG/M |
| 3300025050|Ga0207892_1045109 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 517 | Open in IMG/M |
| 3300025052|Ga0207906_1028068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 776 | Open in IMG/M |
| 3300025069|Ga0207887_1021650 | All Organisms → Viruses → Predicted Viral | 1018 | Open in IMG/M |
| 3300025069|Ga0207887_1064140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 600 | Open in IMG/M |
| 3300025069|Ga0207887_1069291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 576 | Open in IMG/M |
| 3300025125|Ga0209644_1025745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1293 | Open in IMG/M |
| 3300025125|Ga0209644_1038093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1083 | Open in IMG/M |
| 3300025125|Ga0209644_1039346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1067 | Open in IMG/M |
| 3300025125|Ga0209644_1109867 | Not Available | 654 | Open in IMG/M |
| 3300025125|Ga0209644_1165526 | Not Available | 526 | Open in IMG/M |
| 3300025125|Ga0209644_1174469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 512 | Open in IMG/M |
| 3300025241|Ga0207893_1044802 | Not Available | 634 | Open in IMG/M |
| 3300025248|Ga0207904_1056265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 659 | Open in IMG/M |
| 3300025251|Ga0208182_1015783 | All Organisms → Viruses → Predicted Viral | 1963 | Open in IMG/M |
| 3300025251|Ga0208182_1047121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 908 | Open in IMG/M |
| 3300025264|Ga0208029_1023251 | Not Available | 1516 | Open in IMG/M |
| 3300025264|Ga0208029_1058017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 790 | Open in IMG/M |
| 3300025267|Ga0208179_1038800 | All Organisms → Viruses → Predicted Viral | 1136 | Open in IMG/M |
| 3300025267|Ga0208179_1041615 | Not Available | 1080 | Open in IMG/M |
| 3300025267|Ga0208179_1059197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 837 | Open in IMG/M |
| 3300025270|Ga0208813_1030127 | Not Available | 1286 | Open in IMG/M |
| 3300025270|Ga0208813_1115433 | Not Available | 523 | Open in IMG/M |
| 3300025274|Ga0208183_1044764 | Not Available | 904 | Open in IMG/M |
| 3300025274|Ga0208183_1098972 | Not Available | 534 | Open in IMG/M |
| 3300025277|Ga0208180_1099617 | Not Available | 648 | Open in IMG/M |
| 3300025277|Ga0208180_1115351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 579 | Open in IMG/M |
| 3300025280|Ga0208449_1040804 | Not Available | 1298 | Open in IMG/M |
| 3300025282|Ga0208030_1031953 | Not Available | 1621 | Open in IMG/M |
| 3300025282|Ga0208030_1044142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1298 | Open in IMG/M |
| 3300025286|Ga0208315_1152300 | Not Available | 514 | Open in IMG/M |
| 3300025293|Ga0208934_1036384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 937 | Open in IMG/M |
| 3300025293|Ga0208934_1068223 | Not Available | 627 | Open in IMG/M |
| 3300025296|Ga0208316_1036896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1095 | Open in IMG/M |
| 3300025300|Ga0208181_1006068 | All Organisms → Viruses → Predicted Viral | 3717 | Open in IMG/M |
| 3300025300|Ga0208181_1113839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 512 | Open in IMG/M |
| 3300025301|Ga0208450_1069748 | Not Available | 819 | Open in IMG/M |
| 3300025301|Ga0208450_1069951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 817 | Open in IMG/M |
| 3300025305|Ga0208684_1025056 | All Organisms → Viruses → Predicted Viral | 1823 | Open in IMG/M |
| 3300025305|Ga0208684_1025225 | All Organisms → Viruses → Predicted Viral | 1815 | Open in IMG/M |
| 3300025305|Ga0208684_1047742 | All Organisms → Viruses → Predicted Viral | 1189 | Open in IMG/M |
| 3300025873|Ga0209757_10070559 | All Organisms → Viruses → Predicted Viral | 1045 | Open in IMG/M |
| 3300025873|Ga0209757_10120312 | Not Available | 812 | Open in IMG/M |
| 3300025873|Ga0209757_10138583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 759 | Open in IMG/M |
| 3300025873|Ga0209757_10215949 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 608 | Open in IMG/M |
| 3300025873|Ga0209757_10251649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 561 | Open in IMG/M |
| 3300028018|Ga0256381_1056113 | Not Available | 597 | Open in IMG/M |
| 3300028022|Ga0256382_1137054 | Not Available | 587 | Open in IMG/M |
| 3300028022|Ga0256382_1149023 | Not Available | 561 | Open in IMG/M |
| 3300028022|Ga0256382_1154359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 550 | Open in IMG/M |
| 3300032048|Ga0315329_10600795 | Not Available | 584 | Open in IMG/M |
| 3300032130|Ga0315333_10307613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 751 | Open in IMG/M |
| 3300032146|Ga0315303_1061692 | Not Available | 768 | Open in IMG/M |
| 3300032146|Ga0315303_1062891 | Not Available | 760 | Open in IMG/M |
| 3300032278|Ga0310345_11983194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 566 | Open in IMG/M |
| 3300032278|Ga0310345_12463518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 502 | Open in IMG/M |
| 3300032820|Ga0310342_100079459 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED123 | 2939 | Open in IMG/M |
| 3300032820|Ga0310342_102633691 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300032820|Ga0310342_103363275 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 529 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 39.58% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 32.64% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 4.86% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 3.47% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.78% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 2.78% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 2.08% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.08% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 2.08% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.39% |
| Diffuse Hydrothermal Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Fluids | 1.39% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.39% |
| Background Seawater | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater | 0.69% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.69% |
| Diffuse Hydrothermal Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Vent | 0.69% |
| Marine | Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Marine | 0.69% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Fluids | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001735 | Marine viral communities from the Pacific Ocean - LP-45 | Environmental | Open in IMG/M |
| 3300002511 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 | Environmental | Open in IMG/M |
| 3300002514 | Marine viral communities from the Pacific Ocean - ETNP_6_85 | Environmental | Open in IMG/M |
| 3300002760 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 | Environmental | Open in IMG/M |
| 3300003981 | Diffuse hydrothermal vent microbial communities from Menez Gwen hydrothermal field, Mid Atlantic ridge - MGW_A | Environmental | Open in IMG/M |
| 3300006076 | Microbial communities in diffuse hydrothermal fluids of Manus Basin, Bismarck Sea ? fluid A | Environmental | Open in IMG/M |
| 3300006310 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_3_0500m | Environmental | Open in IMG/M |
| 3300006325 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0500m | Environmental | Open in IMG/M |
| 3300006335 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_2_0500m | Environmental | Open in IMG/M |
| 3300006336 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0500m | Environmental | Open in IMG/M |
| 3300006338 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_1_0770m | Environmental | Open in IMG/M |
| 3300006339 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_3_0500m | Environmental | Open in IMG/M |
| 3300006340 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0770m | Environmental | Open in IMG/M |
| 3300006341 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT236_2_0770m | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300007514 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
| 3300007515 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um, replicate b | Environmental | Open in IMG/M |
| 3300007758 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample CTDPlume_2015_DNA CLC_assembly | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008051 | Marine viral communities from Cariaco Basin, Caribbean Sea - 23_WHOI_OMZ | Environmental | Open in IMG/M |
| 3300008216 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar | Environmental | Open in IMG/M |
| 3300008217 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 | Environmental | Open in IMG/M |
| 3300008219 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 | Environmental | Open in IMG/M |
| 3300008220 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 | Environmental | Open in IMG/M |
| 3300009412 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2 | Environmental | Open in IMG/M |
| 3300009413 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 | Environmental | Open in IMG/M |
| 3300009414 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 | Environmental | Open in IMG/M |
| 3300009418 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 | Environmental | Open in IMG/M |
| 3300009602 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 | Environmental | Open in IMG/M |
| 3300009603 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 | Environmental | Open in IMG/M |
| 3300009604 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 | Environmental | Open in IMG/M |
| 3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
| 3300009620 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_51 | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300019054 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001590 (ERX1782183-ERR1711964) | Environmental | Open in IMG/M |
| 3300021442 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 | Environmental | Open in IMG/M |
| 3300021791 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmer | Environmental | Open in IMG/M |
| 3300021978 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Perseverance_CTD_V16A_01_btl17 _150kmer | Environmental | Open in IMG/M |
| 3300023500 | Marine microbial mat from Loihi Seamount, Hawaii, USA - Marker 39_BS4 Individual Assembly | Environmental | Open in IMG/M |
| 3300024052 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_5 | Environmental | Open in IMG/M |
| 3300024517 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3 | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300025038 | Marine viral communities from Cariaco Basin, Caribbean Sea - 24B_WHOI_OMZ_CsCl (SPAdes) | Environmental | Open in IMG/M |
| 3300025044 | Marine viral communities from the Pacific Ocean - LP-50 (SPAdes) | Environmental | Open in IMG/M |
| 3300025045 | Marine viral communities from the Pacific Ocean - LP-46 (SPAdes) | Environmental | Open in IMG/M |
| 3300025046 | Marine viral communities from the Pacific Ocean - LP-45 (SPAdes) | Environmental | Open in IMG/M |
| 3300025049 | Marine viral communities from the Pacific Ocean - LP-55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025050 | Marine viral communities from the Pacific Ocean - LP-54 (SPAdes) | Environmental | Open in IMG/M |
| 3300025052 | Marine viral communities from the Pacific Ocean - LP-37 (SPAdes) | Environmental | Open in IMG/M |
| 3300025069 | Marine viral communities from the Pacific Ocean - LP-38 (SPAdes) | Environmental | Open in IMG/M |
| 3300025125 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300025241 | Marine viral communities from the Deep Pacific Ocean - MSP-121 (SPAdes) | Environmental | Open in IMG/M |
| 3300025248 | Marine viral communities from the Deep Pacific Ocean - MSP-118 (SPAdes) | Environmental | Open in IMG/M |
| 3300025251 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 (SPAdes) | Environmental | Open in IMG/M |
| 3300025264 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025267 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar (SPAdes) | Environmental | Open in IMG/M |
| 3300025270 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 (SPAdes) | Environmental | Open in IMG/M |
| 3300025274 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_51 (SPAdes) | Environmental | Open in IMG/M |
| 3300025277 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 (SPAdes) | Environmental | Open in IMG/M |
| 3300025280 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 (SPAdes) | Environmental | Open in IMG/M |
| 3300025282 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 (SPAdes) | Environmental | Open in IMG/M |
| 3300025286 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 (SPAdes) | Environmental | Open in IMG/M |
| 3300025293 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025296 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 (SPAdes) | Environmental | Open in IMG/M |
| 3300025300 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 (SPAdes) | Environmental | Open in IMG/M |
| 3300025301 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 (SPAdes) | Environmental | Open in IMG/M |
| 3300025305 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 (SPAdes) | Environmental | Open in IMG/M |
| 3300025873 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300028018 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 1600m | Environmental | Open in IMG/M |
| 3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
| 3300032048 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 32315 | Environmental | Open in IMG/M |
| 3300032130 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 34915 | Environmental | Open in IMG/M |
| 3300032146 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_Tmax_316 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24520J20079_10067531 | 3300001735 | Marine | MTITESAQKKVDATLNGEGFLGIHLEGGGCSGYRIKLSPT |
| JGI25131J35506_10134884 | 3300002511 | Marine | MIITEAAQSKVDQVLKGDGYLEVCLEGGGCSGYQIKLKGTSEIPSDAQM |
| JGI25131J35506_10176721 | 3300002511 | Marine | MIITEAAQSKVDQVLKGEGFLEVCLEGGGCSGYQIKLKGTSEIPSDAQMLS |
| JGI25131J35506_10311223 | 3300002511 | Marine | MVITQSAQDKVNQVLNGEGFLEVCLEGGGCSGYQIKLKGTSEIPSDAQML |
| JGI25133J35611_1000305411 | 3300002514 | Marine | MIITEAAKNKVSQVLNGEGFLEVYLEGGGCSGYQIKLKGSQEVPCGSSFQLD* |
| JGI25136J39404_10299451 | 3300002760 | Marine | VTITDAAQCKVNQTLNGEGFLGVYLEGGGCSGYQIRLKPE |
| JGI25136J39404_10707151 | 3300002760 | Marine | MTITEAAQNKVDQVINGEGYLGIYLEGGGCSGYKIKLSPTGELP |
| JGI25136J39404_10723083 | 3300002760 | Marine | MIITEAAKDKVNQVLNGEGFLEVCLEGGGCSGYQIKLKGTQSI |
| JGI25136J39404_10837281 | 3300002760 | Marine | MTITEAAQNKVDQVLNGEGFLEIYLQGGGCSGYQIKLKGT |
| Ga0063042_1341731 | 3300003981 | Diffuse Hydrothermal Vent | MIITEAAQKKVNQVLNGEGFLGILLEGGGCSGYQIKLSPTG |
| Ga0081592_10925501 | 3300006076 | Diffuse Hydrothermal Fluids | MIITEAAKDKVNQVLNGEGFLEVCLEGGGCSGYQIKLKGTQSIPPDAEM |
| Ga0081592_12038443 | 3300006076 | Diffuse Hydrothermal Fluids | MVITEAAKNKVDQVLNGEGFLEVCLEGGGCSGYQIKLKGTQSIPEDAEML |
| Ga0068471_16384451 | 3300006310 | Marine | MTITEAAQNKVDQVINGEGYLGIFLEGGGCSGYKIKLSPT |
| Ga0068501_14801011 | 3300006325 | Marine | MIITEAAKTKVNQVLNGEGFLEVCLEGGGCSGYQIK |
| Ga0068480_15646021 | 3300006335 | Marine | VRITEAAKNKVDQVLNGDGFLEICLEGGGCSGYQIKLKGSS |
| Ga0068502_12027404 | 3300006336 | Marine | MVITETAQNKVDQVLNGEGFLEICLEGGGCSGYQIKLKYAL |
| Ga0068482_19220203 | 3300006338 | Marine | MTITEAAQNKVDQVINGEGFLGIYLEGGGCSGYKIRLSPT |
| Ga0068482_19250281 | 3300006338 | Marine | MIITEAARNKVDQVLNGEGFLEICLEGGGCSGYQIKLK |
| Ga0068481_15433471 | 3300006339 | Marine | MIITEAAKTKVNQVLNGEGFLKVCLEGGGCSGYQIKL |
| Ga0068503_103902135 | 3300006340 | Marine | MVITEAARKKVDQVLNGDGFLEICLQGGGCSGYQIKLKGTSEIPSE |
| Ga0068503_110781111 | 3300006340 | Marine | MTITEAAQNKVDQVINGDGYLGIYLEGGGCSGYKIKLSP |
| Ga0068493_102056591 | 3300006341 | Marine | MIITEAAKTKVNQVLNGEGFLEVCLEGGGCSGYQIKLKGTSEI |
| Ga0098040_11642461 | 3300006751 | Marine | VTITESAQTKVDSTLNGEGFLGIHLEGGGCSGYQIKLNPSP |
| Ga0098039_11583431 | 3300006753 | Marine | MTITEAAQNKVNQVLNGEGFLGIVLEGGGCSGYQIKLSPTGDIPKWA |
| Ga0098044_12503113 | 3300006754 | Marine | MTITEAAQNKVDQVIDGDGYLGIHLEGGGCSGYRIKLSTTGDIPT |
| Ga0098055_12244203 | 3300006793 | Marine | MTITESAQRKVDQTLNGEGFLGVHLEGGGCSGYQIKLSP |
| Ga0098055_13634341 | 3300006793 | Marine | MTITESAQRKVDQTLNGEGFLGVHLEGGGCSGYQIKLNPSTDIP |
| Ga0105020_10820191 | 3300007514 | Marine | VTITESAQNKVDSTLNGEGFLGIHLEGGGCSGYQIKLSPT |
| Ga0105021_12401901 | 3300007515 | Marine | MKITESAQKKVDATLNGEGFLGIHLEGGGCSGYQIKLSPTTDL |
| Ga0105668_11468201 | 3300007758 | Background Seawater | MVITVSARNKVDQVLNGEGFLEIYLQGGGCSGYQI |
| Ga0110931_12708282 | 3300007963 | Marine | MTITESAQRKVDQTLDGEGYLGVHLEGGGCSGYQIKLNPSTDI |
| Ga0098052_12604201 | 3300008050 | Marine | MTITEEAQTKITDVLNGEGFLGIYLEGGGCSGYRIKLSP |
| Ga0098052_13027363 | 3300008050 | Marine | MTITEAAQNKVDQVINGEGYLGIYLEGGGCSGYKIKLSP |
| Ga0098062_10574001 | 3300008051 | Marine | MTITEAAQRKVDQTLNGEGFLGIHLEGGGCSGYQIK |
| Ga0114898_12127351 | 3300008216 | Deep Ocean | MKITESAQRKVDQTLQGEGFLGIHLEGGGCSGYQIKLSPTTELP |
| Ga0114898_12281461 | 3300008216 | Deep Ocean | MVITEAAQNKVDQVLNGDGFLEICLEGGGCSGYQIKLKGS |
| Ga0114899_11394121 | 3300008217 | Deep Ocean | MTVTEAAQTKVNQVLNGEGFLEVCLEGGGCSGYQIKLKGTS |
| Ga0114899_12148001 | 3300008217 | Deep Ocean | MVITEAAQNKVDQVLNGEGFLEVCLEGGGCSGYQIKLKGTSEIPSD |
| Ga0114899_12370122 | 3300008217 | Deep Ocean | VTVTESAQKKVDQTLDGEGYLGIHLEGGGCSGYQIK |
| Ga0114905_10545626 | 3300008219 | Deep Ocean | VTITDSAQQKVDQTLNGEGFLGVHLEGGGCSGYQI |
| Ga0114905_10863175 | 3300008219 | Deep Ocean | MIITEEAQNKVNQVLNGEGFLGVYLEGGGCSGYQIKLRGE |
| Ga0114905_11048551 | 3300008219 | Deep Ocean | MTITEAAQNKVNQVLNGEGFLGVLLEGGGCSGYQIKLSPTGDI |
| Ga0114905_12886631 | 3300008219 | Deep Ocean | MTITESAQNKVDATLNGEGFLGIHLEGGGCSGYQIK |
| Ga0114910_10219439 | 3300008220 | Deep Ocean | LTITEAAQKNVNQVLAGDGYLGVFLEGGGCSGYQIKLKPDSALPPDARMITD |
| Ga0114910_11295953 | 3300008220 | Deep Ocean | MIITEEAQNKVNQVLNGEGFLGVYLEGGGCSGYQIKLRGETDI |
| Ga0114910_11972933 | 3300008220 | Deep Ocean | MTITEAAQNKVDQVLNGEGFLEVCLEGGGCSGYQI |
| Ga0114903_11142361 | 3300009412 | Deep Ocean | MTVTEAAQTKVNQVLNGKGFLEVCLEGGGCSGYQIKLKGTSEIPPD |
| Ga0114902_10671401 | 3300009413 | Deep Ocean | MTITEAAQRKVHQTLNGEGFLGVHLEGGGCSGYQIKLNPSTDIPSD |
| Ga0114902_11825281 | 3300009413 | Deep Ocean | MIITEAAQNKVDQVLKGDGFLEVCLEGGGCSGYQIKLKGT |
| Ga0114909_11620923 | 3300009414 | Deep Ocean | MKITESAQRKVDQTLQGEGFLGIHLEGGGCSGYQIKLSPTT |
| Ga0114908_10330861 | 3300009418 | Deep Ocean | MTITEAAQNKVNQVLNGEGFLGILLEGGGCSGYQIKLSPTGDIPK |
| Ga0114908_12575131 | 3300009418 | Deep Ocean | MVITEAAQNKVDQVLNGEGFLEVCLEGGGCSGYQIKLKGTSE |
| Ga0114900_10877943 | 3300009602 | Deep Ocean | MTITESAQKKVDQTLKGEGFLGVHLEGGGCSGYQIKLTPQADIP |
| Ga0114900_11105363 | 3300009602 | Deep Ocean | MTITESAQRKVDQTLNGEGFLGVHLEGGGCSGYQIKLNPST |
| Ga0114900_11164551 | 3300009602 | Deep Ocean | MTITESAQKKVDQTLNGEGFLGVYLEGGGCSGYQIKLSPSTDLPSD |
| Ga0114900_11434071 | 3300009602 | Deep Ocean | MTITEAAQNKVDQVIDGDGYLGIYLEGGGCSGYRIKLSPTGEL |
| Ga0114911_10506974 | 3300009603 | Deep Ocean | VTITPAAQKKVDQTLNGEGFLGIHLEGGGCSGYQIKLSPTTE |
| Ga0114911_11400081 | 3300009603 | Deep Ocean | MIITEAAQSKVDQVLNGEGFLEVCLEGGGCSGYQIKLKGTSEIPSDA |
| Ga0114901_12341011 | 3300009604 | Deep Ocean | MTITEAAQRKVDQTLDGQGFLGIHLEGGGCSGYQIKLS |
| Ga0114906_10165261 | 3300009605 | Deep Ocean | MTVTEAAQTKVNQVLNGEGFLEVCLEGGGCSGYQIKLKGTSEI |
| Ga0114906_12519043 | 3300009605 | Deep Ocean | MTITEAAQNKVDQVINGDGFLGIYLEGGGCSGYRIK |
| Ga0114912_10968031 | 3300009620 | Deep Ocean | MTITEAAQQKVDQTLNGEGFLGVHLEGGGCSGYQIK |
| Ga0098059_13339941 | 3300010153 | Marine | MTITESAQKKVDATLNGEGFLGIHLEGGGCSGYKIKLSPTTD |
| Ga0098047_102205273 | 3300010155 | Marine | LTITESAQGKVDQVLNGEGFLGIHLEGGGCSGYQIKLNPSP |
| Ga0098047_103220222 | 3300010155 | Marine | MTITESAQKKVDQTLKGEGFLGIHLEGGGCSGYQIKLS |
| Ga0181432_11497873 | 3300017775 | Seawater | MTITEAAQNKVDQVINGEGFLGIYLEGGGCSGYKIRLSPTG |
| Ga0181432_12301661 | 3300017775 | Seawater | MTITEAAQNKVDQVLNGEGFLEIYLQGGGCSGYQIKLKGTSEI |
| Ga0192992_103483503 | 3300019054 | Marine | MIITEAAQSKVDQVLKGEGYLEVCLEGGGCSGYQIKLKGTSEVPSDAQM |
| Ga0206685_103014523 | 3300021442 | Seawater | MTITESAQKKVDATLNGEGFLGIHLEGGGCSGYQIKLSPSTDIPQ |
| Ga0226832_100397281 | 3300021791 | Hydrothermal Vent Fluids | MTITESAQKKVDATLDGNGFLGIHLEGGGCSGYQIKLSPTTDIPQ |
| Ga0226832_102775251 | 3300021791 | Hydrothermal Vent Fluids | MTITEAAQNKVNLVLNGEGFLGILLEGGGCSGYQIKLSPTGD |
| Ga0226832_105359401 | 3300021791 | Hydrothermal Vent Fluids | VTITPAAQKKVDQTLNGEGFLGIHLEGGGCSGYQIKLSP |
| Ga0232646_11872183 | 3300021978 | Hydrothermal Vent Fluids | MIVTEAAQNKVNQVLDGEGFLEVCLEGGGCSGYQI |
| Ga0257021_10530951 | 3300023500 | Marine | MVITETAQNKVDQVLNGEGFLEICLEGGGCSGYQIKLK |
| (restricted) Ga0255050_101389572 | 3300024052 | Seawater | MTITEQAQEKINQTLDGQGYLGIYLEGGGCSGYKIKLSPTGE |
| (restricted) Ga0255049_1001122112 | 3300024517 | Seawater | MTITESAQNKVDATLNGEGFLGIHLEGGGCSGYQIKLSP |
| (restricted) Ga0255049_105803501 | 3300024517 | Seawater | MTITESAQKKVDATLNGEGFLGIHLEGGGCSGYQIKLSPSTDIPQD |
| (restricted) Ga0255048_105794173 | 3300024518 | Seawater | VTITESAQKKVDQTLDGEGFLGIHLEGGGCSGYQIKL |
| Ga0208670_10226210 | 3300025038 | Marine | MTITESAQKKVDQTLNGEGFLGVYLEGGGCSGYQIKL |
| Ga0207891_10368981 | 3300025044 | Marine | LTITESAQKKVDQTLNGEGFLGIHLEGGGCSGYQIKLSPYTDIP |
| Ga0207901_10382834 | 3300025045 | Marine | VTITESAQTKVDQTLNGEGFLGVYLEGGGCSGYQIKLSP |
| Ga0207902_10041224 | 3300025046 | Marine | MVITESAQNKVDQVLNGEGFLEIYLQGGGCSGYQIKLKGTSEIPSEA |
| Ga0207902_10151803 | 3300025046 | Marine | MTVTESAQKKVDQTLNGEGFLGIHLEGGGCSGYQIK |
| Ga0207898_10191241 | 3300025049 | Marine | MTITESAQNKVDSTLNGEGFLGIHLEGGGCSGYQIKLSPST |
| Ga0207892_10115901 | 3300025050 | Marine | VTITESAQSKVDQVLNGEGFLGIHLEGGGCSGYQIKLSPST |
| Ga0207892_10445141 | 3300025050 | Marine | MKITEAAQNKVDQTLNGEGFLGVSLEGGGCSGYQIKLSPATDLPQD |
| Ga0207892_10451093 | 3300025050 | Marine | MIITEAARNKVDQVLNGEGFLEICLQGGGCSGYQIK |
| Ga0207906_10280683 | 3300025052 | Marine | VTITESAQTKVDQTLRGEGFLGVHLEGGGCSGYQI |
| Ga0207887_10216501 | 3300025069 | Marine | MIITEAAKNKVDQVLNGEGFLEICLQGGGCSGYQIKLK |
| Ga0207887_10641403 | 3300025069 | Marine | MTITEAAKTKVNQVLDGQGFLGVYLEGGGCSGYRIKLHADSDIP |
| Ga0207887_10692913 | 3300025069 | Marine | MIITEAAKTKVNQVLNGEGFLEVCLEGGGCSGYQI |
| Ga0209644_10257451 | 3300025125 | Marine | MTITEAAQTKVNQVLNGDGFLGVHLEGGGCSGYQIKLNAST |
| Ga0209644_10380934 | 3300025125 | Marine | MVITESAQNKVDQVLNGEGFLEIYLQGGGCSGYQIKLKGTSEIP |
| Ga0209644_10393465 | 3300025125 | Marine | MIITEAAQSKVDQVLKGEGFLEVCLEGGGCSGYQIKLKGTSEIPSDAQ |
| Ga0209644_11098674 | 3300025125 | Marine | VTITDAAQCKVNQTLNGEGFLGVYLEGGGCSGYQI |
| Ga0209644_11655263 | 3300025125 | Marine | VTITESAQTKVDSTLNGEGFLGIHLEGGGCSGYQIKLNPSSDIPPD |
| Ga0209644_11744692 | 3300025125 | Marine | MTITESAQRKVDQTLNGEGFLGIHLEGGGCSGYQIKLS |
| Ga0207893_10448021 | 3300025241 | Deep Ocean | MVVTQAAQDKVNQTLNGDGYLEICLEGGGCSGYQIKLKGASDIPSDAQ |
| Ga0207904_10562653 | 3300025248 | Deep Ocean | MIITEAAKDKVNQVLNGEGFLEVCLEGGGCSGYQIKLKGTQCIPEDAEM |
| Ga0208182_10157831 | 3300025251 | Deep Ocean | VTITESAQTKVDSTLNGEGFLGIHLEGGGCSGYQIKLSPTTDI |
| Ga0208182_10471213 | 3300025251 | Deep Ocean | MVITEAAQNKVDQVLNGDGFLEICLEGGGCSGYQIKLKGSSEIPADAKM |
| Ga0208029_10232511 | 3300025264 | Deep Ocean | MTITESAQKKVDATLDGNGFLGIHLEGGGCSGYKIKLSPT |
| Ga0208029_10580171 | 3300025264 | Deep Ocean | MTITESAQKKVDATLNGEGFLGIHLEGGGCSGYQIKLS |
| Ga0208179_10388001 | 3300025267 | Deep Ocean | VTITESAQAKVDSTLNGEGFLGIHLEGGGCSGYQIKLSPTTD |
| Ga0208179_10416154 | 3300025267 | Deep Ocean | LTITEAAQKKVNQVLAGDGYLGVFLEGGGCSGYQIKLKGTQSIPED |
| Ga0208179_10591973 | 3300025267 | Deep Ocean | MIITEEAQNKVNQVLNGEGFLGVYLEGGGCSGYQIK |
| Ga0208813_10301275 | 3300025270 | Deep Ocean | MIITEAAQSKVDQVLKGEGFLEVCLEGGGCSGYQIKLKGTS |
| Ga0208813_11154333 | 3300025270 | Deep Ocean | MIITEAAQNKVDQVLKGDGFLEVCLEGGGCSGYQIKLKGTS |
| Ga0208183_10447643 | 3300025274 | Deep Ocean | MIITESAQNKVDQVLNGEGFLEVCLEGGGCSGYQIKLKGTSEIPEDAQ |
| Ga0208183_10989723 | 3300025274 | Deep Ocean | MTITESAQKKVDQTLKGEGFLGIHLEGGGCSGYQIKL |
| Ga0208180_10996171 | 3300025277 | Deep Ocean | MIITEEAQNKVNQVLNGEGFLGVYLEGGGCSGYQI |
| Ga0208180_11153511 | 3300025277 | Deep Ocean | MVITEAAQNKVDQVLNGEGFLEVCLEGGGCSGYQIKL |
| Ga0208449_10408045 | 3300025280 | Deep Ocean | MTITESAQTKVDSTLNGEGFLGIHLEGGGCSGYQIKLS |
| Ga0208030_10319535 | 3300025282 | Deep Ocean | MTITESAQTKVDSTLNGEGFLGIHLEGGGCSGYQIKLSPSTEI |
| Ga0208030_10441425 | 3300025282 | Deep Ocean | MVITEAAQNKVDQVLNGDGFLEICLEGGGCSGYQIKLKGTSEIPSDAKML |
| Ga0208315_11523001 | 3300025286 | Deep Ocean | MTITEAAQTKVDNTLNGEGFLGIHLEGGGCSGYQIK |
| Ga0208934_10363841 | 3300025293 | Deep Ocean | MVITEAAQNKVDQVLNGEGFLEVCLEGGGCSGYQIKLKGTSEIPSDA |
| Ga0208934_10682233 | 3300025293 | Deep Ocean | MTITEAAQTKVDNTLNGEGFLGIHLEGGGCSGYQI |
| Ga0208316_10368961 | 3300025296 | Deep Ocean | MTITEAAQNKVDQVLNGEGFLEVCLEGGGCSGYQIKLKGTSEIPSD |
| Ga0208181_10060681 | 3300025300 | Deep Ocean | MTITESAQKKVDQTLNGEGFLGVHLEGGGCSGYQIKLTPQADIP |
| Ga0208181_11138391 | 3300025300 | Deep Ocean | MVITEAAQNKVDQVLNGDGFLEICLEGGGCSGYQIK |
| Ga0208450_10697483 | 3300025301 | Deep Ocean | MIITEAAQSKVDQVLNGEGFLEVCLEGGGCSGYQI |
| Ga0208450_10699511 | 3300025301 | Deep Ocean | MVITEAAQNKVDQVLNGEGFLEVCLEGGGCSGYQIKLKGT |
| Ga0208684_10250561 | 3300025305 | Deep Ocean | VTITESAQNKVDSTLNGEGFLGIHLEGGGCSGYQI |
| Ga0208684_10252251 | 3300025305 | Deep Ocean | MTITESAQTKVDQTLNGEGFLGVHLEGGGCSGYQIKLTPQAD |
| Ga0208684_10477424 | 3300025305 | Deep Ocean | MTITEAAQNKVDQVINGDGYLGIYLEGGGCSGYKIKLSPTGELPT |
| Ga0209757_100705594 | 3300025873 | Marine | MTITEAAQNKVDQVINGEGFLGIYLEGGGCSGYKIKLSATGELPT |
| Ga0209757_101203124 | 3300025873 | Marine | MTITQAAQNKVDQTLRGEGFLGVYLEGGGCSGYQIKL |
| Ga0209757_101385833 | 3300025873 | Marine | VTITESAQGKVDQVLNGEGFLGIHLEGGGCSGYQIKLNPS |
| Ga0209757_102159493 | 3300025873 | Marine | VTITEAAQNKVDQVLNGDGFLEICLEGGGCSGYQIKLKGSSE |
| Ga0209757_102516493 | 3300025873 | Marine | MVITEAARKKVDQVLNGDGFLEICLQGGGCSGYQIKLKGTS |
| Ga0256381_10561131 | 3300028018 | Seawater | MIITEAAQRKVKQVLNGEGFLEICLQGGGCSGYQII |
| Ga0256382_11370543 | 3300028022 | Seawater | MTITEAAQCKVDQTLNGEGFLGVYLEGGGCSGYQIKLKPETEIS |
| Ga0256382_11490232 | 3300028022 | Seawater | MIITEAAQNKVDQVLKGDGFLEVCLEGGGCSGYQIKLKGTSEIPEDAQ |
| Ga0256382_11543591 | 3300028022 | Seawater | MTITEAAQTKVDNTLNGEGFLGIHLEGGGCSGYQIKLSPSTDIPSLP |
| Ga0315329_106007952 | 3300032048 | Seawater | MTITEAAQKKVDQTLNGEGFLGVHLEGGGCSGYQIKLS |
| Ga0315333_103076133 | 3300032130 | Seawater | VTITESAQTKVDSTLNGEGFLGIHLEGGGCSGYQIKLSPTTDIP |
| Ga0315303_10616923 | 3300032146 | Marine | MTITESAQKKVDATLDGEGFLGIHLEGGGCSGYQIKL |
| Ga0315303_10628913 | 3300032146 | Marine | LMTITESAQTKVDSTLNGEGFLGIHLEGGGCSGYQIKLSPHTEIPQD |
| Ga0310345_119831943 | 3300032278 | Seawater | MVITEAAQNKVNQVLNGEGFLEVCLEGGGCSGYQIKLKGT |
| Ga0310345_124635181 | 3300032278 | Seawater | VRITEAAKNKVDQVLNGDGFLEICLEGGGCSGYQIKLKGS |
| Ga0310342_1000794596 | 3300032820 | Seawater | MNITEAAQNKVDQVLKGEGFLEVCLEGGGCSGYQIKLKGTSEIPSD |
| Ga0310342_1026336913 | 3300032820 | Seawater | MTITDAAQTKVDQVINGEGFLGIFLEGGGCSGYRIKLSPTGELPTD |
| Ga0310342_1033632753 | 3300032820 | Seawater | MTITEAAQNKVDQVINGEGFLGIYLEGGGCSGYKIR |
| ⦗Top⦘ |