


| Basic Information | |
|---|---|
| Family ID | F051003 |
| Family Type | Metagenome |
| Number of Sequences | 144 |
| Average Sequence Length | 44 residues |
| Representative Sequence | GELVAALPAGLPLAIEAPCRATADLPALERARRAYRALSALGGA |
| Number of Associated Samples | 130 |
| Number of Associated Scaffolds | 144 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 7.69 % |
| % of genes near scaffold ends (potentially truncated) | 91.67 % |
| % of genes from short scaffolds (< 2000 bps) | 90.28 % |
| Associated GOLD sequencing projects | 126 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (89.583 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.278 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.944 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (34.028 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.17% β-sheet: 0.00% Coil/Unstructured: 70.83% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 144 Family Scaffolds |
|---|---|---|
| PF00296 | Bac_luciferase | 13.89 |
| PF14833 | NAD_binding_11 | 7.64 |
| PF00378 | ECH_1 | 6.25 |
| PF09995 | MPAB_Lcp_cat | 6.25 |
| PF01323 | DSBA | 4.17 |
| PF13561 | adh_short_C2 | 3.47 |
| PF00067 | p450 | 3.47 |
| PF02738 | MoCoBD_1 | 3.47 |
| PF00903 | Glyoxalase | 2.78 |
| PF00578 | AhpC-TSA | 2.78 |
| PF10049 | DUF2283 | 2.78 |
| PF01546 | Peptidase_M20 | 2.08 |
| PF01451 | LMWPc | 2.08 |
| PF13191 | AAA_16 | 1.39 |
| PF00106 | adh_short | 1.39 |
| PF05721 | PhyH | 1.39 |
| PF12773 | DZR | 1.39 |
| PF13458 | Peripla_BP_6 | 0.69 |
| PF01436 | NHL | 0.69 |
| PF05378 | Hydant_A_N | 0.69 |
| PF04879 | Molybdop_Fe4S4 | 0.69 |
| PF00156 | Pribosyltran | 0.69 |
| PF01402 | RHH_1 | 0.69 |
| PF02566 | OsmC | 0.69 |
| PF00211 | Guanylate_cyc | 0.69 |
| PF01850 | PIN | 0.69 |
| PF09972 | DUF2207 | 0.69 |
| PF00528 | BPD_transp_1 | 0.69 |
| PF03446 | NAD_binding_2 | 0.69 |
| PF00285 | Citrate_synt | 0.69 |
| PF04909 | Amidohydro_2 | 0.69 |
| PF12681 | Glyoxalase_2 | 0.69 |
| PF02574 | S-methyl_trans | 0.69 |
| PF07690 | MFS_1 | 0.69 |
| PF00884 | Sulfatase | 0.69 |
| PF02126 | PTE | 0.69 |
| PF01370 | Epimerase | 0.69 |
| PF09585 | Lin0512_fam | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
|---|---|---|---|
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 13.89 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 3.47 |
| COG0145 | N-methylhydantoinase A/oxoprolinase/acetone carboxylase, beta subunit | Amino acid transport and metabolism [E] | 1.39 |
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.39 |
| COG0372 | Citrate synthase | Energy production and conversion [C] | 0.69 |
| COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 0.69 |
| COG1735 | Predicted metal-dependent hydrolase, phosphotriesterase family | General function prediction only [R] | 0.69 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.69 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.69 |
| COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 0.69 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.58 % |
| Unclassified | root | N/A | 10.42 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_100655634 | Not Available | 604 | Open in IMG/M |
| 3300000881|JGI10215J12807_1187920 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300000891|JGI10214J12806_10747147 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300001661|JGI12053J15887_10508343 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300002121|C687J26615_10096677 | Not Available | 740 | Open in IMG/M |
| 3300002899|JGIcombinedJ43975_10090398 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
| 3300004020|Ga0055440_10044976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 953 | Open in IMG/M |
| 3300004024|Ga0055436_10160732 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 689 | Open in IMG/M |
| 3300004156|Ga0062589_101294197 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300005172|Ga0066683_10593849 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300005178|Ga0066688_10970767 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300005295|Ga0065707_10503429 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 755 | Open in IMG/M |
| 3300005343|Ga0070687_101331916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 534 | Open in IMG/M |
| 3300005353|Ga0070669_100333866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1227 | Open in IMG/M |
| 3300005439|Ga0070711_100429005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingopyxis → Sphingopyxis macrogoltabida | 1079 | Open in IMG/M |
| 3300005444|Ga0070694_100757584 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 793 | Open in IMG/M |
| 3300005446|Ga0066686_10377529 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300005446|Ga0066686_10410232 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 926 | Open in IMG/M |
| 3300005540|Ga0066697_10009024 | All Organisms → cellular organisms → Bacteria | 5064 | Open in IMG/M |
| 3300005544|Ga0070686_101300930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 607 | Open in IMG/M |
| 3300005546|Ga0070696_101977072 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005577|Ga0068857_100092151 | All Organisms → cellular organisms → Bacteria | 2713 | Open in IMG/M |
| 3300005617|Ga0068859_100151122 | All Organisms → cellular organisms → Bacteria | 2397 | Open in IMG/M |
| 3300005843|Ga0068860_101732366 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300005876|Ga0075300_1039045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 660 | Open in IMG/M |
| 3300005879|Ga0075295_1000769 | All Organisms → cellular organisms → Bacteria | 1968 | Open in IMG/M |
| 3300005879|Ga0075295_1025309 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300005880|Ga0075298_1003370 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1102 | Open in IMG/M |
| 3300006047|Ga0075024_100295768 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 792 | Open in IMG/M |
| 3300006797|Ga0066659_11285619 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300006846|Ga0075430_100543873 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300006853|Ga0075420_101659681 | Not Available | 547 | Open in IMG/M |
| 3300006854|Ga0075425_100024357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 6661 | Open in IMG/M |
| 3300006854|Ga0075425_101916617 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300006880|Ga0075429_101443368 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300006881|Ga0068865_101232790 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300006918|Ga0079216_10389077 | Not Available | 870 | Open in IMG/M |
| 3300006969|Ga0075419_11514866 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300007076|Ga0075435_101311555 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300007265|Ga0099794_10015617 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3356 | Open in IMG/M |
| 3300009038|Ga0099829_10219659 | All Organisms → cellular organisms → Bacteria | 1543 | Open in IMG/M |
| 3300009089|Ga0099828_11812299 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300009090|Ga0099827_10514838 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300009090|Ga0099827_10635065 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 921 | Open in IMG/M |
| 3300009156|Ga0111538_12046018 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300009553|Ga0105249_11062452 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 879 | Open in IMG/M |
| 3300009815|Ga0105070_1051746 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300010304|Ga0134088_10244881 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300010304|Ga0134088_10495779 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300010366|Ga0126379_11046313 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300010376|Ga0126381_101228194 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
| 3300010400|Ga0134122_10090522 | All Organisms → cellular organisms → Bacteria | 2407 | Open in IMG/M |
| 3300011270|Ga0137391_10397417 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1178 | Open in IMG/M |
| 3300011441|Ga0137452_1153354 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300012096|Ga0137389_11490606 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 572 | Open in IMG/M |
| 3300012204|Ga0137374_10076740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3259 | Open in IMG/M |
| 3300012349|Ga0137387_10108627 | All Organisms → cellular organisms → Bacteria | 1942 | Open in IMG/M |
| 3300012354|Ga0137366_10071792 | All Organisms → cellular organisms → Bacteria | 2638 | Open in IMG/M |
| 3300012355|Ga0137369_10291859 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300012358|Ga0137368_10265933 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
| 3300012363|Ga0137390_10290074 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
| 3300012363|Ga0137390_11954920 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 513 | Open in IMG/M |
| 3300012907|Ga0157283_10393032 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300012917|Ga0137395_10893142 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300012922|Ga0137394_10117091 | All Organisms → cellular organisms → Bacteria | 2253 | Open in IMG/M |
| 3300012922|Ga0137394_10376497 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1211 | Open in IMG/M |
| 3300012929|Ga0137404_11020350 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300012944|Ga0137410_11971328 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 519 | Open in IMG/M |
| 3300012948|Ga0126375_11209371 | Not Available | 629 | Open in IMG/M |
| 3300012948|Ga0126375_11618423 | Not Available | 558 | Open in IMG/M |
| 3300013306|Ga0163162_10599212 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
| 3300014883|Ga0180086_1131195 | Not Available | 651 | Open in IMG/M |
| 3300015052|Ga0137411_1327903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2717 | Open in IMG/M |
| 3300015241|Ga0137418_10391606 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300015259|Ga0180085_1011290 | All Organisms → cellular organisms → Bacteria | 2442 | Open in IMG/M |
| 3300015371|Ga0132258_11118533 | All Organisms → cellular organisms → Bacteria | 1991 | Open in IMG/M |
| 3300017792|Ga0163161_10560808 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300017930|Ga0187825_10360487 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 552 | Open in IMG/M |
| 3300017939|Ga0187775_10237171 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300017944|Ga0187786_10496692 | Not Available | 552 | Open in IMG/M |
| 3300017961|Ga0187778_10710181 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 680 | Open in IMG/M |
| 3300018053|Ga0184626_10068259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 1496 | Open in IMG/M |
| 3300018060|Ga0187765_10505100 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300018063|Ga0184637_10728972 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300018074|Ga0184640_10064810 | All Organisms → cellular organisms → Bacteria | 1536 | Open in IMG/M |
| 3300018076|Ga0184609_10100070 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
| 3300018076|Ga0184609_10287104 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 770 | Open in IMG/M |
| 3300018077|Ga0184633_10459780 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300018084|Ga0184629_10270379 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 891 | Open in IMG/M |
| 3300018422|Ga0190265_12438613 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300018433|Ga0066667_10432759 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300018482|Ga0066669_10211564 | All Organisms → cellular organisms → Bacteria | 1496 | Open in IMG/M |
| 3300018482|Ga0066669_10513211 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300019487|Ga0187893_10585421 | Not Available | 710 | Open in IMG/M |
| 3300020003|Ga0193739_1034686 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1309 | Open in IMG/M |
| 3300020198|Ga0194120_10004475 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 21534 | Open in IMG/M |
| 3300021090|Ga0210377_10495731 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300021170|Ga0210400_10478674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingopyxis → Sphingopyxis macrogoltabida | 1027 | Open in IMG/M |
| 3300021180|Ga0210396_10831097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingopyxis → Sphingopyxis macrogoltabida | 791 | Open in IMG/M |
| 3300021420|Ga0210394_11290951 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300022534|Ga0224452_1105392 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300022563|Ga0212128_10801296 | Not Available | 560 | Open in IMG/M |
| 3300025538|Ga0210132_1041465 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 669 | Open in IMG/M |
| 3300025538|Ga0210132_1052810 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300025938|Ga0207704_11182269 | Not Available | 652 | Open in IMG/M |
| 3300026035|Ga0207703_10508930 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300026089|Ga0207648_11856261 | Not Available | 564 | Open in IMG/M |
| 3300026285|Ga0209438_1209648 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300026307|Ga0209469_1043771 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1440 | Open in IMG/M |
| 3300026309|Ga0209055_1188939 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300026515|Ga0257158_1049555 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 773 | Open in IMG/M |
| 3300026524|Ga0209690_1267810 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300026548|Ga0209161_10215692 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300026551|Ga0209648_10323374 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300026772|Ga0207596_103234 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300027646|Ga0209466_1044660 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300027765|Ga0209073_10111970 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 975 | Open in IMG/M |
| 3300027765|Ga0209073_10115333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingopyxis → Sphingopyxis macrogoltabida | 962 | Open in IMG/M |
| 3300027775|Ga0209177_10001380 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4269 | Open in IMG/M |
| 3300027775|Ga0209177_10418448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingopyxis → Sphingopyxis macrogoltabida | 541 | Open in IMG/M |
| 3300027846|Ga0209180_10146360 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300028608|Ga0247819_10080218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 1599 | Open in IMG/M |
| 3300028792|Ga0307504_10197095 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300030336|Ga0247826_11320343 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300031548|Ga0307408_102432123 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300031681|Ga0318572_10147337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1358 | Open in IMG/M |
| 3300031736|Ga0318501_10579663 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300031832|Ga0318499_10144593 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300031858|Ga0310892_10309463 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300031944|Ga0310884_10782230 | Not Available | 582 | Open in IMG/M |
| 3300032001|Ga0306922_10334014 | All Organisms → cellular organisms → Bacteria | 1626 | Open in IMG/M |
| 3300032163|Ga0315281_10909072 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 899 | Open in IMG/M |
| 3300032180|Ga0307471_104137299 | Not Available | 512 | Open in IMG/M |
| 3300032205|Ga0307472_102296573 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 546 | Open in IMG/M |
| 3300032261|Ga0306920_102292426 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 748 | Open in IMG/M |
| 3300032893|Ga0335069_12764716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingopyxis → Sphingopyxis macrogoltabida | 503 | Open in IMG/M |
| 3300033412|Ga0310810_11068323 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300033550|Ga0247829_10517535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 989 | Open in IMG/M |
| 3300033551|Ga0247830_11159544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 617 | Open in IMG/M |
| 3300034090|Ga0326723_0564237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingopyxis → Sphingopyxis macrogoltabida | 525 | Open in IMG/M |
| 3300034165|Ga0364942_0205295 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 643 | Open in IMG/M |
| 3300034165|Ga0364942_0243544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300034692|Ga0373917_0069051 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.03% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.56% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.47% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.47% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.47% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.78% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 2.78% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.78% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.08% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.08% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.08% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.08% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.39% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.39% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.39% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.39% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.39% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.69% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.69% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.69% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.69% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.69% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.69% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.69% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.69% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.69% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.69% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.69% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.69% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.69% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.69% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000881 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002121 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 | Environmental | Open in IMG/M |
| 3300002899 | Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607) | Environmental | Open in IMG/M |
| 3300004020 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004024 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005876 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 | Environmental | Open in IMG/M |
| 3300005879 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301 | Environmental | Open in IMG/M |
| 3300005880 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_201 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015259 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300020198 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65m | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
| 3300025538 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026772 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08A2-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
| 3300034692 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A0.3 | Engineered | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1006556342 | 3300000364 | Soil | GVLPLKELVASLPANLPLAIEAPCRATADLPALERAQRAYRALADLTGV* |
| JGI10215J12807_11879201 | 3300000881 | Soil | LPIDAPLAIEAPVRAMVHLPALERAQRAYQALSALLGA* |
| JGI10214J12806_107471472 | 3300000891 | Soil | ALPLAVEAPCRATADLPAVERAKRAHQALSALLQSREE* |
| JGI12053J15887_105083431 | 3300001661 | Forest Soil | GVPLAIEAPCRATANLPALERAKLAYRALTDLTGA* |
| C687J26615_100966771 | 3300002121 | Soil | LPLAVEAPCGATAALPAVERARRAYRALAALVGA* |
| JGIcombinedJ43975_100903982 | 3300002899 | Soil | LLPGDGVLPLRELVRALPAGVPLAIEAPVRATGHLPALERAQRAYQALSDLLAG* |
| Ga0055440_100449762 | 3300004020 | Natural And Restored Wetlands | VLPLAELVAALPEGVPLAIEAPSRVSADLPALERAKRAYRALSTLVTS* |
| Ga0055436_101607321 | 3300004024 | Natural And Restored Wetlands | LPAGTPLAIEAPCRAHAELPAVERAKRAYQALSTLVSTCGG* |
| Ga0062589_1012941971 | 3300004156 | Soil | LVAALPADLPLAIEAPCRATAELPALERARRAYQALAALSGV* |
| Ga0066683_105938491 | 3300005172 | Soil | GVLPLAALVAALPPDVPLAIEAPCRATAHLPALERAQRAYRALTALVAPSA* |
| Ga0066688_109707672 | 3300005178 | Soil | AALPAGAPLAIEAPCRATADLPAPERAKRAFRALSALAGA* |
| Ga0065707_105034291 | 3300005295 | Switchgrass Rhizosphere | LPAGIPLAIEAPSRATADLPALERAKRAYRALSALVGAGAA* |
| Ga0070687_1013319161 | 3300005343 | Switchgrass Rhizosphere | DLVAALPPDLPLAIEAPCRATATLSALERARRAYRALTNLTGA* |
| Ga0070669_1003338661 | 3300005353 | Switchgrass Rhizosphere | VLPLKELVAALPRSLPLAIEAPCRATAGLPALDRAKRAYRALADLVGA* |
| Ga0070711_1004290051 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | ALPDGIPLAIEAPCRATAELPAVERARRAHQALSKLPGIRAA* |
| Ga0070694_1007575841 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | EGVLPLAELVAALPDTAPLAVEAPCRAIADLPALERAKRAHRTLSALVQSATERGHGD* |
| Ga0066686_103775293 | 3300005446 | Soil | GDGVLPLAELVAALPATAPLAVEAPCRAIADLTPVERAKRAHQALSALLQAG* |
| Ga0066686_104102322 | 3300005446 | Soil | PLRELVAALPPGVPLAVEAPCRATAQLPAEERAKRAYQALSGLLGAT* |
| Ga0066697_100090246 | 3300005540 | Soil | AELVAALPAGAPLAIEAPCRATADLPAPERAKRAFRALSALTGA* |
| Ga0070686_1013009301 | 3300005544 | Switchgrass Rhizosphere | ELVAALPRSLPLAIEAPCRATAGLPALDRAKRAYRALADLVGA* |
| Ga0070696_1019770721 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | PLRELVAALPPGLPLAIEAPDRTTAHLPALERAKRAHRALTALLAPA* |
| Ga0068857_1000921512 | 3300005577 | Corn Rhizosphere | VLPLAELVAALPDTLPLAVEAPCRATADLPAVERATRAYRALSALLQGREE* |
| Ga0068859_1001511221 | 3300005617 | Switchgrass Rhizosphere | AVEAPCRATADLPAVERAKRAHRAISTLLQCREE* |
| Ga0068860_1017323661 | 3300005843 | Switchgrass Rhizosphere | GVLPLAELVAALPDGMPLSVEAPCRDTAHLPAAERARRAYRALEALLQTPE* |
| Ga0075300_10390452 | 3300005876 | Rice Paddy Soil | LRELVAALPPGIPLAIEAPCRATAELPAVERAKRAHRALAALVGEARPAR* |
| Ga0075295_10007694 | 3300005879 | Rice Paddy Soil | RELVAALPAGIPLAIEAPCRETADLPAVERGKRAYRALAALVGGARPA* |
| Ga0075295_10253091 | 3300005879 | Rice Paddy Soil | VPLAIEAPCRATADLPASERAKRAYRALSALLAT* |
| Ga0075298_10033701 | 3300005880 | Rice Paddy Soil | PGEGGLLLAELVAALSDGVPLAIEASCRATADLPASERAKRAYRALSALLAT* |
| Ga0075024_1002957681 | 3300006047 | Watersheds | LPAGVPLAIEAPCRATAELPAVERARRAYRALSGLVG* |
| Ga0066659_112856191 | 3300006797 | Soil | GEGVLPLAALITALPDTVPLAVEAPCRATADLPAVERAKRAYRALTALMPSSA* |
| Ga0075430_1005438732 | 3300006846 | Populus Rhizosphere | GVLPLAELVAALPPDVPLAIEAPCRATVNLSALERARRAHRALSSLLAPR* |
| Ga0075420_1016596811 | 3300006853 | Populus Rhizosphere | ALPPDLPLAIEAPCRATAGLPALERARRAYRALVDLAGA* |
| Ga0075425_1000243571 | 3300006854 | Populus Rhizosphere | LPAGAPLAIEAPCRATAELPAPERARRAFRALSALTGA* |
| Ga0075425_1019166172 | 3300006854 | Populus Rhizosphere | ADLVAALPATAALAVEAPNRATAHLPAVERARRAYQALSALV* |
| Ga0075429_1014433681 | 3300006880 | Populus Rhizosphere | KELVAALPADLPLAIEAPCRATLDLPALERAKRAYRALADVAGA* |
| Ga0068865_1012327901 | 3300006881 | Miscanthus Rhizosphere | LVAALPPDLPLAIEAPCRATATLSALERARRAYRALTNLTGA* |
| Ga0079216_103890771 | 3300006918 | Agricultural Soil | LIEALPAGVPLAIESPCRASADLPALERAKRAYRALSALTGA* |
| Ga0075419_115148661 | 3300006969 | Populus Rhizosphere | AELVAALPAGIPLAIEAPSRATADLPALERAKRAYRALSALLAR* |
| Ga0075435_1013115551 | 3300007076 | Populus Rhizosphere | LVAALPDTVPLAIEAPCRATADLPAVERAKRAYRALSTLVPSSV* |
| Ga0099794_100156175 | 3300007265 | Vadose Zone Soil | PLAELVAALPAGVPLAIEAPCRATAELPAVERARRAYRALSGLVG* |
| Ga0099829_102196594 | 3300009038 | Vadose Zone Soil | LPLEELVAALPAVPLAIEAPCRATAELPGVERAKRAYRTLSALVSRED* |
| Ga0099828_118122991 | 3300009089 | Vadose Zone Soil | TAPLAVEAPCRATADLPAVERAKRAYQALSRLAL* |
| Ga0099827_105148382 | 3300009090 | Vadose Zone Soil | GEGVLPLAELVAALPDTVPLAVEAPCRATADLPAVERATRAYQTLSALLRARTE* |
| Ga0099827_106350652 | 3300009090 | Vadose Zone Soil | PAGVPLAIEAPCRATADLPALERSKRAYRALTALEGA* |
| Ga0111538_120460181 | 3300009156 | Populus Rhizosphere | GVLPLAELVAALPADAALAVEAPCRATAELPALERARRAYRALTGLLASTG* |
| Ga0105249_110624524 | 3300009553 | Switchgrass Rhizosphere | LRDLVAALPPELPLAVEAPSRATADLPAAERARRAYRALGALLETPNH* |
| Ga0105070_10517462 | 3300009815 | Groundwater Sand | PDDVPLAIEAPCRATAALPALERAKRAYRALTALQSSR* |
| Ga0134088_102448811 | 3300010304 | Grasslands Soil | GEGVLPLAELVGLLPPTVPLAIEAPCRATAELPAAERAKRAYRALTALLEKS* |
| Ga0134088_104957791 | 3300010304 | Grasslands Soil | LIAALPAAAPVAIEAPCRATADLPAVERARRAYRALSKLVL* |
| Ga0126379_110463131 | 3300010366 | Tropical Forest Soil | LPLAIEAPCRATADLPAVERARRAHRALSALLDTSAR* |
| Ga0126381_1012281941 | 3300010376 | Tropical Forest Soil | AALPDAVPLAVEAPCRATADLPAIERARRAHRSLSALVGAGKA* |
| Ga0134122_100905223 | 3300010400 | Terrestrial Soil | PPGLPLAIEAPDRTTAHLPAFDRAQRAHRALTALLAPA* |
| Ga0137391_103974173 | 3300011270 | Vadose Zone Soil | PLRELVAALPAGVPLAIEAPCRSTADLPAVERAKRAYRALSALLTS* |
| Ga0137452_11533542 | 3300011441 | Soil | LVMALPDSVPLAIEAPCRETAHLPALERATRAYRALSTLTGA* |
| Ga0137389_114906062 | 3300012096 | Vadose Zone Soil | LVAALPAGVPLAIEAPCRATAELPPAERARRAYAALSALVG* |
| Ga0137374_100767405 | 3300012204 | Vadose Zone Soil | LSLEELVAALPAVPLAIEAPCRATAELPAVERAKRAYRTLSALVSRED* |
| Ga0137387_101086273 | 3300012349 | Vadose Zone Soil | LPLEELVAALPAVPLAIEAPCRATAELPAVERAKRAYRTLSALVSRED* |
| Ga0137366_100717922 | 3300012354 | Vadose Zone Soil | ALPDAVPLAVEAPCRATADLPAVERARRAHQALSALLSAGKA* |
| Ga0137369_102918593 | 3300012355 | Vadose Zone Soil | LPLEELVAALPAVPLAIEAPCWATAELPAVERAKRAYRTLSALVSRED* |
| Ga0137368_102659334 | 3300012358 | Vadose Zone Soil | LPLEELVAALPAVPLAIEALCRATAELPAVERAKRAYRTLSALVSRED* |
| Ga0137390_102900742 | 3300012363 | Vadose Zone Soil | VAALPAVPLAIEAPCRATAELPGVERAKRAYRTLSALVSRED* |
| Ga0137390_119549202 | 3300012363 | Vadose Zone Soil | AELVAALPAGVPLAIEAPCRATAELPPVERAKRAYAALSALVG* |
| Ga0157283_103930321 | 3300012907 | Soil | PDALPLAVEAPCRATADLPAVERAKRAHQALSALLQSLGE* |
| Ga0137395_108931422 | 3300012917 | Vadose Zone Soil | ELVAALPAGLPLAIEAPCRATADLPALERAQRAFRALTDLRGA* |
| Ga0137394_101170911 | 3300012922 | Vadose Zone Soil | DVPLAIEAPCRATADLPAVERAKRAYRALAGLTGA* |
| Ga0137394_103764973 | 3300012922 | Vadose Zone Soil | AALPDGIPLAIEAPSRATADLPALERARRAYQALSALLAS* |
| Ga0137404_110203501 | 3300012929 | Vadose Zone Soil | LAELIAALPAGAPLAIEAPCRATADLPAPERAKRAFRALSALIGA* |
| Ga0137410_119713282 | 3300012944 | Vadose Zone Soil | AALPATAPLAVEAPCRALADLSPVERAKRAYQALSALLT* |
| Ga0126375_112093711 | 3300012948 | Tropical Forest Soil | PIAIEAPCRATAELPAAERAKRAYRALTALLEKS* |
| Ga0126375_116184232 | 3300012948 | Tropical Forest Soil | LPGEGVLPLADLVAMLPADAALAIEAPCRATTDLPAGERARRAYHALSALVGSR* |
| Ga0163162_105992122 | 3300013306 | Switchgrass Rhizosphere | PLAELVAALPPAAPVAIEAPCRDTAHLPAVERAKRAYQSLTELLARSHR* |
| Ga0180086_11311952 | 3300014883 | Soil | AELVAALPESAPLAIEAPCRATADLPAIERAKRAYQALSALVERATG* |
| Ga0137411_13279038 | 3300015052 | Vadose Zone Soil | LPLAELVAALPDDVPLAIEAPCRATADLPALERAKRAYQALARLQSSR* |
| Ga0137418_103916062 | 3300015241 | Vadose Zone Soil | PGLPLAIEAPCRATAELPALERASRAYRALTALLGAS* |
| Ga0180085_10112904 | 3300015259 | Soil | AALPDGVPLAIEAPCRATADLPALGRAKRAYRALSALLTS* |
| Ga0132258_111185333 | 3300015371 | Arabidopsis Rhizosphere | AALPPDLPLAIEAPCRATASLPALERARRAHRALADLTGS* |
| Ga0163161_105608082 | 3300017792 | Switchgrass Rhizosphere | DLVAALPPDLPLAIEAPCRATATLSALERARRAYRALTNLTGA |
| Ga0187825_103604872 | 3300017930 | Freshwater Sediment | GVPLAIEAPCRATAELPAVERARRAYQALSALVDGVRPA |
| Ga0187775_102371712 | 3300017939 | Tropical Peatland | ALPLRELVAALPAGLPLAIEAPCRATADLPAVERARRAHRALSALLQPR |
| Ga0187786_104966921 | 3300017944 | Tropical Peatland | GALPLRELVAALPAGLPLAIEAPCRATADLPAVERARRAHRALSALLQPR |
| Ga0187778_107101811 | 3300017961 | Tropical Peatland | PTVPLAIEAPSRATANLPAVERAKRAYRALSALLQAAHPPVG |
| Ga0184626_100682592 | 3300018053 | Groundwater Sediment | PLKELVAALPLDVPLAIEAPCRATVDLPAVERAKRAHRALAALAGA |
| Ga0187765_105051002 | 3300018060 | Tropical Peatland | DGLPLAIEAPCRETAHLPALERARRAHAALSALVRRETA |
| Ga0184637_107289721 | 3300018063 | Groundwater Sediment | LAVEAPCRATANLPAVERATRAYQTLSALLRARTE |
| Ga0184640_100648103 | 3300018074 | Groundwater Sediment | LPLAELVATLPGNVPLAIEAPCRATAELPAVERAKRAYGALSALVSRED |
| Ga0184609_101000702 | 3300018076 | Groundwater Sediment | LPLEELVAALPAVPLAIEAPCRATAELPAVERAKRAYRTLSALVSRED |
| Ga0184609_102871041 | 3300018076 | Groundwater Sediment | PLAELVAALPDDLPLAVEAPCRATADLPAVERARRAYRALAVLRQTQTVTRAEDAC |
| Ga0184633_104597801 | 3300018077 | Groundwater Sediment | LPAAVPLAVEAPCRATADLPAVERATRAYQALSALLLARTE |
| Ga0184629_102703792 | 3300018084 | Groundwater Sediment | LPLRELVAALPAGVPLAIEAPCRATADLPAVERAKRAYQALSALLTS |
| Ga0190265_124386131 | 3300018422 | Soil | LAELVASLPPDVPLAIEAPCRATAELPALERAKRAYRALTALTVSV |
| Ga0066667_104327592 | 3300018433 | Grasslands Soil | GEGVLPLAALITALPDTVPLAVEAPCRATADLPAVERAKRAYRALTALMPSSA |
| Ga0066669_102115641 | 3300018482 | Grasslands Soil | PATVPLAIEAPNRATADLPAVERAKRAYRALAALTGA |
| Ga0066669_105132112 | 3300018482 | Grasslands Soil | LRELVAALPPGLPLAIEAPCRATAERPALERASRAYRALTALLGAS |
| Ga0187893_105854213 | 3300019487 | Microbial Mat On Rocks | PRELVAALPPGVPLAIEAPCRATADLPALERARRAYQALSALVAS |
| Ga0193739_10346861 | 3300020003 | Soil | VLPLRELVAALPAGIPLAIEAPCRSTADLPAVERAKRAYRALSALLTS |
| Ga0194120_100044751 | 3300020198 | Freshwater Lake | RALVAALPADAPLAIEAPCRDTAGLPALERAKRAYRALTALVA |
| Ga0210377_104957313 | 3300021090 | Groundwater Sediment | VAALPAGVPLAIEAPCRATADLPAVERAKRAYQALSTLLSTCSV |
| Ga0210400_104786741 | 3300021170 | Soil | AALPDGIPLAIEAPCRATAELPAVERARRAHQALSKLPGIRAA |
| Ga0210396_108310971 | 3300021180 | Soil | LAELVAALPDGIPLAIEAPCRATAELPAVERARRAHQALSKLPGIRAA |
| Ga0210394_112909511 | 3300021420 | Soil | VLPLTELVAALPAGVPLAIEAPSRATVELPALERARRAYRAMSALVGAGSV |
| Ga0224452_11053921 | 3300022534 | Groundwater Sediment | LPLEELVAALPAVPLAIEAPCRATAELPAVERAKRAYRTLSALVSREG |
| Ga0212128_108012962 | 3300022563 | Thermal Springs | AGAPLAVEAPRRATAHLPAVERATRAYRALAALSPG |
| Ga0210132_10414651 | 3300025538 | Natural And Restored Wetlands | LPLAELVAALPEGVPLAIEAPSRVSADLPALERAKRAYRALSTLVTS |
| Ga0210132_10528102 | 3300025538 | Natural And Restored Wetlands | PAGTPLAIEAPCRAHAELPAVERAKRAYQALSTLVSTCGG |
| Ga0207704_111822692 | 3300025938 | Miscanthus Rhizosphere | LVAALPPDLPLAIEAPCRATATLSALERARRAYRALTNLTGA |
| Ga0207703_105089301 | 3300026035 | Switchgrass Rhizosphere | LPLAELVAALPDALPLAVEAPCRATADLPAVERAKRAHQALSALLQSREE |
| Ga0207648_118562611 | 3300026089 | Miscanthus Rhizosphere | PRSLPLAIEAPCRATAGLPALDRAKRAYRALADLVGA |
| Ga0209438_12096482 | 3300026285 | Grasslands Soil | ALPDGIPLAIEAPSRATADLPALERARRAYQALSALLAS |
| Ga0209469_10437713 | 3300026307 | Soil | LPATAPLAVEAPCRALADLLPVERAKRAYQALSALLT |
| Ga0209055_11889392 | 3300026309 | Soil | GELVAALPAGLPLAIEAPCRATADLPALERARRAYRALSALGGA |
| Ga0257158_10495551 | 3300026515 | Soil | AELVAALPAGVPLAIEAPCRATAELPAVERARRAYAALSTLVG |
| Ga0209690_12678101 | 3300026524 | Soil | LPLAELVAALPAGAPLAIEAPCRATADLPAPERAKRAFRALSALTGA |
| Ga0209161_102156921 | 3300026548 | Soil | AELVAALPAGAPLAIEAPCRATADLPAPERAKRAFRALSALTGA |
| Ga0209648_103233741 | 3300026551 | Grasslands Soil | SAPLAIEAPCRATADLPAVERAKRAYRALSVLVGDCGSS |
| Ga0207596_1032342 | 3300026772 | Soil | LPSDVPLAIEAPVRAMAHLPALERAQRAYQALSALLGA |
| Ga0209466_10446601 | 3300027646 | Tropical Forest Soil | LPLAELVAALPAGAPLAIEAPSRATANLPALERATRAYRALTSLAGA |
| Ga0209073_101119701 | 3300027765 | Agricultural Soil | LRELVAALPAGIPLAIEAPVRATAALPPLERARRAHRALTALLDQGSR |
| Ga0209073_101153331 | 3300027765 | Agricultural Soil | ELVAALPAGVPLAIEAPCRATAELPAVERATRAYRALSALVGGGAPRPSG |
| Ga0209177_100013801 | 3300027775 | Agricultural Soil | ALPLRELVAALPAGIPLAIEAPVRATAALPPLERARRAHRALAALLDQGSR |
| Ga0209177_104184481 | 3300027775 | Agricultural Soil | PLAIEAPCRATAELPALERARHAYQALSKLPGIREA |
| Ga0209180_101463604 | 3300027846 | Vadose Zone Soil | LPLEELVAALPAVPLAIEAPCRATAELPGVERAKRAYRTLSALVSRED |
| Ga0247819_100802182 | 3300028608 | Soil | AALPPDLPLAIEAPCRATASLPALERARRAHRALADLTGS |
| Ga0307504_101970952 | 3300028792 | Soil | VAALPAGVPLAIEAPCRATADLPALERAKRAFLALTALRGA |
| Ga0247826_113203431 | 3300030336 | Soil | PADLPLAIEAPCRATAELPALERAQRAHQTLATLIGA |
| Ga0307408_1024321232 | 3300031548 | Rhizosphere | DLVAALPAGVPLAIEAPSRATANLPALERATRAYRSLTALLDAC |
| Ga0318572_101473373 | 3300031681 | Soil | EGVLPLRDLVAALPPGLPLAIEAPCRATAALPALERAKRAYRALATLTGA |
| Ga0318501_105796632 | 3300031736 | Soil | AGAPLAIEAPCRATADLPALERAKRAYRALTSLAGA |
| Ga0318499_101445931 | 3300031832 | Soil | AELIAALPAGAPLAIEAPCRATADLPALERAKRAYRALTSLAGA |
| Ga0310892_103094632 | 3300031858 | Soil | LKDLVAALPPDLPLAIEAPSRATATLSALERARRAYRALTNLTGA |
| Ga0310884_107822302 | 3300031944 | Soil | LPLKELVAALPPDLPLAIEAPCRATASLPALERARRAHRALADLTGS |
| Ga0306922_103340144 | 3300032001 | Soil | PPGLPLAIEAPCRATAALPALERAKRAYRALATLTGA |
| Ga0315281_109090723 | 3300032163 | Sediment | AALPAGVPLAIEAPCRALADLPAVERAKRAYQALSTLLSPCRG |
| Ga0307471_1041372991 | 3300032180 | Hardwood Forest Soil | LPLAELVAALPSGVPIAIEAPCRATAELPAAERAKRAYRALTALLEKS |
| Ga0307472_1022965732 | 3300032205 | Hardwood Forest Soil | AALPPGVPLAIEAPCRATAELPAVERARRAYRALSGLVG |
| Ga0306920_1022924262 | 3300032261 | Soil | RELVAALPPGLPLAIEAPCRATAALAALERAKRAYRALTTLTGA |
| Ga0335069_127647161 | 3300032893 | Soil | AALPPGVPLAVEAPSRATAELPAVERAKRAHRAMSALLEGRSA |
| Ga0310810_110683231 | 3300033412 | Soil | VAALPPGLPLAIEAPDRTTAHLPALERAKRAHRALTALLAPA |
| Ga0247829_105175351 | 3300033550 | Soil | VLPLAELVAALPAGIPLAIEAPSRATADLPALERAQRAYRALSALIGAGSA |
| Ga0247830_111595441 | 3300033551 | Soil | VLPLPELVAALPAGVPLAIEAPCRATAHLPALERARRAYQALSTLTGA |
| Ga0326723_0564237_326_463 | 3300034090 | Peat Soil | VAALPAGVPLAIEAPCRATAELPAVERAKRAYRALSALVGGAGPG |
| Ga0364942_0205295_3_158 | 3300034165 | Sediment | VLPLRELVAALPAGVPLAIEAPCRALADLPAVERAKRAYQALSTLLSTCRG |
| Ga0364942_0243544_36_188 | 3300034165 | Sediment | LPLAELVAVLPDTVPLAVEAPCRATAHLTAVERATRAYRTLSALLLARTE |
| Ga0373917_0069051_449_565 | 3300034692 | Sediment Slurry | LPPDLPLAIEAPCRATAELPALERATRAHRTLSTLIGA |
| Ga0373959_0083622_2_136 | 3300034820 | Rhizosphere Soil | VAALPAGIPLAIEAPVRATAALPPLERARRAHRALTALLDQGSR |
| ⦗Top⦘ |