


| Basic Information | |
|---|---|
| Family ID | F051046 |
| Family Type | Metagenome |
| Number of Sequences | 144 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MYWGHGWGFGAVAALVWLSAVIYLLTLATRLVRAIERIATKFEAKP |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 144 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 84.03 % |
| % of genes near scaffold ends (potentially truncated) | 20.83 % |
| % of genes from short scaffolds (< 2000 bps) | 81.25 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.556 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (38.889 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.583 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (50.694 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.35% β-sheet: 0.00% Coil/Unstructured: 48.65% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 144 Family Scaffolds |
|---|---|---|
| PF05685 | Uma2 | 4.86 |
| PF14559 | TPR_19 | 3.47 |
| PF00196 | GerE | 2.78 |
| PF03544 | TonB_C | 2.78 |
| PF00282 | Pyridoxal_deC | 2.08 |
| PF07786 | HGSNAT_cat | 2.08 |
| PF02265 | S1-P1_nuclease | 2.08 |
| PF00753 | Lactamase_B | 2.08 |
| PF13432 | TPR_16 | 1.39 |
| PF12802 | MarR_2 | 1.39 |
| PF00127 | Copper-bind | 1.39 |
| PF03781 | FGE-sulfatase | 1.39 |
| PF11138 | DUF2911 | 1.39 |
| PF00589 | Phage_integrase | 1.39 |
| PF00580 | UvrD-helicase | 1.39 |
| PF00069 | Pkinase | 1.39 |
| PF07883 | Cupin_2 | 1.39 |
| PF02604 | PhdYeFM_antitox | 0.69 |
| PF04307 | YdjM | 0.69 |
| PF13421 | Band_7_1 | 0.69 |
| PF06736 | TMEM175 | 0.69 |
| PF01734 | Patatin | 0.69 |
| PF01979 | Amidohydro_1 | 0.69 |
| PF01401 | Peptidase_M2 | 0.69 |
| PF00571 | CBS | 0.69 |
| PF00892 | EamA | 0.69 |
| PF14235 | DUF4337 | 0.69 |
| PF06347 | SH3_4 | 0.69 |
| PF03372 | Exo_endo_phos | 0.69 |
| PF03965 | Penicillinase_R | 0.69 |
| PF13384 | HTH_23 | 0.69 |
| PF03713 | DUF305 | 0.69 |
| PF01625 | PMSR | 0.69 |
| PF06452 | CBM9_1 | 0.69 |
| PF04545 | Sigma70_r4 | 0.69 |
| PF08447 | PAS_3 | 0.69 |
| PF03959 | FSH1 | 0.69 |
| PF13365 | Trypsin_2 | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 5.56 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 4.86 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 2.78 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 2.08 |
| COG3503 | Uncharacterized membrane protein, DUF1624 family | Function unknown [S] | 2.08 |
| COG0210 | Superfamily I DNA or RNA helicase | Replication, recombination and repair [L] | 1.39 |
| COG1074 | 3’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V) | Replication, recombination and repair [L] | 1.39 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 1.39 |
| COG3973 | DNA helicase IV | Replication, recombination and repair [L] | 1.39 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.69 |
| COG0400 | Predicted esterase | General function prediction only [R] | 0.69 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.69 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.69 |
| COG1988 | Membrane-bound metal-dependent hydrolase YbcI, DUF457 family | General function prediction only [R] | 0.69 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.69 |
| COG3544 | Uncharacterized conserved protein, DUF305 family | Function unknown [S] | 0.69 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 0.69 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.69 |
| COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 0.69 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.69 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.56 % |
| Unclassified | root | N/A | 19.44 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002560|JGI25383J37093_10076274 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1027 | Open in IMG/M |
| 3300002560|JGI25383J37093_10085074 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300002560|JGI25383J37093_10161521 | Not Available | 590 | Open in IMG/M |
| 3300005167|Ga0066672_10764891 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 612 | Open in IMG/M |
| 3300005172|Ga0066683_10456815 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 782 | Open in IMG/M |
| 3300005174|Ga0066680_10402403 | Not Available | 870 | Open in IMG/M |
| 3300005178|Ga0066688_10566072 | Not Available | 730 | Open in IMG/M |
| 3300005179|Ga0066684_10925446 | Not Available | 567 | Open in IMG/M |
| 3300005445|Ga0070708_100360929 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
| 3300005445|Ga0070708_100390477 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
| 3300005445|Ga0070708_101638359 | Not Available | 599 | Open in IMG/M |
| 3300005446|Ga0066686_10042092 | All Organisms → cellular organisms → Bacteria | 2746 | Open in IMG/M |
| 3300005446|Ga0066686_10295527 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1100 | Open in IMG/M |
| 3300005446|Ga0066686_10664002 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300005447|Ga0066689_10264953 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1060 | Open in IMG/M |
| 3300005450|Ga0066682_10256889 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300005454|Ga0066687_10345485 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300005468|Ga0070707_100071337 | All Organisms → cellular organisms → Bacteria | 3347 | Open in IMG/M |
| 3300005468|Ga0070707_100461871 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
| 3300005468|Ga0070707_100490270 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1190 | Open in IMG/M |
| 3300005468|Ga0070707_100824322 | Not Available | 892 | Open in IMG/M |
| 3300005518|Ga0070699_100357943 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
| 3300005518|Ga0070699_100385005 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
| 3300005536|Ga0070697_100599145 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 968 | Open in IMG/M |
| 3300005552|Ga0066701_10495232 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 757 | Open in IMG/M |
| 3300005554|Ga0066661_10415212 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300005555|Ga0066692_10383753 | Not Available | 891 | Open in IMG/M |
| 3300005557|Ga0066704_10357209 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300005586|Ga0066691_10236060 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300005586|Ga0066691_10245349 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1051 | Open in IMG/M |
| 3300005586|Ga0066691_10284226 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300005598|Ga0066706_10835444 | Not Available | 723 | Open in IMG/M |
| 3300005836|Ga0074470_11310202 | Not Available | 766 | Open in IMG/M |
| 3300005888|Ga0075289_1021244 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300005895|Ga0075277_1010548 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1207 | Open in IMG/M |
| 3300006755|Ga0079222_10000209 | All Organisms → cellular organisms → Bacteria | 12210 | Open in IMG/M |
| 3300006796|Ga0066665_11028063 | Not Available | 630 | Open in IMG/M |
| 3300006797|Ga0066659_10752586 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300006797|Ga0066659_11085766 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 669 | Open in IMG/M |
| 3300006797|Ga0066659_11709035 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 531 | Open in IMG/M |
| 3300006800|Ga0066660_11682567 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300006804|Ga0079221_10000003 | All Organisms → cellular organisms → Bacteria | 103386 | Open in IMG/M |
| 3300006804|Ga0079221_10550878 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300006852|Ga0075433_10027596 | All Organisms → cellular organisms → Bacteria | 4817 | Open in IMG/M |
| 3300006871|Ga0075434_100406152 | Not Available | 1383 | Open in IMG/M |
| 3300006903|Ga0075426_10515754 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 889 | Open in IMG/M |
| 3300007255|Ga0099791_10109727 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300007255|Ga0099791_10397355 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 663 | Open in IMG/M |
| 3300007258|Ga0099793_10129615 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
| 3300009012|Ga0066710_101025603 | Not Available | 1274 | Open in IMG/M |
| 3300009012|Ga0066710_101773654 | Not Available | 934 | Open in IMG/M |
| 3300009088|Ga0099830_10517420 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 974 | Open in IMG/M |
| 3300009088|Ga0099830_11715025 | Not Available | 524 | Open in IMG/M |
| 3300009089|Ga0099828_11754465 | Not Available | 545 | Open in IMG/M |
| 3300009089|Ga0099828_12021055 | Not Available | 504 | Open in IMG/M |
| 3300009090|Ga0099827_10294606 | All Organisms → cellular organisms → Bacteria | 1372 | Open in IMG/M |
| 3300009137|Ga0066709_101890723 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 831 | Open in IMG/M |
| 3300009143|Ga0099792_10139473 | All Organisms → cellular organisms → Bacteria | 1323 | Open in IMG/M |
| 3300009162|Ga0075423_12618104 | Not Available | 551 | Open in IMG/M |
| 3300010304|Ga0134088_10488949 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 606 | Open in IMG/M |
| 3300010371|Ga0134125_10434068 | All Organisms → cellular organisms → Bacteria | 1456 | Open in IMG/M |
| 3300010396|Ga0134126_11190828 | Not Available | 847 | Open in IMG/M |
| 3300011269|Ga0137392_10361875 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300011269|Ga0137392_10400382 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
| 3300011271|Ga0137393_10116542 | All Organisms → cellular organisms → Bacteria | 2199 | Open in IMG/M |
| 3300012189|Ga0137388_10501260 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1128 | Open in IMG/M |
| 3300012189|Ga0137388_11990899 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300012199|Ga0137383_10647835 | Not Available | 772 | Open in IMG/M |
| 3300012199|Ga0137383_10985458 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300012201|Ga0137365_10090200 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2308 | Open in IMG/M |
| 3300012203|Ga0137399_10816886 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300012206|Ga0137380_10134480 | All Organisms → cellular organisms → Bacteria | 2256 | Open in IMG/M |
| 3300012207|Ga0137381_10887989 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 771 | Open in IMG/M |
| 3300012208|Ga0137376_10637216 | Not Available | 921 | Open in IMG/M |
| 3300012211|Ga0137377_11414083 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300012211|Ga0137377_11861997 | Not Available | 520 | Open in IMG/M |
| 3300012285|Ga0137370_10162371 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1297 | Open in IMG/M |
| 3300012285|Ga0137370_10402496 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 829 | Open in IMG/M |
| 3300012350|Ga0137372_10161081 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1824 | Open in IMG/M |
| 3300012350|Ga0137372_10534669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 868 | Open in IMG/M |
| 3300012354|Ga0137366_10011306 | All Organisms → cellular organisms → Bacteria | 7029 | Open in IMG/M |
| 3300012354|Ga0137366_10050520 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3193 | Open in IMG/M |
| 3300012354|Ga0137366_10722049 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 710 | Open in IMG/M |
| 3300012356|Ga0137371_10681888 | Not Available | 786 | Open in IMG/M |
| 3300012357|Ga0137384_10723199 | Not Available | 808 | Open in IMG/M |
| 3300012359|Ga0137385_10111056 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 2425 | Open in IMG/M |
| 3300012361|Ga0137360_11659577 | Not Available | 544 | Open in IMG/M |
| 3300012532|Ga0137373_10140629 | All Organisms → cellular organisms → Bacteria | 2049 | Open in IMG/M |
| 3300012582|Ga0137358_10123395 | All Organisms → cellular organisms → Bacteria | 1761 | Open in IMG/M |
| 3300012683|Ga0137398_10041109 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2688 | Open in IMG/M |
| 3300012683|Ga0137398_10857707 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300012685|Ga0137397_10038216 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3434 | Open in IMG/M |
| 3300012917|Ga0137395_10120793 | All Organisms → cellular organisms → Bacteria | 1765 | Open in IMG/M |
| 3300012918|Ga0137396_10393171 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1027 | Open in IMG/M |
| 3300012918|Ga0137396_10496680 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 904 | Open in IMG/M |
| 3300012918|Ga0137396_10788290 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB1 → unclassified candidate division KSB1 → candidate division KSB1 bacterium | 699 | Open in IMG/M |
| 3300012918|Ga0137396_10939550 | Not Available | 631 | Open in IMG/M |
| 3300012922|Ga0137394_11270285 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300012925|Ga0137419_11669860 | Not Available | 543 | Open in IMG/M |
| 3300012929|Ga0137404_10048662 | All Organisms → cellular organisms → Bacteria | 3239 | Open in IMG/M |
| 3300012929|Ga0137404_10868007 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 822 | Open in IMG/M |
| 3300012930|Ga0137407_10008958 | All Organisms → cellular organisms → Bacteria | 6986 | Open in IMG/M |
| 3300012930|Ga0137407_10624000 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300012931|Ga0153915_11551035 | Not Available | 775 | Open in IMG/M |
| 3300014154|Ga0134075_10133225 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1059 | Open in IMG/M |
| 3300014157|Ga0134078_10238681 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300015264|Ga0137403_10078015 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3349 | Open in IMG/M |
| 3300017656|Ga0134112_10106460 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1056 | Open in IMG/M |
| 3300018056|Ga0184623_10013240 | All Organisms → cellular organisms → Bacteria | 3587 | Open in IMG/M |
| 3300018071|Ga0184618_10045485 | All Organisms → cellular organisms → Bacteria | 1576 | Open in IMG/M |
| 3300018078|Ga0184612_10363562 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300018431|Ga0066655_10515061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Oscillatoriales incertae sedis → Microseira → Microseira wollei | 794 | Open in IMG/M |
| 3300018433|Ga0066667_11476627 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 600 | Open in IMG/M |
| 3300018468|Ga0066662_10307156 | All Organisms → cellular organisms → Bacteria | 1337 | Open in IMG/M |
| 3300020004|Ga0193755_1000507 | All Organisms → cellular organisms → Bacteria | 11315 | Open in IMG/M |
| 3300020004|Ga0193755_1062895 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1204 | Open in IMG/M |
| 3300020170|Ga0179594_10335519 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 573 | Open in IMG/M |
| 3300021046|Ga0215015_10614041 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 9340 | Open in IMG/M |
| 3300021086|Ga0179596_10202841 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300025922|Ga0207646_10234702 | All Organisms → cellular organisms → Bacteria | 1657 | Open in IMG/M |
| 3300025922|Ga0207646_10318009 | Not Available | 1406 | Open in IMG/M |
| 3300025922|Ga0207646_10568802 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1018 | Open in IMG/M |
| 3300026300|Ga0209027_1028658 | All Organisms → cellular organisms → Bacteria | 2108 | Open in IMG/M |
| 3300026301|Ga0209238_1102173 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 970 | Open in IMG/M |
| 3300026308|Ga0209265_1223921 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 516 | Open in IMG/M |
| 3300026318|Ga0209471_1006915 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6093 | Open in IMG/M |
| 3300026333|Ga0209158_1085799 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
| 3300026524|Ga0209690_1073037 | All Organisms → cellular organisms → Bacteria | 1461 | Open in IMG/M |
| 3300026529|Ga0209806_1326576 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300026537|Ga0209157_1078545 | All Organisms → cellular organisms → Bacteria | 1627 | Open in IMG/M |
| 3300026547|Ga0209156_10433151 | All Organisms → cellular organisms → Bacteria → FCB group | 545 | Open in IMG/M |
| 3300026551|Ga0209648_10015591 | All Organisms → cellular organisms → Bacteria | 6632 | Open in IMG/M |
| 3300026551|Ga0209648_10075739 | All Organisms → cellular organisms → Bacteria | 2821 | Open in IMG/M |
| 3300026555|Ga0179593_1026150 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1684 | Open in IMG/M |
| 3300027725|Ga0209178_1000029 | All Organisms → cellular organisms → Bacteria | 38359 | Open in IMG/M |
| 3300027725|Ga0209178_1269028 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300027765|Ga0209073_10028629 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1708 | Open in IMG/M |
| 3300027765|Ga0209073_10057047 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1297 | Open in IMG/M |
| 3300027875|Ga0209283_10526052 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300027882|Ga0209590_10467211 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300028792|Ga0307504_10461879 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300031720|Ga0307469_10648654 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300031962|Ga0307479_10028700 | All Organisms → cellular organisms → Bacteria | 5295 | Open in IMG/M |
| 3300031962|Ga0307479_10123139 | All Organisms → cellular organisms → Bacteria | 2531 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 38.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 21.53% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 9.03% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.03% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.78% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.78% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.08% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.08% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.39% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.39% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.69% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005888 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 | Environmental | Open in IMG/M |
| 3300005895 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25383J37093_100762742 | 3300002560 | Grasslands Soil | MYWGHGIGILAGLIWLAAVIYLLTLATRLVSAIERIATRFEAKP* |
| JGI25383J37093_100850742 | 3300002560 | Grasslands Soil | MSGMYWGHGWGFGAVAALVWLSAVIYLLTLATRLVRAIERIATKFEAKP* |
| JGI25383J37093_101615212 | 3300002560 | Grasslands Soil | MYWGHGFGGVGYLAGLIWLSAVIYLLTLATRLVRAIERIANKFESKAQ* |
| Ga0066672_107648912 | 3300005167 | Soil | MYWGHGFWGVGYLAGLIWLAAVIYLLTLATRLVRAIERIASKFESKAQ* |
| Ga0066683_104568151 | 3300005172 | Soil | MYWGHGFWGVGYLAGLIWLAAVIYLLTLATRLVRAIERIANKFESKAQ* |
| Ga0066680_104024031 | 3300005174 | Soil | MYWGHGFGGVGYLAGLIWLAAVIYLLTLATRLVRAIERIANKFESKAQ* |
| Ga0066688_105660721 | 3300005178 | Soil | MSGMYWGHGWWFGAVAALVWLSAVIYLLTLATRLVRAIERIATKFEPKP* |
| Ga0066684_109254461 | 3300005179 | Soil | MYWEHGFWGVGLAGLIWLAAVIYLLTLATRLVRAIERIANKFEGKAQ* |
| Ga0070708_1003609292 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MYWGHGYWILVPLVWLAAVIYLLTLATRLVRAIERIANKFETKP* |
| Ga0070708_1003904772 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSGMYWGHGWGLGAVAALVWLSAVIYLLTLATRLVRAIERIAAKVEAKP* |
| Ga0070708_1016383591 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MYWGHGVGILAGLIWLAAVIYLLTLATRLVRAIERIANKFEAKP* |
| Ga0066686_100420924 | 3300005446 | Soil | MYWGHGFSILVGLIWLAAVIYLLTLATRLVRAIEQIANRFEAKP* |
| Ga0066686_102955271 | 3300005446 | Soil | MERVYWGQGFSIVVGLVWLAVVIYVLTLATRLVRAIERIARKFDSKP* |
| Ga0066686_106640022 | 3300005446 | Soil | MSWGHGVESLAGLIWIAVVAYLITLGARLVRAIERIATKFENKPQ* |
| Ga0066689_102649533 | 3300005447 | Soil | MYWGHGIGILAGLIWLAAVIYLLTLVTRLVRAIERIASKFESKP* |
| Ga0066682_102568893 | 3300005450 | Soil | MEPVYWDHGFGFGVVAGLVWLAAVIYVLTLATRLVRAIERIATKFESKP* |
| Ga0066687_103454852 | 3300005454 | Soil | MYWEHGFWGVGLAGLIWLAAVIYLLTLATRLVRAIERIANKFESKAQ* |
| Ga0070707_1000713373 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MYWGHGVGILAGLIWLAAVIYLLTLATRLVRAIERIANKFEAKS* |
| Ga0070707_1004618712 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MYWGHGYWILVPLVWLAAVIYLLTLATRLVRAIERIANRFETKP* |
| Ga0070707_1004902703 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MSGMYWGHAWGFGAVAALVWLSAVIYLLTLATRLVRAIERIATKFEAK |
| Ga0070707_1008243221 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LVPPSYSRSSVSPHGFGFLAGLIWLAAVIYLLTLAARLVRAIERIANKVETKP* |
| Ga0070699_1003579432 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MSGMYWGHAWGFGAVAALVWLSAVIYLLTLATRLVRAIERIATKFEAKP* |
| Ga0070699_1003850053 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VSPHGFGFLAGLIWLAAVIYLLTLAARLVRAIERIANKVETKP* |
| Ga0070697_1005991451 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MYWVHGWFGILAGLIWLAAVIYLLTLATRLVRAIERIANKFESKAQ* |
| Ga0066701_104952322 | 3300005552 | Soil | VQEGPMYWGHGIGILAGLIWLAAVIYLLTLATRLVSAIERIATRFEAKP* |
| Ga0066661_104152121 | 3300005554 | Soil | MSGMYWGHGWGFGAVAALVWLSAVIYLLTLATRLVRAIERIATKFEPKP* |
| Ga0066692_103837532 | 3300005555 | Soil | MYWGHGFGGVGYLAGLIWLAAVIYLLTLATRLVRAIERIANKFEGKAQ* |
| Ga0066704_103572092 | 3300005557 | Soil | MSGMYWGHGWWFGAVAALVWLSAVIYLLTLATRLVRAIERIATKFEAKP* |
| Ga0066691_102360603 | 3300005586 | Soil | MSGMYWGHGWGFGAVAALVWLSAVIYLLTLATRLVRAIERIATKF |
| Ga0066691_102453493 | 3300005586 | Soil | MEPVYGGWGHGLGFSVVAGLVWLVVVIYVLTLATRLVRAIERIATKFESKP* |
| Ga0066691_102842262 | 3300005586 | Soil | MSGMYWGHGWWFGAVAALVWLSAVIYLLTLATRLVRAIERIATKFEPRP* |
| Ga0066706_108354443 | 3300005598 | Soil | MYWGHGFGYVAGLIWLAAVVYLLTLGTRLVRAIERIATKFESKP* |
| Ga0074470_113102021 | 3300005836 | Sediment (Intertidal) | EAAMYWGHGLGFLAGLIWLAVVIYLLTLAARFVRAIERIADRTETKPT* |
| Ga0075289_10212442 | 3300005888 | Rice Paddy Soil | MYGGHWFWGGFGYLAGLIWLAAVVYVLTLATRLVRAIERIANKFESKAP* |
| Ga0075277_10105482 | 3300005895 | Rice Paddy Soil | MYGAHWFSGFGYLAALVWLAAVLYVLTLATRLVRAIERIANKFESKAS* |
| Ga0079222_1000020914 | 3300006755 | Agricultural Soil | MAALYWGHGFGFGFGFVSGLVWLAVVIYLLVLATRLVRALERIATKFESKP* |
| Ga0066665_110280632 | 3300006796 | Soil | MSGMYWGHGWWFGAVAALVWLSAVIYLLTLATRLVRAIERIATKFEPKS* |
| Ga0066659_107525862 | 3300006797 | Soil | MSGMYWGHGWGFGAVAALVWLSAVIYLLTLATRLVRAIERIATKFEAKQ* |
| Ga0066659_110857661 | 3300006797 | Soil | MSGMYWGHGWGLGAVAALVWLSAVIYLLTLATRLVRAIERIATKFEAKP* |
| Ga0066659_117090352 | 3300006797 | Soil | GFGAVAALVWLSAVIYLLTLATRLVRAIERIATKFEAKP* |
| Ga0066660_116825672 | 3300006800 | Soil | RRPMYWGHGFWGVGYLAGLIWLAAVIYLLTLATRLVRAIERIASKFESKAQ* |
| Ga0079221_1000000335 | 3300006804 | Agricultural Soil | MFFHYYFPGLGLLAGLIWLAAVVYLLTLATRLVRALERIAARYESKS* |
| Ga0079221_105508781 | 3300006804 | Agricultural Soil | ESRNASRPLHLELTMAAVYWGHGFGFGFVAGLVWLAVVAYLLLLATRLVRALERIATKFEGKP* |
| Ga0075433_100275967 | 3300006852 | Populus Rhizosphere | MYWHWHGFGFLAGLIWLAALIYLLTLAARLVRAIERIANKVETRP* |
| Ga0075434_1004061521 | 3300006871 | Populus Rhizosphere | MYWHWHGFGFLAGLIWLAALIYLLTLAARLVRAIERIANKVET |
| Ga0075426_105157542 | 3300006903 | Populus Rhizosphere | MSGLYWGHGWGLGAVVALVWLSAVIYLLTLATRLVRAIERIATKFEARP* |
| Ga0099791_101097272 | 3300007255 | Vadose Zone Soil | MYWGHGWGFGAVAALVWLSAVIYLLTLATRLVRAIERIATKFEAKP* |
| Ga0099791_103973552 | 3300007255 | Vadose Zone Soil | MYWGHGWGFGAVAALVWLSAVIYLLTLATRLVRAIERIA |
| Ga0099793_101296152 | 3300007258 | Vadose Zone Soil | MYWGHGWAFGAVAALVWLSAVIYLLTLATRLVRAIERIATKFEAKP* |
| Ga0066710_1010256031 | 3300009012 | Grasslands Soil | MERVYWGQGFSIVVGLVWLAVVIYVLTLATRLVRAIERIARKFDSKP |
| Ga0066710_1017736543 | 3300009012 | Grasslands Soil | MYWGHGFGGVGYLAGLIWLAAVIYLLTLATRLVRAIERIANKFEGKAQ |
| Ga0099830_105174202 | 3300009088 | Vadose Zone Soil | LEPVYWGHGFGFGVVAGLVWLAVIVYVLTLATRLVRAIERIATEFESKP* |
| Ga0099830_117150251 | 3300009088 | Vadose Zone Soil | LKQLILERAMYWGHGFRILVGLIWLAAVIYLLTLATRLVRAIEQIANKFESKPQ* |
| Ga0099828_117544652 | 3300009089 | Vadose Zone Soil | MYYGREFGFVGGLIWLAAAIYLLTLAARLVRAIERIAEKVGPNPPK |
| Ga0099828_120210551 | 3300009089 | Vadose Zone Soil | MEPAYWGHGFGFGFVAALVWLAAVIYVLTLATRLVRAIERIATKFESKS* |
| Ga0099827_102946062 | 3300009090 | Vadose Zone Soil | MSGVYWGHGWGFGAIAALVWLSAVIYLLTLATRLVRAIERIAMKFEAKP* |
| Ga0066709_1018907232 | 3300009137 | Grasslands Soil | MYWGHGWWFGAVAALVWLSAVIYLLTLATRLVRAIERIATKFEAKP* |
| Ga0099792_101394731 | 3300009143 | Vadose Zone Soil | MYWGHGWGFGAVAALVWLSAVIYLLTLATRLVRAIERIATKLEAKP* |
| Ga0075423_126181042 | 3300009162 | Populus Rhizosphere | MYWHWHGFGFLAGLIWLAALIYLLTLAARLVRAIERIA |
| Ga0134088_104889492 | 3300010304 | Grasslands Soil | VDTLDHHVQEGPMYWGHGFSILVGLIWLAAVIYLLTLATRLVRAIEQIANRFEAKP* |
| Ga0134125_104340682 | 3300010371 | Terrestrial Soil | MYWHWHGFGFLSGLIWLAAVIYLLTLAARLVRAIERIANKVETKP* |
| Ga0134126_111908281 | 3300010396 | Terrestrial Soil | MYWHWHGFGFLADLIWLAALIYLLTLAARLVRAIERIANKVETKP* |
| Ga0137392_103618751 | 3300011269 | Vadose Zone Soil | MSGVYWGHGWGVGAVAALVWLSAVIYLLTLATRLVRAIERIATKFEAKP* |
| Ga0137392_104003823 | 3300011269 | Vadose Zone Soil | VGAVAALVWLSAVIYLLTLATRLVRAIERIATKFEAKP* |
| Ga0137393_101165425 | 3300011271 | Vadose Zone Soil | MSGVYWGHGWGVGAVAALVWLSAVIYLLTLATRLVRA |
| Ga0137388_105012602 | 3300012189 | Vadose Zone Soil | MYWGHGWGLGAVAALVWLSAVIYLLTLATRLVRAIERIATKFEAKP* |
| Ga0137388_119908992 | 3300012189 | Vadose Zone Soil | WGFGAVAALVWLSAVIYLLTLATRLVRAIERIATKFEAKP* |
| Ga0137383_106478351 | 3300012199 | Vadose Zone Soil | MEPVYWGHGFGFSVVAGLVWLAVVIYVLTLATRLVRAIERIATKF* |
| Ga0137383_109854582 | 3300012199 | Vadose Zone Soil | MYWGHGFWGVGYLAGLIWLAAVIYLLTLATRLVRAIERIANEFESKAQ* |
| Ga0137365_100902003 | 3300012201 | Vadose Zone Soil | MSGVYWGHGWGFGAVAALVWLSAVIYLLTLATRLVRAIERIATKFEAKP* |
| Ga0137399_108168861 | 3300012203 | Vadose Zone Soil | MSGGYWGHGYWFGRVAALVWLSAVIYLLTLATRLVRAIERIATKFEAKP* |
| Ga0137380_101344802 | 3300012206 | Vadose Zone Soil | MAAVYWGHGFGLGFGFVAGLVWLAVVTYLLLLATRLVRAIERIATKFEGKP* |
| Ga0137381_108879892 | 3300012207 | Vadose Zone Soil | MYWGHGFGGVGYLAGLIWLAAVIYLLTLATRLVRAIERIANEFESKAQ* |
| Ga0137376_106372163 | 3300012208 | Vadose Zone Soil | LEEPMEPAYWGHGFGFSVVVGLVWLAAVIYVLTLATRLVRAVERIATKFESKP* |
| Ga0137377_114140832 | 3300012211 | Vadose Zone Soil | MYWGHGWGFGAVAALVWLSAVIYLLTLATRLVRAIERIAMKFEAKP* |
| Ga0137377_118619972 | 3300012211 | Vadose Zone Soil | MSGMYWGHGWGFGALAALVWLSAVIYLLTLATRLVRAIERIATKFEAKP* |
| Ga0137370_101623711 | 3300012285 | Vadose Zone Soil | MYWGHGWGFGAVAALVWLSAVIYLLTLATRLVRAIERIATKFDAKP* |
| Ga0137370_104024962 | 3300012285 | Vadose Zone Soil | FGAVAALVWLSAVIYLLTLATRLVRAIERIATKFEAKP* |
| Ga0137372_101610813 | 3300012350 | Vadose Zone Soil | MYWGHGFWGVGYLAGLIWLAAVIYLLTLATRLVRAIERIANK |
| Ga0137372_105346691 | 3300012350 | Vadose Zone Soil | MYWGHGIGILAGLIWLAAVIYLLTLITRLVRAIERIANKFEAKP* |
| Ga0137366_100113067 | 3300012354 | Vadose Zone Soil | MSGVYWGHGWWFGAIAALVWLSAVIYLLTLATRLVRAIERIATKFEAKP* |
| Ga0137366_100505202 | 3300012354 | Vadose Zone Soil | MAALYWGHGFGFGFGFVAGLVWLAVVTYLLLLATRLVRAIERIATKFEGKP* |
| Ga0137366_107220491 | 3300012354 | Vadose Zone Soil | MYWGHGFWGVGYLAGLIWLAAVIYLLTLATRLVRAIERIANKFESRAQ* |
| Ga0137371_106818882 | 3300012356 | Vadose Zone Soil | MEPVYWDHGFGFGVVAGLVWLAAFIYVLTLATRLVRAIERIATKFESKP* |
| Ga0137384_107231991 | 3300012357 | Vadose Zone Soil | PRSIHLEEKMEPVYGGWGHGLGFSVVAGLVWLVVVIYVLTLATRLVRAIERIATQFESKP |
| Ga0137385_101110561 | 3300012359 | Vadose Zone Soil | MEPVYGGWGHGLGRSVVAGLVWLVVVLYVLTLATRLVRAIERIATKFESKP* |
| Ga0137360_116595771 | 3300012361 | Vadose Zone Soil | ERTMYWAHGWFGILAGLTWLAAVIYLLTLATRLVRAIERIANKFESKAQ* |
| Ga0137373_101406292 | 3300012532 | Vadose Zone Soil | MYWGHGIGILAGLIWLAAVIYLLTLVTRLVRAIERIANKFEAKP* |
| Ga0137358_101233951 | 3300012582 | Vadose Zone Soil | MYWGHGWGFGAVAALVWLSAVLYLLTHATRLGRAIERIATKFEAKP* |
| Ga0137398_100411092 | 3300012683 | Vadose Zone Soil | MYWGHGWGFGAVAALVWLSAVIYLLTLDTRLVRAIERIATKFEAKP* |
| Ga0137398_108577072 | 3300012683 | Vadose Zone Soil | MSGGYWGHGYWFGLVAALVWLSAVIYLLTLATRLVRAIERIATKFEAKP* |
| Ga0137397_100382161 | 3300012685 | Vadose Zone Soil | MYWGHGWGFGAVAALVWLSAVIYLLTLATRLVRAIERIATKFE |
| Ga0137395_101207933 | 3300012917 | Vadose Zone Soil | MSGMYWGHGWGFGAVAALVWLSAVIYLLTLATRLVRAIERIATKLEAKP* |
| Ga0137396_103931711 | 3300012918 | Vadose Zone Soil | MYWGHGVGILAGLIWLAAVIYLLTLATRLVSAIERIATRFEAKQ* |
| Ga0137396_104966801 | 3300012918 | Vadose Zone Soil | MYWGHGWGFGAVAALVWLSAVLYLLTLATRLVRAIERIATKFEAKP* |
| Ga0137396_107882902 | 3300012918 | Vadose Zone Soil | MSGGYWGHGYGFGLVAALVWLSAVIYLLTLATRLVRAIERIATRFEAKP* |
| Ga0137396_109395502 | 3300012918 | Vadose Zone Soil | MYYYHHAFGIVGAVVWLAVAIYLLTLATRLVRAIEKIAGKSDAKPS* |
| Ga0137394_112702852 | 3300012922 | Vadose Zone Soil | MSGMYWGHGWGFGAVAALVWLSAVIYLLTLATRLVRAIERIAMKFEAKP* |
| Ga0137419_116698601 | 3300012925 | Vadose Zone Soil | MYWGHGWGLGAVAALVWLLAVIYLLTLATRLVRAIERIATKFEAKP* |
| Ga0137404_100486624 | 3300012929 | Vadose Zone Soil | MSGMYWGHGWGVGAVAALVWLSAVIYLLTLATRLVRAIERIATKFEAKP* |
| Ga0137404_108680071 | 3300012929 | Vadose Zone Soil | GMYWGHGWGFGAVAALVWLSAVIYLLTLATRLVRAIERIAMKFEAKP* |
| Ga0137407_100089588 | 3300012930 | Vadose Zone Soil | MYWGHGWGVGAVAALVWLSAVIYLLTLATRLVRAIERIATKFEAKP* |
| Ga0137407_106240002 | 3300012930 | Vadose Zone Soil | MSGMYWGHGWGFAAVAALVWLSAVIYLLTLATRLVRAIERIATKFEAKP* |
| Ga0153915_115510352 | 3300012931 | Freshwater Wetlands | MYWAHGFWGGFGYLAGLIWLAAVIYILTLATRLVRAIERIANKFESKAP* |
| Ga0134075_101332252 | 3300014154 | Grasslands Soil | MAGVYWGHGYGFGIVVGLVWLSAVIYLLTLATRLLRAMERIATKFETKP* |
| Ga0134078_102386812 | 3300014157 | Grasslands Soil | MSGMYWGHGWGFGAVAALVWLSAIIYLLTLATRLVRAIE |
| Ga0137403_100780153 | 3300015264 | Vadose Zone Soil | WGHGWGFGAVAALVWLSAVIYLLTLATRLVRAIERIATKFEAKP* |
| Ga0134112_101064602 | 3300017656 | Grasslands Soil | MSWGHGVESLAGLIWIAVVAYLITLGARLVRAIERIATKFENKPQ |
| Ga0184623_100132405 | 3300018056 | Groundwater Sediment | MSWGHGVEGLVGLLWAAVAVYLLTLGARLVRAIERIASKFEGKPQ |
| Ga0184618_100454851 | 3300018071 | Groundwater Sediment | MSGMYWGHGWGLGAVAALVWLLAVIYLLTLATRLVRAIERIATKFEAKP |
| Ga0184612_103635622 | 3300018078 | Groundwater Sediment | MSWGHGVDSFVGLLWAAVVVYLLTLGARLVRAIERIASKFEGKPQ |
| Ga0066655_105150612 | 3300018431 | Grasslands Soil | MYWGHGVGILAGLIWLAAVIYLLTLATRLVRAIERIANKFEAKP |
| Ga0066667_114766271 | 3300018433 | Grasslands Soil | MSGMYWGHGWGFGAVAALVWLSAVIYLLTLATRLVRAIERIATKFEAKP |
| Ga0066662_103071562 | 3300018468 | Grasslands Soil | MYWGHGIGILAGLIWLAAVIYLLTLATRLVSAIERIATRFEAKP |
| Ga0193755_10005073 | 3300020004 | Soil | MSGMYWGHGWGFGAVAALVWLLAVIYLLTLATRLVRAIERIATKFEAKP |
| Ga0193755_10628952 | 3300020004 | Soil | MSGMYWGHGWAFGAVAALVWLSAVIYLLTLATRLVRAIERIATKFETKP |
| Ga0179594_103355191 | 3300020170 | Vadose Zone Soil | MSGMYWGHGWGFGAVAALVWLSAVIYLLTLATRLVRAI |
| Ga0215015_106140413 | 3300021046 | Soil | MWWYGHGLGIIAGLVWLGAVIYLLTLATRLVRAIEQIAAKFESRAG |
| Ga0179596_102028412 | 3300021086 | Vadose Zone Soil | MSGMYWGHGWGFGAVAALVWLSAVIYLLTLATRLVRAIERIATKLEAKP |
| Ga0207646_102347023 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MYWGHGVGILAGLIWLAAVIYLLTLATRLVRAIERIANKFEAKS |
| Ga0207646_103180091 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VSPHGFGFLAGLIWLAAVIYLLTLAARLVRAIERIANKVETKP |
| Ga0207646_105688022 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MSGMYWGHAWGFGAVAALVWLSAVIYLLTLATRLVRAIERIATKFEAKQ |
| Ga0209027_10286581 | 3300026300 | Grasslands Soil | SGMYWGHGWGLGAVAALVWLSAVIYLLTLATRLVRAIERIATKFEAKP |
| Ga0209238_11021731 | 3300026301 | Grasslands Soil | MSGMYWGHGWGLGAVAALVWLSAVIYLLTLATRLVRAIERIATKFEAKP |
| Ga0209265_12239212 | 3300026308 | Soil | MYWEHGFWGVGLAGLIWLAAVIYLLTLATRLVRAIERIANKFESKAQ |
| Ga0209471_10069155 | 3300026318 | Soil | MSGMYWGHGWGFGAVAALVWLSAVIYLLTLATRLVRAIERIATKFEPKP |
| Ga0209158_10857992 | 3300026333 | Soil | MSGMYWGHGWWFGAVAALVWLSAVIYLLTLATRLVRAIERIATKFEPRP |
| Ga0209690_10730372 | 3300026524 | Soil | MYWGHGFGGVGYLAGLIWLAAVIYLLTLATRLVRAIERIANKFESKAQ |
| Ga0209806_13265762 | 3300026529 | Soil | MSGMYWGHGWWFGAVAALVWLSAVIYLLTLATRLVRAIERIATKFEPKP |
| Ga0209157_10785452 | 3300026537 | Soil | MYWGHGFSILVGLIWLAAVIYLLTLATRLVRAIEQIANRFEAKP |
| Ga0209156_104331512 | 3300026547 | Soil | MYWEHGFWGVGLAGLIWLAAVIYLLTLATRLVRAIERIANK |
| Ga0209648_100155915 | 3300026551 | Grasslands Soil | MMWYGHGLGIIVGLVWLGAVIYLLTLATRLVRAIEQIAARFDGKVG |
| Ga0209648_100757392 | 3300026551 | Grasslands Soil | MWWYGHGLGIIAGLVWLGAVIYLLTLATRLVRAIEHIAAKFESKAG |
| Ga0179593_10261502 | 3300026555 | Vadose Zone Soil | RAGVCAPVVALVWFSAVIYLLTLATRLVRAIERIATKFEAK |
| Ga0209178_100002935 | 3300027725 | Agricultural Soil | MFFHYYFPGLGLLAGLIWLAAVVYLLTLATRLVRALERIAARYESKS |
| Ga0209178_12690282 | 3300027725 | Agricultural Soil | HLELTMAAVYWGHGFGFGFVAGLVWLAVVAYLLLLATRLVRALERIATKFEGKP |
| Ga0209073_100286292 | 3300027765 | Agricultural Soil | GFGFGFGFVSGLVWLAVVIYLLVLATRLVRALERIATKFESKP |
| Ga0209073_100570471 | 3300027765 | Agricultural Soil | MAALYWGHGFGFGFGFVSGLVWLAVVIYLLVLATRLVRALERIATKFESKP |
| Ga0209283_105260521 | 3300027875 | Vadose Zone Soil | MSGVYWGHGWGVGAVAALVWLSAVIYLLTLATRLVRAIERIATKFEAKP |
| Ga0209590_104672112 | 3300027882 | Vadose Zone Soil | MSGVYWGHGWGFGAIAALVWLSAVIYLLTLATRLVRAIERIAMKFEAKP |
| Ga0307504_104618792 | 3300028792 | Soil | MSGVYWGHGWAFGAVAALVWLSAVIYLLTLATRLVRAIERIATKFEAKP |
| Ga0307469_106486541 | 3300031720 | Hardwood Forest Soil | MSGLFWGHGWGFGAVVALVWLSAVIYLLTLATRLVRAIERIATKFEDRP |
| Ga0307479_100287003 | 3300031962 | Hardwood Forest Soil | MYWGHGIGILAGLIWLAAVIYLLTLATRLVSAIERIAAKFEAKP |
| Ga0307479_101231392 | 3300031962 | Hardwood Forest Soil | MWWYGHGLGIVAGLVWLGAVIYLLTLATRLVRAIEHIADKFDGKPG |
| ⦗Top⦘ |