


| Basic Information | |
|---|---|
| Family ID | F051113 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 144 |
| Average Sequence Length | 43 residues |
| Representative Sequence | LLMAGADRAIRELMFIFKDDPIEIPLEEATMSVWARMQLEE |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 144 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 2.08 % |
| % of genes near scaffold ends (potentially truncated) | 94.44 % |
| % of genes from short scaffolds (< 2000 bps) | 86.81 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.60 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.944 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (18.056 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.222 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (54.861 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.83% β-sheet: 0.00% Coil/Unstructured: 52.17% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 144 Family Scaffolds |
|---|---|---|
| PF03237 | Terminase_6N | 6.25 |
| PF04014 | MazE_antitoxin | 1.39 |
| PF00124 | Photo_RC | 0.69 |
| PF14890 | Intein_splicing | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.94 % |
| All Organisms | root | All Organisms | 43.06 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000756|JGI12421J11937_10068824 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1069 | Open in IMG/M |
| 3300001941|GOS2219_1000405 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1990 | Open in IMG/M |
| 3300001961|GOS2240_1055069 | All Organisms → cellular organisms → Bacteria | 1916 | Open in IMG/M |
| 3300003413|JGI25922J50271_10124981 | Not Available | 541 | Open in IMG/M |
| 3300003860|Ga0031658_1088965 | Not Available | 554 | Open in IMG/M |
| 3300005346|Ga0074242_10833938 | Not Available | 1897 | Open in IMG/M |
| 3300005527|Ga0068876_10722116 | Not Available | 531 | Open in IMG/M |
| 3300005612|Ga0070723_10226863 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 860 | Open in IMG/M |
| 3300005613|Ga0074649_1042380 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 2084 | Open in IMG/M |
| 3300006565|Ga0100228_1134750 | Not Available | 656 | Open in IMG/M |
| 3300006639|Ga0079301_1005315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 5248 | Open in IMG/M |
| 3300006734|Ga0098073_1013903 | Not Available | 1295 | Open in IMG/M |
| 3300006734|Ga0098073_1022139 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 943 | Open in IMG/M |
| 3300006734|Ga0098073_1029152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Anabaena | 783 | Open in IMG/M |
| 3300006790|Ga0098074_1071286 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 947 | Open in IMG/M |
| 3300006790|Ga0098074_1099841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Anabaena | 769 | Open in IMG/M |
| 3300006790|Ga0098074_1157360 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300006810|Ga0070754_10056881 | Not Available | 2043 | Open in IMG/M |
| 3300006810|Ga0070754_10314584 | Not Available | 699 | Open in IMG/M |
| 3300006874|Ga0075475_10031833 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 2547 | Open in IMG/M |
| 3300006919|Ga0070746_10105299 | Not Available | 1403 | Open in IMG/M |
| 3300006928|Ga0098041_1152110 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300007134|Ga0101663_1062367 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 636 | Open in IMG/M |
| 3300007346|Ga0070753_1125071 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 987 | Open in IMG/M |
| 3300007538|Ga0099851_1062683 | Not Available | 1449 | Open in IMG/M |
| 3300007538|Ga0099851_1336321 | Not Available | 528 | Open in IMG/M |
| 3300007539|Ga0099849_1243906 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 662 | Open in IMG/M |
| 3300007541|Ga0099848_1114120 | Not Available | 1026 | Open in IMG/M |
| 3300007541|Ga0099848_1124108 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 973 | Open in IMG/M |
| 3300007541|Ga0099848_1154198 | Not Available | 848 | Open in IMG/M |
| 3300007541|Ga0099848_1267306 | Not Available | 594 | Open in IMG/M |
| 3300007541|Ga0099848_1268646 | Not Available | 592 | Open in IMG/M |
| 3300007544|Ga0102861_1044650 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1145 | Open in IMG/M |
| 3300007960|Ga0099850_1119879 | Not Available | 1074 | Open in IMG/M |
| 3300007960|Ga0099850_1246939 | Not Available | 689 | Open in IMG/M |
| 3300007960|Ga0099850_1314017 | Not Available | 593 | Open in IMG/M |
| 3300007973|Ga0105746_1273831 | Not Available | 583 | Open in IMG/M |
| 3300008111|Ga0114344_1121621 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 924 | Open in IMG/M |
| 3300008116|Ga0114350_1012276 | Not Available | 3775 | Open in IMG/M |
| 3300008120|Ga0114355_1105333 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1098 | Open in IMG/M |
| 3300009001|Ga0102963_1416405 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → unclassified Balneolaceae → Balneolaceae bacterium | 527 | Open in IMG/M |
| 3300009146|Ga0105091_10542863 | Not Available | 595 | Open in IMG/M |
| 3300009158|Ga0114977_10279935 | Not Available | 955 | Open in IMG/M |
| 3300009169|Ga0105097_10562728 | Not Available | 640 | Open in IMG/M |
| 3300010296|Ga0129348_1132782 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 867 | Open in IMG/M |
| 3300010297|Ga0129345_1243115 | Not Available | 630 | Open in IMG/M |
| 3300010297|Ga0129345_1350182 | Not Available | 508 | Open in IMG/M |
| 3300010299|Ga0129342_1278539 | Not Available | 578 | Open in IMG/M |
| 3300010318|Ga0136656_1071215 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1236 | Open in IMG/M |
| 3300010318|Ga0136656_1267379 | Not Available | 560 | Open in IMG/M |
| 3300010354|Ga0129333_10872929 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 763 | Open in IMG/M |
| 3300010354|Ga0129333_10993489 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 706 | Open in IMG/M |
| 3300010354|Ga0129333_11552757 | Not Available | 541 | Open in IMG/M |
| 3300010354|Ga0129333_11752188 | Not Available | 504 | Open in IMG/M |
| 3300010368|Ga0129324_10302349 | Not Available | 629 | Open in IMG/M |
| 3300010368|Ga0129324_10305009 | Not Available | 626 | Open in IMG/M |
| 3300010370|Ga0129336_10509523 | Not Available | 648 | Open in IMG/M |
| 3300010370|Ga0129336_10791740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | 500 | Open in IMG/M |
| 3300010430|Ga0118733_100396775 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 2733 | Open in IMG/M |
| 3300011118|Ga0114922_11530159 | Not Available | 536 | Open in IMG/M |
| 3300012920|Ga0160423_10128967 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1781 | Open in IMG/M |
| 3300012950|Ga0163108_10286386 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1060 | Open in IMG/M |
| 3300014050|Ga0119952_1017802 | Not Available | 2470 | Open in IMG/M |
| 3300016791|Ga0182095_1908101 | Not Available | 635 | Open in IMG/M |
| 3300017721|Ga0181373_1064185 | Not Available | 659 | Open in IMG/M |
| 3300017733|Ga0181426_1097722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | 589 | Open in IMG/M |
| 3300017739|Ga0181433_1013281 | Not Available | 2243 | Open in IMG/M |
| 3300017766|Ga0181343_1157750 | Not Available | 631 | Open in IMG/M |
| 3300017784|Ga0181348_1182431 | Not Available | 764 | Open in IMG/M |
| 3300017788|Ga0169931_10134997 | Not Available | 2256 | Open in IMG/M |
| 3300017952|Ga0181583_10376187 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 888 | Open in IMG/M |
| 3300017952|Ga0181583_10451044 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 793 | Open in IMG/M |
| 3300017956|Ga0181580_10783331 | Not Available | 601 | Open in IMG/M |
| 3300017963|Ga0180437_10870892 | Not Available | 648 | Open in IMG/M |
| 3300017990|Ga0180436_11229232 | Not Available | 573 | Open in IMG/M |
| 3300018065|Ga0180430_10328166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | 1041 | Open in IMG/M |
| 3300018426|Ga0181566_10310837 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1138 | Open in IMG/M |
| 3300020179|Ga0194134_10173126 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 954 | Open in IMG/M |
| 3300020196|Ga0194124_10058477 | Not Available | 2364 | Open in IMG/M |
| 3300020214|Ga0194132_10030096 | Not Available | 4893 | Open in IMG/M |
| 3300020214|Ga0194132_10394130 | Not Available | 708 | Open in IMG/M |
| 3300020220|Ga0194119_10022772 | Not Available | 6980 | Open in IMG/M |
| 3300020251|Ga0211700_1024395 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 665 | Open in IMG/M |
| 3300020395|Ga0211705_10059421 | Not Available | 1378 | Open in IMG/M |
| 3300020395|Ga0211705_10076877 | Not Available | 1203 | Open in IMG/M |
| 3300020411|Ga0211587_10288942 | Not Available | 675 | Open in IMG/M |
| 3300020457|Ga0211643_10537912 | Not Available | 574 | Open in IMG/M |
| 3300021091|Ga0194133_10031147 | Not Available | 4968 | Open in IMG/M |
| 3300021368|Ga0213860_10473321 | Not Available | 538 | Open in IMG/M |
| 3300021424|Ga0194117_10189473 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1023 | Open in IMG/M |
| 3300021425|Ga0213866_10173141 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1133 | Open in IMG/M |
| 3300021558|Ga0224704_1067044 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 636 | Open in IMG/M |
| 3300021963|Ga0222712_10611355 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 628 | Open in IMG/M |
| 3300022063|Ga0212029_1057821 | Not Available | 565 | Open in IMG/M |
| 3300022065|Ga0212024_1091676 | Not Available | 541 | Open in IMG/M |
| 3300022068|Ga0212021_1125329 | Not Available | 526 | Open in IMG/M |
| 3300022071|Ga0212028_1020161 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1161 | Open in IMG/M |
| 3300022167|Ga0212020_1092286 | Not Available | 506 | Open in IMG/M |
| 3300022179|Ga0181353_1094661 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → unclassified Balneolaceae → Balneolaceae bacterium | 741 | Open in IMG/M |
| 3300022198|Ga0196905_1167031 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → unclassified Balneolaceae → Balneolaceae bacterium | 561 | Open in IMG/M |
| 3300022200|Ga0196901_1055629 | Not Available | 1466 | Open in IMG/M |
| 3300022200|Ga0196901_1161308 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → unclassified Balneolaceae → Balneolaceae bacterium | 740 | Open in IMG/M |
| 3300022407|Ga0181351_1204505 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 656 | Open in IMG/M |
| 3300022407|Ga0181351_1262099 | Not Available | 531 | Open in IMG/M |
| 3300023175|Ga0255777_10580585 | Not Available | 561 | Open in IMG/M |
| 3300024262|Ga0210003_1212663 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 785 | Open in IMG/M |
| 3300024289|Ga0255147_1109298 | Not Available | 505 | Open in IMG/M |
| (restricted) 3300024340|Ga0255042_10130224 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → unclassified Balneolaceae → Balneolaceae bacterium | 734 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10487646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | 590 | Open in IMG/M |
| 3300025057|Ga0208018_115451 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 968 | Open in IMG/M |
| 3300025057|Ga0208018_121917 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 741 | Open in IMG/M |
| 3300025057|Ga0208018_135362 | Not Available | 504 | Open in IMG/M |
| 3300025093|Ga0208794_1072206 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → unclassified Balneolaceae → Balneolaceae bacterium | 603 | Open in IMG/M |
| 3300025151|Ga0209645_1146014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp. | 732 | Open in IMG/M |
| 3300025674|Ga0208162_1022706 | Not Available | 2393 | Open in IMG/M |
| 3300025674|Ga0208162_1149269 | Not Available | 642 | Open in IMG/M |
| 3300027693|Ga0209704_1222688 | Not Available | 551 | Open in IMG/M |
| 3300027782|Ga0209500_10047664 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 2306 | Open in IMG/M |
| 3300027785|Ga0209246_10405752 | Not Available | 511 | Open in IMG/M |
| 3300027793|Ga0209972_10341821 | Not Available | 649 | Open in IMG/M |
| 3300027797|Ga0209107_10027387 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 3274 | Open in IMG/M |
| 3300027816|Ga0209990_10476251 | Not Available | 531 | Open in IMG/M |
| 3300027899|Ga0209668_10117709 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1570 | Open in IMG/M |
| 3300027974|Ga0209299_1222272 | Not Available | 683 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1249898 | Not Available | 640 | Open in IMG/M |
| 3300029635|Ga0135217_107053 | Not Available | 667 | Open in IMG/M |
| 3300031565|Ga0307379_10204040 | Not Available | 2020 | Open in IMG/M |
| 3300031578|Ga0307376_10321161 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1030 | Open in IMG/M |
| 3300031669|Ga0307375_10705527 | Not Available | 581 | Open in IMG/M |
| 3300031787|Ga0315900_10258189 | Not Available | 1481 | Open in IMG/M |
| 3300031857|Ga0315909_10700568 | Not Available | 657 | Open in IMG/M |
| 3300032093|Ga0315902_10106453 | Not Available | 3024 | Open in IMG/M |
| 3300032093|Ga0315902_10247164 | Not Available | 1739 | Open in IMG/M |
| 3300032156|Ga0315295_12023956 | Not Available | 540 | Open in IMG/M |
| 3300034012|Ga0334986_0150542 | Not Available | 1343 | Open in IMG/M |
| 3300034012|Ga0334986_0248799 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 967 | Open in IMG/M |
| 3300034019|Ga0334998_0165773 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1402 | Open in IMG/M |
| 3300034061|Ga0334987_0390233 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 886 | Open in IMG/M |
| 3300034061|Ga0334987_0569984 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 674 | Open in IMG/M |
| 3300034062|Ga0334995_0615060 | Not Available | 628 | Open in IMG/M |
| 3300034073|Ga0310130_0011011 | Not Available | 3154 | Open in IMG/M |
| 3300034101|Ga0335027_0697678 | Not Available | 603 | Open in IMG/M |
| 3300034102|Ga0335029_0267356 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1096 | Open in IMG/M |
| 3300034102|Ga0335029_0717392 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → unclassified Balneolaceae → Balneolaceae bacterium | 540 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 18.06% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 9.72% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 9.03% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.64% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 6.94% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.86% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 4.17% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.47% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.78% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 2.78% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.08% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.08% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.08% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 2.08% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 2.08% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.39% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.39% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.39% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 1.39% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.39% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.39% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 1.39% |
| C. Singaporensis (Marine Sponge) | Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → C. Singaporensis (Marine Sponge) | 1.39% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.69% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.69% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.69% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.69% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.69% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.69% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.69% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.69% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.69% |
| Marine Harbor | Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor | 0.69% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.69% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.69% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300001941 | Marine microbial communities from Browns Bank, Gulf of Maine - GS003 | Environmental | Open in IMG/M |
| 3300001961 | Marine microbial communities from Dirty Rock, Cocos Island, Costa Rica - GS025 | Environmental | Open in IMG/M |
| 3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
| 3300003860 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL | Environmental | Open in IMG/M |
| 3300005346 | Saline sediment microbial community from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005612 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 | Environmental | Open in IMG/M |
| 3300005613 | Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment | Environmental | Open in IMG/M |
| 3300006565 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_2_0125m | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006734 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006790 | Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300007134 | Marine sponge C. singaporensis microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'control', co6ic19 | Host-Associated | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012950 | Marine microbial communities from the Central Pacific Ocean - Fk160115 155m metaG | Environmental | Open in IMG/M |
| 3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
| 3300016791 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
| 3300017990 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_S_2 metaG | Environmental | Open in IMG/M |
| 3300018065 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_S_2 metaG | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
| 3300020196 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m | Environmental | Open in IMG/M |
| 3300020214 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015054 Kigoma Offshore 80m | Environmental | Open in IMG/M |
| 3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020251 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555940-ERR599040) | Environmental | Open in IMG/M |
| 3300020395 | Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX555987-ERR599133) | Environmental | Open in IMG/M |
| 3300020411 | Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556098-ERR599130) | Environmental | Open in IMG/M |
| 3300020457 | Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014) | Environmental | Open in IMG/M |
| 3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021558 | Marine sponge C. singaporensis microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'control', co6ic19 200bp no Eukaryotes last | Host-Associated | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022071 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2) | Environmental | Open in IMG/M |
| 3300022167 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2) | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023175 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024340 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_5 | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300025057 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025093 | Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
| 3300029635 | Marine harbor viral communities from the Indian Ocean - SMH2 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12421J11937_100688244 | 3300000756 | Freshwater And Sediment | SNKDRKGLLMAGADQAIRELLTIFKDDPIEGPLHEASMSIWAKMQLSE* |
| GOS2219_10004055 | 3300001941 | Marine | FS*SQGLLMAGADRALREVASIFKDDPIEGPLQEASMSVWARMQFED* |
| GOS2240_10550694 | 3300001961 | Marine | TNMRDRKGLLMAGADRAIRELMFVFKDDPIETPLEEASMSVWARMQLEE* |
| JGI25922J50271_101249813 | 3300003413 | Freshwater Lake | DRKGLLMAGADRAIRELLTIFKDDPIEVPLEEASMSVWSHMQMEE* |
| Ga0031658_10889653 | 3300003860 | Freshwater Lake Sediment | DLFTGNKDRKGLLMAGADRAIRELLTIFKDDPIEVPLEEASMSVWSHMQMEE* |
| Ga0074242_108339384 | 3300005346 | Saline Water And Sediment | MAGADRAIRELMFIFKDDPIEIPLEEATMSVWARMQLEE* |
| Ga0068876_107221161 | 3300005527 | Freshwater Lake | GTIAQLDLFTSSRDRKGLLMAGADRAIRELVFIFKDDPIEIPLHEASMSVWARMQLEE* |
| Ga0070723_102268634 | 3300005612 | Marine Sediment | RAIRELNSVFKDDPIEGPLQEAAMSVWARIQFED* |
| Ga0074649_10423801 | 3300005613 | Saline Water And Sediment | DRALRELGAIFKDDPIEGPLQEASMSVWAKIQYED* |
| Ga0100228_11347502 | 3300006565 | Marine | GILMAGADRAIRELMFIFKDDPIEIPLEEATMSVWARMQLEE* |
| Ga0079301_10053157 | 3300006639 | Deep Subsurface | GLLMAGADRAIRELMFIFKDDPIEIPLEEATMSVWSRMQLEE* |
| Ga0098073_10139031 | 3300006734 | Marine | MAGADRAMREIISIFRDDPIEGPLHEASMSVWARIQYEED* |
| Ga0098073_10221393 | 3300006734 | Marine | DRAIRELLAIFKDDPISIPLEEASMAVWARMQLEE* |
| Ga0098073_10291521 | 3300006734 | Marine | SFVSSRDRKGLLMAGADRAMREIISIFRDDPIEGPLHEASMSVWARIQYEED* |
| Ga0098074_10712863 | 3300006790 | Marine | GADRAIRELLAIFKDDPISIPLEEASMAVWARMQLEE* |
| Ga0098074_10998413 | 3300006790 | Marine | KGLLMAGADRAIRELLTIFKDDPIEVPLEEASMSVWAHMQLEE* |
| Ga0098074_11573601 | 3300006790 | Marine | IDQIEKFTNIKDRKGMLMAGADRAIRELMFIFKDDPIEIPLEEASMSVWTRMQLEE* |
| Ga0070754_100568816 | 3300006810 | Aqueous | RAIRELLAIFKDDPISIPLEEASMAVWARMQLEE* |
| Ga0070754_103145841 | 3300006810 | Aqueous | ADRAIRELMAIFKDDPIEIPLEEATMSVWAKMQLEE* |
| Ga0075475_100318335 | 3300006874 | Aqueous | LLMAGADRALRELGAIFKDDPVEGPLQEASMSVWAKIQFEE* |
| Ga0070746_101052994 | 3300006919 | Aqueous | LMAGADRAIRELMFIFKDDPIEIPLEEATMSVWARMQLEE* |
| Ga0098041_11521103 | 3300006928 | Marine | LLMAGADRAIRELMFIFKDDPIEIPLEEATMSVWARMQLEE* |
| Ga0101663_10623672 | 3300007134 | C. Singaporensis (Marine Sponge) | KGLLMAGADRAIRELMFIFKDDPIETPLEEATMSVWARMQLEE* |
| Ga0070753_11250713 | 3300007346 | Aqueous | GADRALRELLTIFKDDPIEYPLEEASMSVWAKMQYEDS* |
| Ga0099851_10626831 | 3300007538 | Aqueous | MAGADRAIRELMFIFKDDPIESPLEEASMAVWSRMQLEE* |
| Ga0099851_13363211 | 3300007538 | Aqueous | ALKDRKGLLMAGADRAIRELMFIFKDDPIEIPLEEATMSVWARMQLEE* |
| Ga0099849_12439063 | 3300007539 | Aqueous | RKGLLMAGADQAIRELLTIFKDDPIEGPLHEASMSIWAKMQLSE* |
| Ga0099848_11141201 | 3300007541 | Aqueous | KGLLMAGADRAIRELMFIFKDDPIEIPLEEATMSVWARMQLEE* |
| Ga0099848_11241081 | 3300007541 | Aqueous | GADRALRELQIIFKDDPIEIPLEEASMSIWAKMQYDDS* |
| Ga0099848_11541981 | 3300007541 | Aqueous | ADRAIRELMFIFKDDPIEIPLEEATMSVWARMQLEE* |
| Ga0099848_12673063 | 3300007541 | Aqueous | LMAGADRAIRELLTIFKDDPIEVPLEEASMSVWAHMQLEE* |
| Ga0099848_12686461 | 3300007541 | Aqueous | IEQFTTTRDRKGLLMAGADRAIRELLFVFKDDPIEIPLSEASMSVWARMQLEE* |
| Ga0102861_10446504 | 3300007544 | Estuarine | FVSSKDRKGLLLAGADRAIRELNSVFKDDPIEGPLQEAAMSVWARIQFED* |
| Ga0099850_11198791 | 3300007960 | Aqueous | EQFTSARDRKGLLMAGADRAIRELMFVFKDDPIEGPLNEASMSVWARMQLEE* |
| Ga0099850_12469392 | 3300007960 | Aqueous | GADRAVRELLFVFKDDPIEIPLNEASMSVWARMQLEE* |
| Ga0099850_13140171 | 3300007960 | Aqueous | LMAGADRALRELLTIFKDDPIEYPLEEASMSVWAKMQYEDS* |
| Ga0105746_12738311 | 3300007973 | Estuary Water | LLMAGADRAIRELLTIFKDDPIEIPLEEASMSVWSHMQMEE* |
| Ga0114344_11216214 | 3300008111 | Freshwater, Plankton | RKGLLMAGADRAIREILSVFKDDPIEIPLEEASMSVWAHMQLEE* |
| Ga0114350_10122769 | 3300008116 | Freshwater, Plankton | RAIREILSVFKDDPIEIPLEEASMSVWAHMQLEE* |
| Ga0114355_11053334 | 3300008120 | Freshwater, Plankton | GADRAIRELLTIFKDDPIEVPLEEASMSVWSHMQMEE* |
| Ga0102963_14164053 | 3300009001 | Pond Water | AGADRAIRELMFIFKDDPIESPLEEASMAVWSRMQLEE* |
| Ga0105091_105428632 | 3300009146 | Freshwater Sediment | RAIRELVFIFKDDPIEIPLHEASMSVWARMQLEE* |
| Ga0114977_102799354 | 3300009158 | Freshwater Lake | ADRAIRELAFIFKDDPIEGPLKEAAMSVWARMQLEE* |
| Ga0105097_105627281 | 3300009169 | Freshwater Sediment | RGTIAQIDTFTSTRDRKGLLMAGADRAIRELMCIFKDDPIEAPLLEASMSVWAKMQLDE* |
| Ga0129348_11327821 | 3300010296 | Freshwater To Marine Saline Gradient | KDRKGLLMAGADRAIRELMFIFKDDPIEIPLEEATMSVWARMQLEE* |
| Ga0129345_12431151 | 3300010297 | Freshwater To Marine Saline Gradient | ELRGAIAQIEQFTTSRDRKGLLMAGADRAIRELLFVFKDDPIEIPLNEASMSVWARMQLEE* |
| Ga0129345_13501821 | 3300010297 | Freshwater To Marine Saline Gradient | KDRKGLLMAGADRAIRELLTIFKDDPIEVPLEEASMSVWSHMQMEE* |
| Ga0129342_12785391 | 3300010299 | Freshwater To Marine Saline Gradient | KGLLMAGADQAIRELLMIFKDDPIEAPLQEASMSVWAKMQLSE* |
| Ga0136656_10712151 | 3300010318 | Freshwater To Marine Saline Gradient | KGLLMAGADRAIRELMFIFKDDPIEIPLEEATMSVWSRMQLEE* |
| Ga0136656_12673793 | 3300010318 | Freshwater To Marine Saline Gradient | RKGLLMAGADRAIRELLTIFKDDPIEVPLEEASMSVWSHMQMEE* |
| Ga0129333_108729291 | 3300010354 | Freshwater To Marine Saline Gradient | DRAIRELMAIFKDDPIELPLEEASMSVWAKMQYEER* |
| Ga0129333_109934891 | 3300010354 | Freshwater To Marine Saline Gradient | KGLLMAGADRAIRELMFIFKDDPIEAPLHEATMSVWARMQLEE* |
| Ga0129333_115527572 | 3300010354 | Freshwater To Marine Saline Gradient | GLLMAGADRAIRELLTIFKDDPIEVPLEEASMSVWAHMQLEE* |
| Ga0129333_117521881 | 3300010354 | Freshwater To Marine Saline Gradient | LLMAGADRAIRELMFIFKDDPIEGPLQEASMSVWARMQLEE* |
| Ga0129324_103023492 | 3300010368 | Freshwater To Marine Saline Gradient | IKDRKGLLMAGADRAIRELMFIFKDDPIEIPLEEATMSVWARMQLEE* |
| Ga0129324_103050092 | 3300010368 | Freshwater To Marine Saline Gradient | MAGADRAIRELLTIFKDDPIEYPLEEASMSVWAHMQLEE* |
| Ga0129336_105095231 | 3300010370 | Freshwater To Marine Saline Gradient | ADRAIRELMVIFKDDPIEIPLEEASMSIWAKMQLDE* |
| Ga0129336_107917403 | 3300010370 | Freshwater To Marine Saline Gradient | RAIRELLAVFKDDPIEIPLEEASMSVWAKIQFDEG* |
| Ga0118733_1003967757 | 3300010430 | Marine Sediment | AGADRAIRELNSVFKDDPIEGPLQEAAMSVWARIQFED* |
| Ga0114922_115301593 | 3300011118 | Deep Subsurface | LLMAGADRAIRELMLIFKDDPIESPLNEASLSVWAKMQFED* |
| Ga0160423_101289671 | 3300012920 | Surface Seawater | GLLLAGADRAIREMLSIFKDDPIEGPLEEASMSVWAKIQFEDT* |
| Ga0163108_102863861 | 3300012950 | Seawater | DRKGLLMAGADRAIRELMFIFKDDPIEIPLEEATMSVWARMQLEE* |
| Ga0119952_10178021 | 3300014050 | Freshwater | PSTKDRGVLVVAGAGGAIRELLMIFKDDPYEGPLEEASMSVWSRMQLEE* |
| Ga0182095_19081013 | 3300016791 | Salt Marsh | ADRAIRELMFIFKDDPIEIPLEEATMSVWSRMQLEE |
| Ga0181373_10641851 | 3300017721 | Marine | ELRGTIAQVEEFTNNRDRKGLLMAGADRAIRELMQVFKDDPIEIPLEEATMSVWAKMQLE |
| Ga0181426_10977221 | 3300017733 | Seawater | IAQVDAFVSSKDRKGLLLAGADRAIRELNSVFKDDPIEGPLQEAAMSVWARIQFEE |
| Ga0181433_10132811 | 3300017739 | Seawater | KGLLMAGAERAIRELMFIFRDDPIESPLEEATMSVWARMQLEE |
| Ga0181343_11577504 | 3300017766 | Freshwater Lake | ADRAIRELLTIFKDDPIEVPLEEASMSVWSHMQMEE |
| Ga0181348_11824313 | 3300017784 | Freshwater Lake | LMAGADRAIRELMFIFKDDPIEIPLEEATMSVWARMQLEE |
| Ga0169931_101349974 | 3300017788 | Freshwater | MAGADRAIRELMFIFKDDPIEIPLEEATMSVWARMQIEE |
| Ga0181583_103761873 | 3300017952 | Salt Marsh | DRKGLLMAGADRAIRELMFIFKDDPIEIPLEEATMSVWARMQLEE |
| Ga0181583_104510443 | 3300017952 | Salt Marsh | GADRAIRELITIFKDDPIEIPLEEASMSVWSHMQLEE |
| Ga0181580_107833311 | 3300017956 | Salt Marsh | LMAGADRAIRELMFIFKDDPIESPLEEASMSVWARMQLEE |
| Ga0180437_108708921 | 3300017963 | Hypersaline Lake Sediment | GADRAMREILFVFKDDPMESPLEEASLSVWARMQMEE |
| Ga0180436_112292321 | 3300017990 | Hypersaline Lake Sediment | RKGLLMAGADRAMREILFVFKDDPMESPLEEASLSVWARMQMEE |
| Ga0180430_103281664 | 3300018065 | Hypersaline Lake Sediment | GADRALRELSAIFKDDPIEGPLQEASMSVWAKLQYED |
| Ga0181566_103108371 | 3300018426 | Salt Marsh | GLLMAGADRAIRELMFIFKDDPIEIPLEEATMSVWSRMQLEE |
| Ga0194134_101731263 | 3300020179 | Freshwater Lake | VKDRKGLLMAGADRAIRELMFIFKDDPIESPLHEASMSVWARMQLEE |
| Ga0194124_100584776 | 3300020196 | Freshwater Lake | PGADRAIRELMFIFKDDPIEGPLQEASMSVWARMQLEE |
| Ga0194132_100300968 | 3300020214 | Freshwater Lake | GTINQVEQYTSVKDRKGLLMAGADRAIRELMFIFKDDPIESPLHEASMSVWARMQLEE |
| Ga0194132_103941301 | 3300020214 | Freshwater Lake | KGLLMAGADRAIRELMFIFKDDPIEGPLQEASMSVWARMQLEE |
| Ga0194119_1002277210 | 3300020220 | Freshwater Lake | SFTSSKDRKGLLMAGADRAIRELMFIFKDDPIEGPLQEASMSVWARMQLEE |
| Ga0211700_10243951 | 3300020251 | Marine | GADRAIRELMFIFKDDPIETPLEEATMSVWARMQLEE |
| Ga0211705_100594214 | 3300020395 | Marine | NTKDRKGILMAGADRAIRELMFIFKDDPIEIPLEEATMSVWARMQLEE |
| Ga0211705_100768773 | 3300020395 | Marine | GADRAIRELMFIFKDDPIEIPLEEATMSVWARMQLEE |
| Ga0211587_102889422 | 3300020411 | Marine | DRAIRELMFIFKDDPIEIPLEEATMSVWARMQLEE |
| Ga0211643_105379122 | 3300020457 | Marine | FTNTKDRKGLLMAGADRAVRELMFIFKDDPIEIPLEEATMSVWARMQLEE |
| Ga0194133_100311478 | 3300021091 | Freshwater Lake | QVEQYTSVKDRKGLLMAGADRAIRELMFIFKDDPIESPLHEASMSVWARMQLEE |
| Ga0213860_104733212 | 3300021368 | Seawater | DRAIRELITIFKDDPIEIPLEEASMSVWSHMQLEE |
| Ga0194117_101894734 | 3300021424 | Freshwater Lake | IAQVENYTANKDRKGLLMAGADQAIRELLMIFKDDPIEGPLQEASMSVWAKMQLSE |
| Ga0213866_101731411 | 3300021425 | Seawater | RKGLLMAGADRAIRELMFIFKDDPIEIPLEEATMSVWSRMQLEE |
| Ga0224704_10670442 | 3300021558 | C. Singaporensis (Marine Sponge) | KGLLMAGADRAIRELMFIFKDDPIETPLEEATMSVWARMQLEE |
| Ga0222712_106113553 | 3300021963 | Estuarine Water | GADRAIRELMFIFKDDPIEGPLEEASMSVWARMQLEE |
| Ga0212029_10578213 | 3300022063 | Aqueous | KFTSIKDRKGLLMAGADRAIRELMFIFKDDPIEIPLEEATMSVWARMQLEE |
| Ga0212024_10916762 | 3300022065 | Aqueous | KDRKGLLMAGADRAIRELITIFKDDPIEIPLEEASMSVWSHMQLEE |
| Ga0212021_11253292 | 3300022068 | Aqueous | DRAIRELMAIFKDDPIEIPLEEATMSVWAKMQLEE |
| Ga0212028_10201611 | 3300022071 | Aqueous | GLLLAGADRAIRELLAIFKDDPISIPLEEASMAVWARMQLEE |
| Ga0212020_10922862 | 3300022167 | Aqueous | RGAIAQVEEFTGMKDRKGLLMAGADRAIRELMFIFKDDPIEIPLEEATMSVWSRMQLEE |
| Ga0181353_10946613 | 3300022179 | Freshwater Lake | LLMAGADRALRELQIIFKDDPIEIPLEEASMSIWAKMQYEDS |
| Ga0196905_11670311 | 3300022198 | Aqueous | DKKGLLMAGADRALRELLSIFKDEPIEGPLQDASMSVWAKMQLSE |
| Ga0196901_10556291 | 3300022200 | Aqueous | ADQAIRELLMIFKDDPIEAPLQEASMSVWAKMQLNE |
| Ga0196901_11613081 | 3300022200 | Aqueous | GLLMAGADRAIRELLTIFKDDPIEVPLEEASMSVWAHMQLEE |
| Ga0181351_12045051 | 3300022407 | Freshwater Lake | RKGLLMAGADRAIRELMFIFKDDPIEIPLEEATMSVWARMQLEE |
| Ga0181351_12620992 | 3300022407 | Freshwater Lake | LMAGADRAIRELAFIFKDDPIEGPLKEAAMSVWARMQLEE |
| Ga0255777_105805853 | 3300023175 | Salt Marsh | GLLMAGADRAIRELMFIFKDGPIEIPLEEATMSVWSRMQLEE |
| Ga0210003_12126634 | 3300024262 | Deep Subsurface | TSNKDRKGLLMAGADQAIRELLTIFKDDPIEGPLHEASMSIWAKMQLSE |
| Ga0255147_11092981 | 3300024289 | Freshwater | LMAGADRAIRELMFIFKDDPIEGPLEEATMSVWSRMQLEE |
| (restricted) Ga0255042_101302241 | 3300024340 | Seawater | LAGADRAIRELNSVFKDDPIEGPLQEAAMSVWARIQFED |
| (restricted) Ga0255046_104876461 | 3300024519 | Seawater | QVDAFVSSKDRKGLLLAGADRAIRELNSVFKDDPIEGPLQEAAMSVWARIQFED |
| Ga0208018_1154511 | 3300025057 | Marine | TNIKDRKGMLMAGADRAIRELMFIFKDDPIEIPLEEASMSVWTRMQLEE |
| Ga0208018_1219171 | 3300025057 | Marine | GADRAMREIISIFRDDPIEGPLHEASMSVWARIQYEED |
| Ga0208018_1353621 | 3300025057 | Marine | KSLIMAGADKAIRELCAIFKDDVFEAPLHEASLSVWAKLQFED |
| Ga0208794_10722063 | 3300025093 | Marine | LLIGADRAIREMISIFKDDPIEGPLQEAAMSVWAKIQYEE |
| Ga0209645_11460141 | 3300025151 | Marine | ADRALRELTSVFKDDPIEGPLSEAGMSIWAKIQFEE |
| Ga0208162_10227061 | 3300025674 | Aqueous | MAGADRAIRELMFIFKDDPIESPLEEASMAVWSRMQLEE |
| Ga0208162_11492691 | 3300025674 | Aqueous | ADRAIRELMFIFKDDPIEIPLEEATMSVWARMQLEE |
| Ga0209704_12226881 | 3300027693 | Freshwater Sediment | DRAIRELVFIFKDDPIEIPLHEASMSVWARMQLEE |
| Ga0209500_100476641 | 3300027782 | Freshwater Lake | SYTSNKDRKGLLMAGADQAIRELLTIFKDDPIEGPLHEASMSIWAKMQLSE |
| Ga0209246_104057521 | 3300027785 | Freshwater Lake | DRKGLLMAGADRAIRELAFIFKDDPIEGPLKEAAMSVWARMQLEE |
| Ga0209972_103418211 | 3300027793 | Freshwater Lake | AGADRALRELQIIFKDDPIEIPLEEASMSIWAKMQYEDS |
| Ga0209107_100273877 | 3300027797 | Freshwater And Sediment | LLMAGADQAIRELLTIFKDDPIEGPLHEASMSIWAKMQLSE |
| Ga0209990_104762511 | 3300027816 | Freshwater Lake | GTIAQLDLFTSSRDRKGLLMAGADRAIRELVFIFKDDPIEIPLHEASMSVWARMQLEE |
| Ga0209668_101177091 | 3300027899 | Freshwater Lake Sediment | ADRAMRELMAIFKDDPIEGPLHEASMSVWAKMQLDE |
| Ga0209299_12222724 | 3300027974 | Freshwater Lake | DRAMREVAFIFKDDPIEAPLEEAIMSVWARMQLEE |
| (restricted) Ga0247843_12498983 | 3300028569 | Freshwater | KFTSIKDRKGLLMAGADRAIRELMFIFKDDPIEIPLEEATMSVWSRMQLEE |
| Ga0135217_1070532 | 3300029635 | Marine Harbor | LFQLFPSHDPMKDRKGLLMAGADRAIRELMFIFKDDPIEIPLEEATMSVWARMQLEE |
| Ga0307379_102040401 | 3300031565 | Soil | GLLMAGADRAVRELLFIFKDDPIEAPLNEASMSVWARMQLEE |
| Ga0307376_103211614 | 3300031578 | Soil | ADRAIRELMLIFKDDPIESPLNEASLSVWAKMQFED |
| Ga0307375_107055271 | 3300031669 | Soil | NIKDRKGMLMAGADRAIRELMFIFKDDPIEIPLEEASMSVWTRMQLEE |
| Ga0315900_102581894 | 3300031787 | Freshwater | IDTFTSTRDRKGLLMAGADRAIRELMCIFKDDPIEAPLLEASMSVWAKMQLDE |
| Ga0315909_107005681 | 3300031857 | Freshwater | MAGADRALRELQIIFKDDPIEIPLEEASMSIWAKMQYEDS |
| Ga0315902_101064538 | 3300032093 | Freshwater | AGADRAIREILSVFKDDPIEIPLEEASMSVWAHMQLEE |
| Ga0315902_102471641 | 3300032093 | Freshwater | IAQIDAFTSTRDRKGLLMAGADRAIRELMCIFKDDPIEAPLLEASMSVWAKMQLDE |
| Ga0315295_120239561 | 3300032156 | Sediment | NKDRKGLLMAGADRAIRELAFIFKDDPIEGPLKEAAMSVWARMQLEE |
| Ga0334986_0150542_1228_1341 | 3300034012 | Freshwater | GADRAIRELMCIFKDDPIEAPLLEASMSVWAKMQLDE |
| Ga0334986_0248799_2_169 | 3300034012 | Freshwater | AQVELFTANRDRKGLLMAGADRAIRELLSVFKDDPIEIPLEEAAMSVWAKMQLDE |
| Ga0334998_0165773_6_125 | 3300034019 | Freshwater | MAGADRAIRELMFIFKDDPIEIPLEEATMSVWARMQLEE |
| Ga0334987_0390233_4_123 | 3300034061 | Freshwater | MAGADRAIRELMVIFKDDPIEIPLEEASMSIWAKMQLDE |
| Ga0334987_0569984_3_116 | 3300034061 | Freshwater | GADRAIRELLSIFKDDPIEIPLEEASMSVWSRMQLEE |
| Ga0334995_0615060_17_136 | 3300034062 | Freshwater | MAGADRAIRELMFIFKDDPIEVPLEEATLSVWARMQLEE |
| Ga0310130_0011011_2982_3152 | 3300034073 | Fracking Water | INQVESYTIVKDRKGLLMAGADQAIRELLAVFKDDPIEGPLQEASMSVWAKMQLNE |
| Ga0335027_0697678_491_601 | 3300034101 | Freshwater | ADRAIRELMVIFKDDPIEIPLEEASMSIWAKMQLDE |
| Ga0335029_0267356_965_1084 | 3300034102 | Freshwater | MAGADRAIRELLSIFKDDPIEIPLEEASMSVWSRMQLEE |
| Ga0335029_0717392_10_129 | 3300034102 | Freshwater | MAGADRAIRELLSVFKDDPIEIPLEEATMSVWAKMQLDE |
| ⦗Top⦘ |