


| Basic Information | |
|---|---|
| Family ID | F051014 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 144 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MSETIGRLLAAGNVAEVFEWGSRVVKLYRSPARKPTAFREA |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 144 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 97.92 % |
| % of genes near scaffold ends (potentially truncated) | 97.22 % |
| % of genes from short scaffolds (< 2000 bps) | 93.75 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.667 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (36.806 % of family members) |
| Environment Ontology (ENVO) | Unclassified (64.583 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.333 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.59% β-sheet: 21.74% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 144 Family Scaffolds |
|---|---|---|
| PF00005 | ABC_tran | 4.86 |
| PF00311 | PEPcase | 4.17 |
| PF04255 | DUF433 | 3.47 |
| PF00496 | SBP_bac_5 | 2.78 |
| PF01425 | Amidase | 2.08 |
| PF04226 | Transgly_assoc | 1.39 |
| PF04191 | PEMT | 1.39 |
| PF00211 | Guanylate_cyc | 1.39 |
| PF00144 | Beta-lactamase | 1.39 |
| PF07298 | NnrU | 1.39 |
| PF10544 | T5orf172 | 0.69 |
| PF13730 | HTH_36 | 0.69 |
| PF04273 | BLH_phosphatase | 0.69 |
| PF00583 | Acetyltransf_1 | 0.69 |
| PF05598 | DUF772 | 0.69 |
| PF13602 | ADH_zinc_N_2 | 0.69 |
| PF13701 | DDE_Tnp_1_4 | 0.69 |
| PF01494 | FAD_binding_3 | 0.69 |
| PF00561 | Abhydrolase_1 | 0.69 |
| PF13280 | WYL | 0.69 |
| PF13419 | HAD_2 | 0.69 |
| PF00248 | Aldo_ket_red | 0.69 |
| PF13551 | HTH_29 | 0.69 |
| PF13751 | DDE_Tnp_1_6 | 0.69 |
| PF12840 | HTH_20 | 0.69 |
| PF00487 | FA_desaturase | 0.69 |
| PF00171 | Aldedh | 0.69 |
| PF00083 | Sugar_tr | 0.69 |
| PF10604 | Polyketide_cyc2 | 0.69 |
| PF12833 | HTH_18 | 0.69 |
| PF14378 | PAP2_3 | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
|---|---|---|---|
| COG2352 | Phosphoenolpyruvate carboxylase | Energy production and conversion [C] | 4.17 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 3.47 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 2.08 |
| COG4094 | Uncharacterized membrane protein | Function unknown [S] | 1.39 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.39 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.39 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.39 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.39 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 1.39 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.39 |
| COG3453 | Predicted phosphohydrolase, protein tyrosine phosphatase (PTP) superfamily, DUF442 family | General function prediction only [R] | 0.69 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.69 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.69 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.69 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.69 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.69 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.69 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.69 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.36 % |
| Unclassified | root | N/A | 7.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005187|Ga0066675_10945048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 650 | Open in IMG/M |
| 3300005332|Ga0066388_103622779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 788 | Open in IMG/M |
| 3300005575|Ga0066702_10522131 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300005764|Ga0066903_104716144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 725 | Open in IMG/M |
| 3300006028|Ga0070717_10757090 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300006796|Ga0066665_10348625 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
| 3300006954|Ga0079219_10781111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 746 | Open in IMG/M |
| 3300009826|Ga0123355_11975251 | Not Available | 542 | Open in IMG/M |
| 3300010046|Ga0126384_11035875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 749 | Open in IMG/M |
| 3300010048|Ga0126373_11022357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 892 | Open in IMG/M |
| 3300010359|Ga0126376_11109923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 800 | Open in IMG/M |
| 3300010360|Ga0126372_12127079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 609 | Open in IMG/M |
| 3300010361|Ga0126378_11719132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 713 | Open in IMG/M |
| 3300010361|Ga0126378_13206715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 520 | Open in IMG/M |
| 3300010366|Ga0126379_13458709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 529 | Open in IMG/M |
| 3300010366|Ga0126379_13851048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 503 | Open in IMG/M |
| 3300010376|Ga0126381_100617275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1544 | Open in IMG/M |
| 3300010398|Ga0126383_10757568 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300012362|Ga0137361_10006931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7802 | Open in IMG/M |
| 3300012923|Ga0137359_11097136 | Not Available | 681 | Open in IMG/M |
| 3300012958|Ga0164299_11157732 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 582 | Open in IMG/M |
| 3300012971|Ga0126369_10476744 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1302 | Open in IMG/M |
| 3300012971|Ga0126369_11211902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 845 | Open in IMG/M |
| 3300016294|Ga0182041_10012102 | All Organisms → cellular organisms → Bacteria | 4969 | Open in IMG/M |
| 3300016294|Ga0182041_11763638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 573 | Open in IMG/M |
| 3300016319|Ga0182033_11367364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 637 | Open in IMG/M |
| 3300016341|Ga0182035_10344320 | Not Available | 1237 | Open in IMG/M |
| 3300016341|Ga0182035_11828969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 550 | Open in IMG/M |
| 3300016357|Ga0182032_10108872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1974 | Open in IMG/M |
| 3300016357|Ga0182032_10885526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 758 | Open in IMG/M |
| 3300016357|Ga0182032_10896598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 753 | Open in IMG/M |
| 3300016357|Ga0182032_11112533 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300016357|Ga0182032_12049356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300016371|Ga0182034_10604736 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300016371|Ga0182034_10700702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 861 | Open in IMG/M |
| 3300016371|Ga0182034_10908578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 757 | Open in IMG/M |
| 3300016371|Ga0182034_11381383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 615 | Open in IMG/M |
| 3300016371|Ga0182034_11890091 | Not Available | 527 | Open in IMG/M |
| 3300016371|Ga0182034_12046674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 506 | Open in IMG/M |
| 3300016387|Ga0182040_10154556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces paradoxus | 1639 | Open in IMG/M |
| 3300016387|Ga0182040_10468005 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300016387|Ga0182040_10906697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 731 | Open in IMG/M |
| 3300016404|Ga0182037_10720330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 855 | Open in IMG/M |
| 3300016404|Ga0182037_11573956 | Not Available | 584 | Open in IMG/M |
| 3300016422|Ga0182039_10329604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1275 | Open in IMG/M |
| 3300016445|Ga0182038_10672522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM1253 | 899 | Open in IMG/M |
| 3300016445|Ga0182038_11036596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM1253 | 727 | Open in IMG/M |
| 3300020579|Ga0210407_10357555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1142 | Open in IMG/M |
| 3300020581|Ga0210399_10116221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2195 | Open in IMG/M |
| 3300020581|Ga0210399_11489580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 525 | Open in IMG/M |
| 3300021171|Ga0210405_10224571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1487 | Open in IMG/M |
| 3300021405|Ga0210387_11232713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 649 | Open in IMG/M |
| 3300021432|Ga0210384_10222215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1699 | Open in IMG/M |
| 3300021478|Ga0210402_10925187 | Not Available | 798 | Open in IMG/M |
| 3300021560|Ga0126371_10550927 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1302 | Open in IMG/M |
| 3300021560|Ga0126371_11852828 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300021560|Ga0126371_13933274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 500 | Open in IMG/M |
| 3300022531|Ga0242660_1213646 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300024347|Ga0179591_1176781 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1275 | Open in IMG/M |
| 3300025906|Ga0207699_10211017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1321 | Open in IMG/M |
| 3300025915|Ga0207693_10597551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 859 | Open in IMG/M |
| 3300025916|Ga0207663_10964590 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 683 | Open in IMG/M |
| 3300027104|Ga0208095_1012281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 606 | Open in IMG/M |
| 3300027161|Ga0208368_107330 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 604 | Open in IMG/M |
| 3300027174|Ga0207948_1002418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2086 | Open in IMG/M |
| 3300027266|Ga0209215_1066191 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300030498|Ga0268247_10472275 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300031057|Ga0170834_112576698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 659 | Open in IMG/M |
| 3300031122|Ga0170822_16417655 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300031545|Ga0318541_10645847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 591 | Open in IMG/M |
| 3300031561|Ga0318528_10423311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 715 | Open in IMG/M |
| 3300031573|Ga0310915_10661022 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300031573|Ga0310915_10948421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 602 | Open in IMG/M |
| 3300031668|Ga0318542_10690617 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 533 | Open in IMG/M |
| 3300031680|Ga0318574_10458096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 746 | Open in IMG/M |
| 3300031682|Ga0318560_10135303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1297 | Open in IMG/M |
| 3300031682|Ga0318560_10820420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300031708|Ga0310686_109062319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 548 | Open in IMG/M |
| 3300031708|Ga0310686_109806800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2171 | Open in IMG/M |
| 3300031719|Ga0306917_10508722 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 946 | Open in IMG/M |
| 3300031720|Ga0307469_11105654 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 745 | Open in IMG/M |
| 3300031720|Ga0307469_11401166 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 667 | Open in IMG/M |
| 3300031744|Ga0306918_10302904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1232 | Open in IMG/M |
| 3300031744|Ga0306918_10776782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 748 | Open in IMG/M |
| 3300031744|Ga0306918_11508785 | Not Available | 513 | Open in IMG/M |
| 3300031748|Ga0318492_10153045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1164 | Open in IMG/M |
| 3300031768|Ga0318509_10523317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 662 | Open in IMG/M |
| 3300031777|Ga0318543_10218301 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300031777|Ga0318543_10584688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300031780|Ga0318508_1171908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 618 | Open in IMG/M |
| 3300031782|Ga0318552_10082176 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1572 | Open in IMG/M |
| 3300031793|Ga0318548_10004825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira → unclassified Nitrosospira → Nitrosospira sp. Nsp1 | 4843 | Open in IMG/M |
| 3300031793|Ga0318548_10123606 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1252 | Open in IMG/M |
| 3300031833|Ga0310917_10373329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM1253 | 969 | Open in IMG/M |
| 3300031833|Ga0310917_10617669 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300031833|Ga0310917_10965770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 572 | Open in IMG/M |
| 3300031845|Ga0318511_10288788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 740 | Open in IMG/M |
| 3300031845|Ga0318511_10515616 | Not Available | 554 | Open in IMG/M |
| 3300031879|Ga0306919_10970002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 650 | Open in IMG/M |
| 3300031890|Ga0306925_10598633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1164 | Open in IMG/M |
| 3300031890|Ga0306925_10676359 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300031890|Ga0306925_11200777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 760 | Open in IMG/M |
| 3300031890|Ga0306925_11608172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 631 | Open in IMG/M |
| 3300031893|Ga0318536_10344617 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 754 | Open in IMG/M |
| 3300031897|Ga0318520_10384580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 856 | Open in IMG/M |
| 3300031910|Ga0306923_12129965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 565 | Open in IMG/M |
| 3300031912|Ga0306921_10571898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1309 | Open in IMG/M |
| 3300031912|Ga0306921_11588006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 711 | Open in IMG/M |
| 3300031912|Ga0306921_11614178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 704 | Open in IMG/M |
| 3300031941|Ga0310912_10556124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 893 | Open in IMG/M |
| 3300031941|Ga0310912_10916563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 674 | Open in IMG/M |
| 3300031941|Ga0310912_10935040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 666 | Open in IMG/M |
| 3300031941|Ga0310912_11072682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 616 | Open in IMG/M |
| 3300031942|Ga0310916_10390105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1185 | Open in IMG/M |
| 3300031942|Ga0310916_10924725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 730 | Open in IMG/M |
| 3300031945|Ga0310913_11192057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 530 | Open in IMG/M |
| 3300031946|Ga0310910_10927767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 682 | Open in IMG/M |
| 3300031947|Ga0310909_10825187 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300031954|Ga0306926_12058512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300031954|Ga0306926_12249985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 605 | Open in IMG/M |
| 3300031959|Ga0318530_10326084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 635 | Open in IMG/M |
| 3300031981|Ga0318531_10396591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 624 | Open in IMG/M |
| 3300031981|Ga0318531_10421166 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 604 | Open in IMG/M |
| 3300032001|Ga0306922_10568548 | Not Available | 1204 | Open in IMG/M |
| 3300032001|Ga0306922_11250471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 753 | Open in IMG/M |
| 3300032001|Ga0306922_11831761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 596 | Open in IMG/M |
| 3300032035|Ga0310911_10364963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 834 | Open in IMG/M |
| 3300032035|Ga0310911_10525696 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300032059|Ga0318533_10867035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 662 | Open in IMG/M |
| 3300032059|Ga0318533_10900037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 649 | Open in IMG/M |
| 3300032059|Ga0318533_10970561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 623 | Open in IMG/M |
| 3300032063|Ga0318504_10104839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1270 | Open in IMG/M |
| 3300032076|Ga0306924_10191615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2347 | Open in IMG/M |
| 3300032076|Ga0306924_10508202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1372 | Open in IMG/M |
| 3300032076|Ga0306924_12300444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300032205|Ga0307472_100253579 | Not Available | 1381 | Open in IMG/M |
| 3300032261|Ga0306920_100406494 | Not Available | 2024 | Open in IMG/M |
| 3300032261|Ga0306920_100857677 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1330 | Open in IMG/M |
| 3300032261|Ga0306920_101223231 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300032828|Ga0335080_10222973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2067 | Open in IMG/M |
| 3300033289|Ga0310914_10717235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 896 | Open in IMG/M |
| 3300033289|Ga0310914_11013020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 731 | Open in IMG/M |
| 3300033289|Ga0310914_11307753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 627 | Open in IMG/M |
| 3300033289|Ga0310914_11739918 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 36.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 33.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.42% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.08% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.08% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.08% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.39% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.39% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.69% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.69% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027104 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF024 (SPAdes) | Environmental | Open in IMG/M |
| 3300027161 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF032 (SPAdes) | Environmental | Open in IMG/M |
| 3300027174 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes) | Environmental | Open in IMG/M |
| 3300027266 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300030498 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.e (v2) | Host-Associated | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066675_109450481 | 3300005187 | Soil | MSEAMGRLLAVGNVAEIFEWGSRVLKPYKSTAAKPAAFREAAI* |
| Ga0066388_1036227793 | 3300005332 | Tropical Forest Soil | MSETIGRLLAAGQRAEVFEWGCRVVKLCRSTGSKQVIFREAAINA |
| Ga0066702_105221312 | 3300005575 | Soil | MSETIGRLLAVGNVAEVFECGSRVLKLYRSAVRKPTAFREAAIHATV |
| Ga0066903_1047161442 | 3300005764 | Tropical Forest Soil | MSETMGRLLAAGQRAEVFEWGCRVVKLCRSTGSKQV |
| Ga0070717_107570901 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MPARKDRLLATGNVAEIFEWGSRVLKLYKSPAAKLVAF |
| Ga0066665_103486251 | 3300006796 | Soil | MSEIIGHLLAAGQRAEVFEWGSRVVKLYRSTAAKRVIFGEAA |
| Ga0079219_107811113 | 3300006954 | Agricultural Soil | MSETMGRLLAAGQRAEVFEWGSRAVKLYRCAAAKQTAFREAAIH |
| Ga0123355_119752513 | 3300009826 | Termite Gut | MEEALGRPLATGNTAEIFEWGSRVMKLYKSPLAKPVAFREAATSA |
| Ga0126384_110358751 | 3300010046 | Tropical Forest Soil | MSERIGRLLAAGNVAEVFEWGPRQVLKLYRSATAKPTVVREAGTTRR |
| Ga0126373_110223571 | 3300010048 | Tropical Forest Soil | MSETIGRLLAAGNVAEVFEWGSRVVKLYRSPARKPTAFREA |
| Ga0126376_111099231 | 3300010359 | Tropical Forest Soil | MSNVGRLLAAGTVAEVFEWGSHVVKLYRSPAAKQAAFRE |
| Ga0126372_121270792 | 3300010360 | Tropical Forest Soil | MSETIGRLLATGNVAEVFEWGSRVVKLYRSPARKP |
| Ga0126378_117191321 | 3300010361 | Tropical Forest Soil | MSETIGRLLAAGNVAEVFEWGSRVVKLYRSSARKPMAFREA |
| Ga0126378_132067151 | 3300010361 | Tropical Forest Soil | MSERIGRLLAAGNVAEVFEWGSHRVLKLYRLAEAKPTVFREARNQAAVEALG |
| Ga0126379_134587092 | 3300010366 | Tropical Forest Soil | MSETIGRLLAAGQRAEVFEWGSHVVKLCRSTGSKH |
| Ga0126379_138510482 | 3300010366 | Tropical Forest Soil | MSKTVGQLLVAGNVTEVFEWGSRVVKLYWSPAAKQAAFREAA |
| Ga0126381_1006172753 | 3300010376 | Tropical Forest Soil | LLAAGNVAEVFEWGSRVVKLYRSPARKPTAFREAAIHAAVEAMA |
| Ga0126383_107575683 | 3300010398 | Tropical Forest Soil | MSETMGRLLAAGQRAEVFEWGCRVVKLCRSTGSKQVIFREAAIN |
| Ga0137361_100069311 | 3300012362 | Vadose Zone Soil | MSERIGRLLAAGNVAEVFEWGSRVVKLYLSAGAKQTVFREA |
| Ga0137359_110971361 | 3300012923 | Vadose Zone Soil | MSEGIGRLLAAGNVAEVFEWGSCVVKLYRSAGAKQTVFREAGIH |
| Ga0164299_111577321 | 3300012958 | Soil | MTETMGHLLAVGNVAEIFEWGSRVLKLYKSTDAKPAAFREAAIHAAAEA |
| Ga0126369_104767441 | 3300012971 | Tropical Forest Soil | MSETIGRLLAAGNVAEVFEWGSRVVKLYRSSARKPTAFREA |
| Ga0126369_112119022 | 3300012971 | Tropical Forest Soil | MSETIGRLLAAGQRAEVFEWGCRVVKLCRSTGSKQVIFRE |
| Ga0182041_100121021 | 3300016294 | Soil | MNERTGRWLAVGDVAEIFEWGSRVVKLYKSTAAKPSAFRKV |
| Ga0182041_117636381 | 3300016294 | Soil | MSETIGRLLAAGNVAEVFEWGSRVVKLCRSPARKPTAFREAAIHAAVEAMALPV |
| Ga0182033_113673642 | 3300016319 | Soil | MNERTGRWLAVSDVAEIFEWGSRVVKLYKSTAAKPSAFRKVAIQAAVEASGL |
| Ga0182035_103443201 | 3300016341 | Soil | MSETIGRLLAAGQRAEVFEWGTRVVKLSRSTGSKPVIFREAAIHAAVEAL |
| Ga0182035_118289691 | 3300016341 | Soil | MSETIGRLLAAGNVAEVFEWGSRVVKLYRSSARKPTA |
| Ga0182032_101088721 | 3300016357 | Soil | MSETIGRLLAAGNVAEVFEWGSRVVKLYRSAARKPTVFGEA |
| Ga0182032_108855262 | 3300016357 | Soil | MSETMGRLLAAGQRAEVFEWGSRVVKLCRSTGSKQVIFREAAINAA |
| Ga0182032_108965981 | 3300016357 | Soil | MSETMGRLLAAGQRAEVFEWGSRVVKLCRSTGSKQVIFREAAIN |
| Ga0182032_111125331 | 3300016357 | Soil | MSETIGRLLAAGNVAEVFEWGSRVVKLYRSSARKPTAFREAA |
| Ga0182032_120493561 | 3300016357 | Soil | MSETMGRLLAAGQRAEVFEWGRRVVKLCRSTGSKQVIFREAAINAAVEALG |
| Ga0182034_106047362 | 3300016371 | Soil | MSETIGRLLAAGNVAEVFEWGSRVVKLYRSAARKATAFR |
| Ga0182034_107007021 | 3300016371 | Soil | MSETMGRLLAAGQRAEVFEWGCRVVKLCRSTGSKQVIFREAAINAAVEAL |
| Ga0182034_109085781 | 3300016371 | Soil | MSETRGRLLAAGQRAEVFEWGSRVVKLCRSTGSKQVIFREAAIN |
| Ga0182034_113813831 | 3300016371 | Soil | MSETIGRLLAAGNVAEVFEWGSRVVKLYRSSARKPTAFREAAIHAS |
| Ga0182034_118900912 | 3300016371 | Soil | MSETIGRLLAAGQRAEVLEFGIRVVKLCRSTGSKRVTFREASIHAAVEALGL |
| Ga0182034_120466741 | 3300016371 | Soil | MSETIGRLLAAGNVAEVFEWGSRVVKLYRSPARKPT |
| Ga0182040_101545563 | 3300016387 | Soil | MSETIGRLLAAGNVAEVFEWGSRVVKLYRSSARKPTAFRE |
| Ga0182040_104680051 | 3300016387 | Soil | MLPRIIVGGCMMSETIGRLLAAGNVAEVFEWGSRVVKLYRSPARKPTAFREA |
| Ga0182040_109066971 | 3300016387 | Soil | MSETMGRLLAAGQRAEVFEWGCRVVKLCRSTGSKQVIFRE |
| Ga0182037_107203301 | 3300016404 | Soil | MSETMGRLLAAGQRAEVFEWGSRVVKLCRSTGSKQVI |
| Ga0182037_115739561 | 3300016404 | Soil | MSETIGRLLAAGNVAEVFEWGSRVVKLCRSPARKPTAFREAAI |
| Ga0182039_103296041 | 3300016422 | Soil | MNETPGRLLAAGNVAEVFEWGSRVVKLYRSSARKATAFR |
| Ga0182038_106725222 | 3300016445 | Soil | MSETIGRLLAAGNVAEVFEWGSRVVKLYRSSARKPTAF |
| Ga0182038_110365962 | 3300016445 | Soil | MNETIGRLLAAGNVAEVSEWRSRVVKLYRSSARKPTAF |
| Ga0210407_103575551 | 3300020579 | Soil | MSETIGRLLAVGNVAEVFECGSRVLKLYRSAARKPT |
| Ga0210399_101162211 | 3300020581 | Soil | MLSRQQPQGIKMSETIGQLLAVGNVAEVFEWGSRVVKLYRSPERKLTAFREAAIHAAVEAMAL |
| Ga0210399_114895802 | 3300020581 | Soil | MSETIGRLLAVGNVAEVFECGSRVLKLYRFAVRKP |
| Ga0210405_102245712 | 3300021171 | Soil | MSETIGRLLAVGNVAEVFECGSRVLKLYRFAVRKPTPFREA |
| Ga0210387_112327132 | 3300021405 | Soil | MSETIGRLLAAGQRAEVFEWGSRVVKLCRSTGSKRVTFREAAIHAAV |
| Ga0210384_102222153 | 3300021432 | Soil | MSEIIGHLLAAGQRAEVFEWGSRVVKLYRSTASKTV |
| Ga0210402_109251872 | 3300021478 | Soil | MDETIGRLLAVGNVAEVFEWGSRVLKLYKSTAAKPAA |
| Ga0126371_105509273 | 3300021560 | Tropical Forest Soil | MSNVGRLLAAGNVAEVFEWGSRVVKLYRSPAAKQAAFREAA |
| Ga0126371_118528281 | 3300021560 | Tropical Forest Soil | MSETIGRMLAAGNVAEVFEWGSRVVKLYRSSARKPTAFREA |
| Ga0126371_139332742 | 3300021560 | Tropical Forest Soil | MSEAIGPLIAIGNVAEVFEWGSHVLKLYKSTAAKP |
| Ga0242660_12136462 | 3300022531 | Soil | MSETIGRLLAVGNVAEVFECGSRVLKLYRSAVRKPTAFREAAIH |
| Ga0179591_11767811 | 3300024347 | Vadose Zone Soil | MTETVGRLLAIGNVAEIFEWGSRVLKLYKSTKAKPAAFRGKGSDNISC |
| Ga0207699_102110171 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MSETIGRLLAVGNVAEVFECGSRVLKLYRSAVRKPT |
| Ga0207693_105975511 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MSETIGRLLAVGNVAEVFECGSRVLKLYRSAVRKPTPFREAAIHATVETM |
| Ga0207663_109645902 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MSETIGRLLAVGNVAEVFECGSRVLKLYRSAVRKSTAF |
| Ga0208095_10122811 | 3300027104 | Forest Soil | MSETIGRLLAVGNVAEVFECGSRVLKLYRSAVRKPTAFREAAI |
| Ga0208368_1073302 | 3300027161 | Forest Soil | MSETIGRLLAVGNVAEVFECGSRVLKLYRSAVRKPTA |
| Ga0207948_10024181 | 3300027174 | Forest Soil | MSETIGRLLAVGNVAEVFECGSRVLKLYRSAVRKPTPF |
| Ga0209215_10661912 | 3300027266 | Forest Soil | MNENTGRLLAAGNVAEVFEWGCRIVKLYRSSAAKQA |
| Ga0268247_104722751 | 3300030498 | Agave | MGEAIGRLLAAGNVAEVFELGGRVVKLYRRPEAKPAAFREASVHA |
| Ga0170834_1125766983 | 3300031057 | Forest Soil | MTETIGRLLAARKVAEVFEWGSRVVKLYRSPARKPTAFREAAI |
| Ga0170822_164176552 | 3300031122 | Forest Soil | MSETIGRLLAVGNVAEVFECGSRVLKLYRSAVRKP |
| Ga0318541_106458471 | 3300031545 | Soil | MSETMGRLLAAGQRAEVFEWGSRVVKLCRSTGSKQVIFREA |
| Ga0318528_104233113 | 3300031561 | Soil | MSETMGRLLAAGQRAEVFEWGSRVVKLCRSTGSKQVIFREAAI |
| Ga0310915_106610221 | 3300031573 | Soil | MSETIGRLLAAGNVAEVFEWGSRVVKLYRSSARKPTAFREAAI |
| Ga0310915_109484212 | 3300031573 | Soil | MNETIGRLLAAGNVAEVFEWGSRVVKLYRSSARKPTAFREAAIKGC |
| Ga0318542_106906172 | 3300031668 | Soil | LLAVGNVAEMFEWDARAVKLYQSTAANPAAFREAAI |
| Ga0318574_104580961 | 3300031680 | Soil | MSETMGRLLAAGQRAEVFEWGSRVVKLCRSTGSKQVVFREAAIN |
| Ga0318560_101353034 | 3300031682 | Soil | MSETMGRLLAAGLRAEVFEWGSRVVKLCRSTGSKQV |
| Ga0318560_108204201 | 3300031682 | Soil | MSETVGRLLAAGNVAEVFEWGSRVVKLYRSPARKPTAFREAAIH |
| Ga0310686_1090623192 | 3300031708 | Soil | MSETMGPLLAAGQRAEVFEWGDRVVKLCRSTGSKQ |
| Ga0310686_1098068002 | 3300031708 | Soil | MNERIGRWLAVGDVAEIFEWGSRVVKLYKSTACSRRL |
| Ga0306917_105087222 | 3300031719 | Soil | MSETMGRLLAAGQRAEVFEWGSRVVKLCRSTGSKQVIFRE |
| Ga0307469_111056542 | 3300031720 | Hardwood Forest Soil | MSESIGRLLAAGNMAEVFEWGSSVVKLYLSVRSGKPTVFREAGNHAAVEALGL |
| Ga0307469_114011661 | 3300031720 | Hardwood Forest Soil | MTETMGQLLAVGNVAEIFEWGSRVLKFYKSTDAKPAAFREAAIHAAAEAL |
| Ga0306918_103029041 | 3300031744 | Soil | MSETIGRLLAAGNVAEVFEWGSRVVKLYRSSARKPAA |
| Ga0306918_107767822 | 3300031744 | Soil | MSETMGRLLAAGQRAEVFEWGSRVVKLCRSTGSKQVV |
| Ga0306918_115087851 | 3300031744 | Soil | MSETIGRLLAAGNVAEVFEWGSRVVKLCRSPARKPTAFREAAIHAAV |
| Ga0318492_101530451 | 3300031748 | Soil | MNETIGRLLAAGNVAEVFEWGSRVMKLYRSPAKKPTAF |
| Ga0318509_105233171 | 3300031768 | Soil | MSETIGRLLAAGNVAEVFEWGSRVVKLYRSSARKP |
| Ga0318543_102183014 | 3300031777 | Soil | MSETIGRLLAAGNVAEVFEWGSRVVKLYRSPARKTTAFREA |
| Ga0318543_105846881 | 3300031777 | Soil | MSETMGRLLAAGQRAEVFEWGSRVVKLCRSTGSKQVVFREAAI |
| Ga0318508_11719081 | 3300031780 | Soil | MSETMGRLLAAGQRAEVFEWGSRVVKLCRSTGSKQVIFREAAINA |
| Ga0318552_100821763 | 3300031782 | Soil | MNETIGRLLAAGNVAEVFEWGSRVMKLYRSPAKKPTAFREAAIHAAVEA |
| Ga0318548_100048257 | 3300031793 | Soil | MNETIGRLLAAGNVAEVFEWGSRVMKLYRSPAKKPTAFREAAIH |
| Ga0318548_101236062 | 3300031793 | Soil | MSETMGRLLAAGLRAEVFEWGSRVVKLCRSAGSKQVIFREAAINA |
| Ga0310917_103733292 | 3300031833 | Soil | MSETIGRLLAAGNVAEVFEWGSRVVKLYRSSARKPA |
| Ga0310917_106176691 | 3300031833 | Soil | MSETMGRVLAAGQRAEVFEWGCRVVKLCRSTGSKQVTFREAAINAAVEA |
| Ga0310917_109657701 | 3300031833 | Soil | MSETIGRLLAAGNVAEVFEWGARVVKLYRSPARKPTAFREAAIHAA |
| Ga0318511_102887881 | 3300031845 | Soil | MSETMGRLLAAGLRAEVFEWGSRVVKLCRSTGSKQVIFREAAINAAVEA |
| Ga0318511_105156162 | 3300031845 | Soil | MESSRCWTMSDTVGRLLAAGNVAEVFEWDFRVVKLYRSPTAKPAAFREAAIHAAVEEI |
| Ga0306919_109700021 | 3300031879 | Soil | MSETMGRLLAAGQRAEVFEWGSRVVKLCRSTGSKQVIFREAAINAAVEAL |
| Ga0306925_105986333 | 3300031890 | Soil | MSETIGRLLAAGNVAEVFAWGSRVVKLYRSAARKPAAFRE |
| Ga0306925_106763591 | 3300031890 | Soil | MSETIGRLLAAGNVAEVFEWGSRVVKLYRSSARKPTPLREA |
| Ga0306925_112007772 | 3300031890 | Soil | MSETMGRLLAAGQRAEVFEWGCRVVKLCRSTGSKQVIFR |
| Ga0306925_116081722 | 3300031890 | Soil | MSETMGRLLAAGQRAEVFEWGSRVVKLCRSTGSKQVIFREAAINAAVEALG |
| Ga0318536_103446171 | 3300031893 | Soil | MSETMGRLLAAGLRAEVFEWGSRVVKLCRSAGSKQVIFREAAI |
| Ga0318520_103845801 | 3300031897 | Soil | MSETIGRLLAAGNVAEVFEWGSRVVKLYRSSARKPTAFR |
| Ga0306923_121299651 | 3300031910 | Soil | MSETIGRLLAAGNVAEVFEWGSRVVKLYRSSARKLTAFREA |
| Ga0306921_105718981 | 3300031912 | Soil | MSETIGRLLGTGNVAEVFEWGSHVVKLYRSARKPMAFHE |
| Ga0306921_115880061 | 3300031912 | Soil | MSETMGRLLAAGQRAEVFEWGSRVVKLCRSTGSKQVIF |
| Ga0306921_116141783 | 3300031912 | Soil | MSETMGRLLAAGQRAEVFEWGSRVVKLCRSTGSKQV |
| Ga0310912_105561241 | 3300031941 | Soil | MSETMGRLLAAGQRAEVFEWGSRVVKLCRSTGSKQVIFREAA |
| Ga0310912_109165631 | 3300031941 | Soil | MNETIGRLLAVGNVAEVFEWGARVVKLYKSAAAKP |
| Ga0310912_109350402 | 3300031941 | Soil | MSETMGRLLAAGQRAEVFEWGARVVKLCRSTGSKQVIFREA |
| Ga0310912_110726822 | 3300031941 | Soil | MSETMGRLLAAGQRAEVFEWGCRVVKLCRSTGSKQVIFREAAINAAVE |
| Ga0310916_103901051 | 3300031942 | Soil | MESSRCWTMSDTVGRLLAAGNVAEVFEWDFRVVKLYRSPTA |
| Ga0310916_109247251 | 3300031942 | Soil | MSETMGRLLAAGQRAEVFEWGARVVKLCRSTGSKQVIFREAAINAA |
| Ga0310913_111920571 | 3300031945 | Soil | MNETIGRLLAAGNVAEVFEWGSRVVKLYRSSARKPTAFRE |
| Ga0310910_109277671 | 3300031946 | Soil | MSETIGRLLAAGNVAEVFEWGSRVVKLYRSPARKPTAFREAAIHA |
| Ga0310909_108251874 | 3300031947 | Soil | MSETIGRLLAAGNVAEVFEWGSRVVKLYRSPARKTTAFR |
| Ga0306926_120585121 | 3300031954 | Soil | MSETIGRLLAAGNVAEVFEWGSRVVKLYRSSARKPMAFREAAIHAAV |
| Ga0306926_122499851 | 3300031954 | Soil | MSETMGRLLAAGQRAEVFEWGSRVVKLCRSTGSKQVIFREAAINAAV |
| Ga0318530_103260841 | 3300031959 | Soil | MSETMGRLLAAGQRAEVFEWGSRVVKLCRSTGSKQVVFRE |
| Ga0318531_103965911 | 3300031981 | Soil | MSETIGRLLAAGNVAEVFEWGSRVVKLYRSSARKPTAFREAIHAAV |
| Ga0318531_104211662 | 3300031981 | Soil | MNERIGRLLAVGNVAEVFEWGARAVKLYQSTACSS |
| Ga0306922_105685481 | 3300032001 | Soil | MNETIGCLLAVGNVAEVFEWGARVVKLYKSAAAKPAAF |
| Ga0306922_112504712 | 3300032001 | Soil | MMSETIGRLLAAGNVAEVFEWGSRVVKLYRSPARKPTAFREAAIHS |
| Ga0306922_118317611 | 3300032001 | Soil | MSETMCRLLAAGQRAEVFEWGSCGVKLCRSTGSKQVIFREAAINAAV |
| Ga0310911_103649631 | 3300032035 | Soil | MSETMGRLLAAGQRAEVFEWGSRVVKLCRSTGSKQVIFREAAINAAVEA |
| Ga0310911_105256961 | 3300032035 | Soil | MSETIGRLLAAGNVAEVFEWGSRVVKLYRSSARKPTPLREAAVHAAV |
| Ga0318533_108670351 | 3300032059 | Soil | MSDNVGRLLAAGNVAEVFEWDCRVVKLYRSPAAKPAAFREAAIHAAV |
| Ga0318533_109000372 | 3300032059 | Soil | MSETIGRLLAVGQRAEVFEWGSRVVKLCRSPGSKQ |
| Ga0318533_109705612 | 3300032059 | Soil | MSKTVRRLLAAGNVAEVFEWGSRVVKLYRSPAAKQA |
| Ga0318504_101048391 | 3300032063 | Soil | MESSRCWTMSDTVGRLLAAGNVAEVFEWDFRVVKLYRSPTAKPAAFREAA |
| Ga0306924_101916151 | 3300032076 | Soil | MSETMCRLLAAGQRAEVFEWGSCGVKLCRSTGSKQVI |
| Ga0306924_105082022 | 3300032076 | Soil | MNETIGRLLAAGNVAEVFEWGSRVVKLYRSSARKPTAFREAA |
| Ga0306924_123004441 | 3300032076 | Soil | MSETMGRLLAAGQRAEVFEWGSRVVKLCRSTGSKQVIFR |
| Ga0307472_1002535791 | 3300032205 | Hardwood Forest Soil | MSESIGRLLAAGNVAEVFEWGSRVVKLYRSTVANQTVFREAAN |
| Ga0306920_1004064945 | 3300032261 | Soil | MNETIGRLLAVGNVAEVFEWGARVVKLYKSAAAKPAAF |
| Ga0306920_1008576771 | 3300032261 | Soil | MSETMGRLLAAGQRAEVFEWGSRVVKLCRSTGSKQEIFREAAINAAEAL |
| Ga0306920_1012232311 | 3300032261 | Soil | MSETMGRLLAAGQRAEVFEWGCRVVKLCRSTGSKQVIFREAAINAAVEA |
| Ga0335080_102229731 | 3300032828 | Soil | MEEAIGRTLATGNTAEIFEWGSRVMKLFRSPEAKRAAFHEA |
| Ga0310914_107172351 | 3300033289 | Soil | MSETMGRLLAAGQRAEVFEWGCRVVKLCRSTGSKQVIFREAAINAAVEALG |
| Ga0310914_110130201 | 3300033289 | Soil | MSETIGRLLAAGQRAEVFEWGSRVVKLCRSTGSKQVIFREAAI |
| Ga0310914_113077531 | 3300033289 | Soil | MSETMGRLLAAGQRAEVFEWGSRVVKLCRSTGSKQVIFREAAINAAVE |
| Ga0310914_117399182 | 3300033289 | Soil | MSKTVRRLLAAGNVAEVFEWGSRVVKLYRSPAAKQ |
| ⦗Top⦘ |