


| Basic Information | |
|---|---|
| Family ID | F050990 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 144 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MNPDTLNFTGDAVTFLGLIGVISTAIIVVTVFRSYFNSPLRK |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 144 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 21.53 % |
| % of genes near scaffold ends (potentially truncated) | 35.42 % |
| % of genes from short scaffolds (< 2000 bps) | 65.28 % |
| Associated GOLD sequencing projects | 110 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (43.056 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (11.111 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.806 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (45.833 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.57% β-sheet: 0.00% Coil/Unstructured: 61.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 144 Family Scaffolds |
|---|---|---|
| PF13392 | HNH_3 | 2.78 |
| PF14240 | YHYH | 2.08 |
| PF07275 | ArdA | 1.39 |
| PF07460 | NUMOD3 | 0.69 |
| PF03330 | DPBB_1 | 0.69 |
| PF04851 | ResIII | 0.69 |
| PF13385 | Laminin_G_3 | 0.69 |
| PF02672 | CP12 | 0.69 |
| PF09834 | DUF2061 | 0.69 |
| PF02086 | MethyltransfD12 | 0.69 |
| PF04820 | Trp_halogenase | 0.69 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.69 |
| PF06067 | DUF932 | 0.69 |
| PF00877 | NLPC_P60 | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
|---|---|---|---|
| COG4734 | Antirestriction protein ArdA | Defense mechanisms [V] | 1.39 |
| COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 0.69 |
| COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
| COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 56.94 % |
| Unclassified | root | N/A | 43.06 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001275|B570J13894_1022724 | Not Available | 591 | Open in IMG/M |
| 3300001847|RCM41_1033352 | All Organisms → Viruses → Predicted Viral | 1105 | Open in IMG/M |
| 3300002144|M2t2BS2_10338929 | All Organisms → Viruses → Predicted Viral | 1545 | Open in IMG/M |
| 3300002401|B570J29611_1000629 | All Organisms → Viruses → Predicted Viral | 3661 | Open in IMG/M |
| 3300002835|B570J40625_101053546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 691 | Open in IMG/M |
| 3300003277|JGI25908J49247_10135433 | Not Available | 579 | Open in IMG/M |
| 3300003491|JGI25924J51412_1049128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Bristolvirus → Bristolvirus rhodeisland | 664 | Open in IMG/M |
| 3300004448|Ga0065861_1172970 | Not Available | 697 | Open in IMG/M |
| 3300004460|Ga0066222_1129481 | Not Available | 641 | Open in IMG/M |
| 3300004481|Ga0069718_16292426 | All Organisms → Viruses → Predicted Viral | 4084 | Open in IMG/M |
| 3300004792|Ga0007761_11309710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Bristolvirus → Bristolvirus rhodeisland | 618 | Open in IMG/M |
| 3300004836|Ga0007759_10103135 | All Organisms → Viruses → Predicted Viral | 2350 | Open in IMG/M |
| 3300005432|Ga0066845_10000058 | Not Available | 29007 | Open in IMG/M |
| 3300005517|Ga0070374_10382600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 709 | Open in IMG/M |
| 3300005580|Ga0049083_10204711 | Not Available | 670 | Open in IMG/M |
| 3300005582|Ga0049080_10006235 | All Organisms → Viruses → Predicted Viral | 4137 | Open in IMG/M |
| 3300005582|Ga0049080_10216985 | Not Available | 629 | Open in IMG/M |
| 3300005583|Ga0049085_10187828 | Not Available | 688 | Open in IMG/M |
| 3300005611|Ga0074647_1004761 | All Organisms → Viruses → Predicted Viral | 3367 | Open in IMG/M |
| 3300005662|Ga0078894_11450491 | Not Available | 571 | Open in IMG/M |
| 3300005837|Ga0078893_10279443 | Not Available | 7037 | Open in IMG/M |
| 3300006040|Ga0073914_10055706 | Not Available | 733 | Open in IMG/M |
| 3300006802|Ga0070749_10182955 | All Organisms → Viruses → Predicted Viral | 1206 | Open in IMG/M |
| 3300007538|Ga0099851_1144013 | Not Available | 890 | Open in IMG/M |
| 3300007541|Ga0099848_1003157 | Not Available | 7654 | Open in IMG/M |
| 3300007546|Ga0102874_1002153 | Not Available | 6740 | Open in IMG/M |
| 3300007960|Ga0099850_1225170 | Not Available | 730 | Open in IMG/M |
| 3300009149|Ga0114918_10355418 | Not Available | 807 | Open in IMG/M |
| 3300009151|Ga0114962_10026922 | All Organisms → Viruses → Predicted Viral | 3988 | Open in IMG/M |
| 3300009152|Ga0114980_10023557 | All Organisms → Viruses → Predicted Viral | 3832 | Open in IMG/M |
| 3300009152|Ga0114980_10644365 | Not Available | 596 | Open in IMG/M |
| 3300009159|Ga0114978_10005114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 10525 | Open in IMG/M |
| 3300009159|Ga0114978_10152763 | All Organisms → Viruses → Predicted Viral | 1486 | Open in IMG/M |
| 3300009159|Ga0114978_10734482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage SynMITS9220M01 | 561 | Open in IMG/M |
| 3300009161|Ga0114966_10015596 | Not Available | 5882 | Open in IMG/M |
| 3300009164|Ga0114975_10015451 | All Organisms → Viruses → Predicted Viral | 4684 | Open in IMG/M |
| 3300009168|Ga0105104_10130325 | All Organisms → Viruses → Predicted Viral | 1357 | Open in IMG/M |
| 3300009180|Ga0114979_10000189 | All Organisms → Viruses | 40215 | Open in IMG/M |
| 3300009182|Ga0114959_10036271 | All Organisms → Viruses → Predicted Viral | 2963 | Open in IMG/M |
| 3300009182|Ga0114959_10205142 | Not Available | 1019 | Open in IMG/M |
| 3300009218|Ga0103848_1009772 | All Organisms → Viruses → Predicted Viral | 1689 | Open in IMG/M |
| 3300009218|Ga0103848_1070025 | All Organisms → Viruses | 695 | Open in IMG/M |
| 3300009223|Ga0103850_1050191 | Not Available | 511 | Open in IMG/M |
| 3300009450|Ga0127391_1002731 | Not Available | 3980 | Open in IMG/M |
| 3300009474|Ga0127390_1005664 | All Organisms → Viruses → Predicted Viral | 3890 | Open in IMG/M |
| 3300009480|Ga0127405_1008305 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2918 | Open in IMG/M |
| 3300009484|Ga0127411_1060956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-B05 | 966 | Open in IMG/M |
| 3300009504|Ga0114946_10341202 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 784 | Open in IMG/M |
| 3300009504|Ga0114946_10426718 | Not Available | 684 | Open in IMG/M |
| 3300009504|Ga0114946_10714647 | Not Available | 502 | Open in IMG/M |
| 3300009563|Ga0130030_1047925 | Not Available | 660 | Open in IMG/M |
| 3300010293|Ga0116204_1165605 | All Organisms → Viruses | 730 | Open in IMG/M |
| 3300010296|Ga0129348_1247680 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 600 | Open in IMG/M |
| 3300010297|Ga0129345_1077425 | Not Available | 1248 | Open in IMG/M |
| 3300010318|Ga0136656_1085343 | All Organisms → Viruses → Predicted Viral | 1115 | Open in IMG/M |
| 3300010354|Ga0129333_10062603 | All Organisms → Viruses → Predicted Viral | 3466 | Open in IMG/M |
| 3300010354|Ga0129333_10260926 | All Organisms → Viruses → Predicted Viral | 1559 | Open in IMG/M |
| 3300010354|Ga0129333_10281547 | All Organisms → Viruses → Predicted Viral | 1492 | Open in IMG/M |
| 3300010354|Ga0129333_10612913 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 943 | Open in IMG/M |
| 3300010885|Ga0133913_10502061 | All Organisms → Viruses → Predicted Viral | 3196 | Open in IMG/M |
| 3300010997|Ga0139324_1122775 | Not Available | 673 | Open in IMG/M |
| 3300012471|Ga0129334_1078284 | Not Available | 6939 | Open in IMG/M |
| 3300012966|Ga0129341_1151665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 588 | Open in IMG/M |
| (restricted) 3300013128|Ga0172366_10014476 | Not Available | 5992 | Open in IMG/M |
| (restricted) 3300013133|Ga0172362_10166089 | All Organisms → Viruses → Predicted Viral | 1623 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10142537 | All Organisms → Viruses → Predicted Viral | 1612 | Open in IMG/M |
| 3300017761|Ga0181356_1039773 | All Organisms → Viruses → Predicted Viral | 1656 | Open in IMG/M |
| 3300017987|Ga0180431_10874147 | Not Available | 597 | Open in IMG/M |
| 3300017987|Ga0180431_11070579 | All Organisms → Viruses | 528 | Open in IMG/M |
| 3300017989|Ga0180432_10174316 | All Organisms → Viruses → Predicted Viral | 1745 | Open in IMG/M |
| 3300018420|Ga0181563_10347694 | Not Available | 856 | Open in IMG/M |
| 3300018558|Ga0188836_100129 | All Organisms → Viruses → Predicted Viral | 2202 | Open in IMG/M |
| 3300018682|Ga0188851_1008465 | All Organisms → Viruses → Predicted Viral | 1403 | Open in IMG/M |
| 3300019034|Ga0193543_10046644 | Not Available | 549 | Open in IMG/M |
| 3300019076|Ga0188856_1000236 | Not Available | 900 | Open in IMG/M |
| 3300020141|Ga0211732_1070222 | Not Available | 6563 | Open in IMG/M |
| 3300020151|Ga0211736_10333359 | All Organisms → Viruses → Predicted Viral | 3997 | Open in IMG/M |
| 3300020151|Ga0211736_10773021 | All Organisms → Viruses → Predicted Viral | 2547 | Open in IMG/M |
| 3300020151|Ga0211736_10794382 | All Organisms → Viruses → Predicted Viral | 1783 | Open in IMG/M |
| 3300020159|Ga0211734_10443678 | All Organisms → Viruses → Predicted Viral | 1500 | Open in IMG/M |
| 3300020159|Ga0211734_11089341 | All Organisms → Viruses → Predicted Viral | 4059 | Open in IMG/M |
| 3300020159|Ga0211734_11321543 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2 | 5445 | Open in IMG/M |
| 3300020161|Ga0211726_10417789 | All Organisms → Viruses | 576 | Open in IMG/M |
| 3300020161|Ga0211726_10596597 | Not Available | 574 | Open in IMG/M |
| 3300020239|Ga0211501_1000004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 81269 | Open in IMG/M |
| 3300020312|Ga0211542_1021635 | All Organisms → Viruses → Predicted Viral | 1344 | Open in IMG/M |
| 3300020312|Ga0211542_1055205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 727 | Open in IMG/M |
| 3300020417|Ga0211528_10001229 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 19016 | Open in IMG/M |
| 3300020499|Ga0208084_1004647 | All Organisms → Viruses → Predicted Viral | 1921 | Open in IMG/M |
| 3300021373|Ga0213865_10363545 | Not Available | 653 | Open in IMG/M |
| 3300021425|Ga0213866_10014701 | Not Available | 4734 | Open in IMG/M |
| 3300021425|Ga0213866_10239905 | Not Available | 927 | Open in IMG/M |
| 3300021961|Ga0222714_10420114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 702 | Open in IMG/M |
| 3300021963|Ga0222712_10094328 | All Organisms → Viruses → Predicted Viral | 2108 | Open in IMG/M |
| 3300022407|Ga0181351_1000193 | Not Available | 16260 | Open in IMG/M |
| 3300022407|Ga0181351_1110213 | All Organisms → Viruses → Predicted Viral | 1049 | Open in IMG/M |
| 3300023174|Ga0214921_10138243 | All Organisms → Viruses → Predicted Viral | 1693 | Open in IMG/M |
| 3300024262|Ga0210003_1217387 | Not Available | 773 | Open in IMG/M |
| 3300024346|Ga0244775_10006688 | Not Available | 11443 | Open in IMG/M |
| 3300025135|Ga0209498_1083721 | All Organisms → Viruses → Predicted Viral | 1336 | Open in IMG/M |
| 3300025578|Ga0208864_1019334 | Not Available | 2033 | Open in IMG/M |
| 3300027084|Ga0208443_1001342 | Not Available | 6542 | Open in IMG/M |
| 3300027114|Ga0208009_1001824 | Not Available | 5966 | Open in IMG/M |
| 3300027219|Ga0208167_1003511 | All Organisms → Viruses → Predicted Viral | 2844 | Open in IMG/M |
| 3300027221|Ga0208557_1000496 | Not Available | 8657 | Open in IMG/M |
| 3300027608|Ga0208974_1158214 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 570 | Open in IMG/M |
| 3300027656|Ga0209357_1154785 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Bristolvirus → Bristolvirus rhodeisland | 610 | Open in IMG/M |
| 3300027693|Ga0209704_1012917 | All Organisms → Viruses → Predicted Viral | 2021 | Open in IMG/M |
| 3300027708|Ga0209188_1013997 | All Organisms → Viruses → Predicted Viral | 4361 | Open in IMG/M |
| 3300027708|Ga0209188_1233071 | All Organisms → Viruses | 645 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1170998 | Not Available | 907 | Open in IMG/M |
| 3300027763|Ga0209088_10000293 | Not Available | 36407 | Open in IMG/M |
| 3300027763|Ga0209088_10016481 | All Organisms → Viruses → Predicted Viral | 3887 | Open in IMG/M |
| 3300027772|Ga0209768_10277453 | Not Available | 714 | Open in IMG/M |
| 3300027785|Ga0209246_10166570 | Not Available | 865 | Open in IMG/M |
| 3300027797|Ga0209107_10443023 | Not Available | 585 | Open in IMG/M |
| (restricted) 3300027970|Ga0247837_1224909 | Not Available | 758 | Open in IMG/M |
| (restricted) 3300027995|Ga0233418_10335571 | Not Available | 535 | Open in IMG/M |
| 3300028193|Ga0265594_1028273 | All Organisms → Viruses → Predicted Viral | 2339 | Open in IMG/M |
| 3300028193|Ga0265594_1191402 | Not Available | 653 | Open in IMG/M |
| 3300029199|Ga0168647_100926 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 11119 | Open in IMG/M |
| 3300029318|Ga0185543_1076724 | All Organisms → Viruses | 673 | Open in IMG/M |
| 3300031539|Ga0307380_10807063 | Not Available | 774 | Open in IMG/M |
| 3300031565|Ga0307379_10803717 | Not Available | 828 | Open in IMG/M |
| 3300031566|Ga0307378_11022238 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
| 3300031669|Ga0307375_10212416 | All Organisms → Viruses → Predicted Viral | 1290 | Open in IMG/M |
| 3300031707|Ga0315291_10504389 | All Organisms → Viruses → Predicted Viral | 1122 | Open in IMG/M |
| 3300031746|Ga0315293_10292463 | All Organisms → Viruses → Predicted Viral | 1309 | Open in IMG/M |
| 3300031746|Ga0315293_10528361 | Not Available | 906 | Open in IMG/M |
| 3300031746|Ga0315293_10771735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 707 | Open in IMG/M |
| 3300031758|Ga0315907_10439709 | All Organisms → Viruses → Predicted Viral | 1044 | Open in IMG/M |
| 3300031758|Ga0315907_11063416 | Not Available | 578 | Open in IMG/M |
| 3300032156|Ga0315295_10036071 | All Organisms → Viruses → Predicted Viral | 4551 | Open in IMG/M |
| 3300032163|Ga0315281_10564110 | All Organisms → Viruses → Predicted Viral | 1203 | Open in IMG/M |
| 3300032173|Ga0315268_10249905 | All Organisms → Viruses → Predicted Viral | 1707 | Open in IMG/M |
| 3300032173|Ga0315268_11023539 | Not Available | 832 | Open in IMG/M |
| 3300032342|Ga0315286_12042281 | Not Available | 532 | Open in IMG/M |
| 3300033233|Ga0334722_10103646 | All Organisms → Viruses → Predicted Viral | 2157 | Open in IMG/M |
| 3300033233|Ga0334722_10150854 | All Organisms → Viruses | 1741 | Open in IMG/M |
| 3300033418|Ga0316625_100137284 | All Organisms → Viruses → Predicted Viral | 1478 | Open in IMG/M |
| 3300033980|Ga0334981_0000728 | Not Available | 25254 | Open in IMG/M |
| 3300033994|Ga0334996_0530154 | Not Available | 520 | Open in IMG/M |
| 3300034071|Ga0335028_0467915 | Not Available | 704 | Open in IMG/M |
| 3300034121|Ga0335058_0008367 | Not Available | 6430 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 11.11% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 10.42% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 9.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.25% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.56% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 4.86% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.17% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 4.17% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.47% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 2.78% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 2.78% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.08% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 2.08% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.08% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 2.08% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 2.08% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.39% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.39% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.39% |
| Meromictic Pond | Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond | 1.39% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.39% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.39% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.39% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 1.39% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.39% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.69% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.69% |
| Anoxic Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water | 0.69% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.69% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.69% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.69% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.69% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.69% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.69% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water And Sediment | 0.69% |
| Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.69% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001275 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
| 3300001847 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM41. ROCA_DNA251_0.2um_TAP-D_2a | Environmental | Open in IMG/M |
| 3300002144 | Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2BS2 (113f) | Environmental | Open in IMG/M |
| 3300002401 | Freshwater microbial communities from Lake Mendota, WI - 26JUN2009 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300004792 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004836 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005432 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV78 | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005611 | Saline surface water microbial communities from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006040 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_30-Apr-14 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007546 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02 | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009218 | Microbial communities of water from Amazon river, Brazil - RCM1 | Environmental | Open in IMG/M |
| 3300009223 | Microbial communities of water from Amazon river, Brazil - RCM3 | Environmental | Open in IMG/M |
| 3300009450 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 4m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009474 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 3m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009480 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 10m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009484 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 12m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009504 | Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment | Environmental | Open in IMG/M |
| 3300009563 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 5, Depth 6m; RNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010293 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300010997 | ECM15MPS05_Aassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method A (2X250bp) | Environmental | Open in IMG/M |
| 3300012471 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012966 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013128 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cm | Environmental | Open in IMG/M |
| 3300013133 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2 | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017987 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_1 metaG | Environmental | Open in IMG/M |
| 3300017989 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_2 metaG | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018558 | Metatranscriptome of marine microbial communities from Baltic Sea - GS676_0p8 | Environmental | Open in IMG/M |
| 3300018682 | Metatranscriptome of marine microbial communities from Baltic Sea - GS680_0p1 | Environmental | Open in IMG/M |
| 3300019034 | Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_039 - TARA_B100000091 (ERX1399743-ERR1328123) | Environmental | Open in IMG/M |
| 3300019076 | Metatranscriptome of marine microbial communities from Baltic Sea - GS683_0p8 | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020239 | Marine microbial communities from Tara Oceans - TARA_B100000003 (ERX555909-ERR598959) | Environmental | Open in IMG/M |
| 3300020312 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX556125-ERR598977) | Environmental | Open in IMG/M |
| 3300020417 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082) | Environmental | Open in IMG/M |
| 3300020499 | Freshwater microbial communities from Lake Mendota, WI - 14SEP2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025135 | Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment (SPAdes) | Environmental | Open in IMG/M |
| 3300025578 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M (SPAdes) | Environmental | Open in IMG/M |
| 3300027084 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
| 3300027219 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027221 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027970 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5m | Environmental | Open in IMG/M |
| 3300027995 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_1_MG | Environmental | Open in IMG/M |
| 3300028193 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_80m | Environmental | Open in IMG/M |
| 3300029199 | Deep subsurface microbial communities from shale gas basins in Pennsylvania, USA - 1_Day0 | Environmental | Open in IMG/M |
| 3300029318 | Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J13894_10227242 | 3300001275 | Freshwater | MMTPDTLNFTGNAVTFLGLIGVISTAIIVVTVFRSYFNSPLRK* |
| RCM41_10333524 | 3300001847 | Marine Plankton | MTPDTYNFAGDGVTVLGLVGIISTAIIIVLCFTRYYNSPLRK* |
| M2t2BS2_103389296 | 3300002144 | Marine | MTPDSLNFTGDAVTFLGLIGVTSTLIILVSVFRSYFNSPLRK* |
| B570J29611_10006296 | 3300002401 | Freshwater | MMVETLDFTGDAVTVLGLVGIXSTGIILVLCFTRYYNSPLRK* |
| B570J40625_1010535461 | 3300002835 | Freshwater | MTPDTYSFSGDAVTVLGLVGIISTGIILVVAYTRYWNSPLRK* |
| JGI25908J49247_101354331 | 3300003277 | Freshwater Lake | MTPDSYTFTGDTVTYLGLVGIISTAIIVVSVFRSFYKSPLNK* |
| JGI25924J51412_10491283 | 3300003491 | Freshwater Lake | MTPDTLNFTGDGITFLGLIGVISTAIIVVSVFRSYFNSPLRK* |
| Ga0065861_11729701 | 3300004448 | Marine | MPDFYSFSGDGVTYLGAVGIVSSFVILYTAFRRYYNSPLRK* |
| Ga0066222_11294813 | 3300004460 | Marine | LTLITKMTPDTLNFTGDTVTYLGLIGIISTAIIVVSVFRSFYKSPLNK* |
| Ga0069718_162924267 | 3300004481 | Sediment | MNPDTLNFTGDAVTYLGLIGVTSTLIILVTVFRSYFNSPLRK* |
| Ga0007761_113097104 | 3300004792 | Freshwater Lake | MTPDTLNFTGDGITFLGLIGVISTAIIVVSVFRSFYKSPLNK* |
| Ga0007759_101031353 | 3300004836 | Freshwater Lake | MTPDFYTFTGDTVTYLGLIGIISTAIIVVSVFRSFYKSPLNK* |
| Ga0066845_1000005811 | 3300005432 | Marine | MTPDTFNFTGDAITVIGFIGVASTGIILFTAFTRYFNSPLRK* |
| Ga0070374_103826001 | 3300005517 | Freshwater Lake | MMNPDTLNFTGDAFTYLGFVGVISTLIILVTAFTRFYKSPLNK* |
| Ga0049083_102047114 | 3300005580 | Freshwater Lentic | MNLDTLNFTGDAFTYLGFVGVISTLIILVTAFTRFYKS |
| Ga0049080_100062356 | 3300005582 | Freshwater Lentic | MNPPTLDFSGNVVTFLGLIGVTSTLIILISVFRSYFNSPLRK* |
| Ga0049080_102169853 | 3300005582 | Freshwater Lentic | TGDAVTYLGFVGVVSTLIILVTAFTRFYKSPLNK* |
| Ga0049085_101878283 | 3300005583 | Freshwater Lentic | MVNPDTLNFTGDAFTYLGFVGVISTLIILVTAFTRFYKSPLNK* |
| Ga0074647_100476112 | 3300005611 | Saline Water And Sediment | MMNPDTYNFAGDGVTILGFIGVLSTVIILYTAFNRYFNSPLRK* |
| Ga0078894_114504912 | 3300005662 | Freshwater Lake | MMVDTLDFTGDAVTVLGLVGIISTGIILVLCFTRYYNSPLRK* |
| Ga0078893_1027944318 | 3300005837 | Marine Surface Water | MTPDTFNFTGDAVTVIGFIGVASTLIILFTAFTRYNNSPLRK* |
| Ga0073914_100557063 | 3300006040 | Sand | MTPDSYTFTGDTVTYLGLIGIISTAIIVVSVFRSFYKSPLNK* |
| Ga0070749_101829551 | 3300006802 | Aqueous | MTPDTLNFTGDATTVLGFIGVISTLIILIAVYRSYWKSPYRR* |
| Ga0099851_11440131 | 3300007538 | Aqueous | MTPDTLDFTGNAVTYLGFVGVVSAFVIIVTSFRRFFNS |
| Ga0099848_10031574 | 3300007541 | Aqueous | MTPDTLNFTGDAVTYLGLIGVISTLIIVVTSFRRYFNSPLRK* |
| Ga0102874_100215321 | 3300007546 | Estuarine | MTPSTLNFTGDAVTYLGLIGVISTAIIVVSVFRSYFNSPLRK* |
| Ga0099850_12251701 | 3300007960 | Aqueous | PDTLNFTGDAVTYLGLIGVISTLIIVVTSFRRYFNSPLRK* |
| Ga0114918_103554183 | 3300009149 | Deep Subsurface | MTPDALNFTGDAVTYLGLIGVISTLIIVVTSFRRYFNSPLRK* |
| Ga0114962_100269228 | 3300009151 | Freshwater Lake | MPPTLSFTGDAVTFLGAVGVVSTLIIVYTSFVRFYKSPLNK* |
| Ga0114980_100235575 | 3300009152 | Freshwater Lake | MPETMTFTGDGVTFLGLIGVISTAIIVITVFRSYYNSPLRK* |
| Ga0114980_106443652 | 3300009152 | Freshwater Lake | MPDTLNFTGDGITFLGLIGVISTAIIVITVFRSYSKSPLRK* |
| Ga0114978_1000511433 | 3300009159 | Freshwater Lake | MPDSYGFVGDGVTFLGLIGVISTAIIVITVFRSYSKSPLRK* |
| Ga0114978_101527635 | 3300009159 | Freshwater Lake | MTPDSYTFTGDTVTFLGLIGVISTAIIVITVFRSYYNSPLRK* |
| Ga0114978_107344821 | 3300009159 | Freshwater Lake | QRKLRLLMPDTLNFTGDGITFLGLIGVISTAIIVVTVFRSFGNSPLRK* |
| Ga0114966_100155965 | 3300009161 | Freshwater Lake | MMPDFYSFSGDGVTYLGAVGIVSSFVILYTAFRRYYNSPLRK* |
| Ga0114975_100154518 | 3300009164 | Freshwater Lake | MPETMTFTGDAVTFLGLIGVISTAIIVITVFRSFGNSPLRK* |
| Ga0105104_101303253 | 3300009168 | Freshwater Sediment | MTPDTLNFTGNAVTYLGLIGVVSTLIIVVSVFRSFANSPVRK* |
| Ga0114979_1000018921 | 3300009180 | Freshwater Lake | MPDTLNFTGDGITFLGLIGVISTAIIVVTVFRSYYNSPLRK* |
| Ga0114959_100362711 | 3300009182 | Freshwater Lake | FTGDAVTFLGAVGVVSTLIIVYTSFVRFYKSPLNK* |
| Ga0114959_102051421 | 3300009182 | Freshwater Lake | MPNTLEFTGNAVTYLGLVGVTSTFVILVAVFKSFFNSPFRR* |
| Ga0103848_10097723 | 3300009218 | River Water | MPDTYGFVGDGVTFLGLVGIISTAIIIVTAFTRYYNSPLRK* |
| Ga0103848_10700254 | 3300009218 | River Water | YGFVGDGVTFLGLVGIISTAIIIVTAFTRYYNSPLRK* |
| Ga0103850_10501911 | 3300009223 | River Water | PDTYGFVGDGVTFLGLVGIISTAIIIVTAFTRYYNSPLRK* |
| Ga0127391_100273112 | 3300009450 | Meromictic Pond | MPVNTLSFQGDAVTYLGLVGLISTGIIVVLCFTRYFNSPLRK* |
| Ga0127390_100566414 | 3300009474 | Meromictic Pond | MTPDALNFTGDAVTYLGLIGVISTAIIVVSVFRSYFNSPLRK* |
| Ga0127405_10083056 | 3300009480 | Meromictic Pond | MMPVNTLSFQGDAVTYLGLVGLISTGIIVVLCFTRYFNSPLRK* |
| Ga0127411_10609564 | 3300009484 | Meromictic Pond | NFTGDAVTYLGLIGVISTAIIVVSVFRSYFNSPLRK* |
| Ga0114946_103412021 | 3300009504 | Sediment | MIETLDFSGNIVTVIGFVGVISTAIIVVTSFRRYFNSPLRK* |
| Ga0114946_104267182 | 3300009504 | Sediment | MIETLDFTGNIVTVIGFVGVISTAIIVVTSFRRYFNSPLRK* |
| Ga0114946_107146473 | 3300009504 | Sediment | MIETLDFSGNIVTAIGFVGVISTAIIVVTSFRRYFNSPLRK* |
| Ga0130030_10479251 | 3300009563 | Meromictic Pond | MTPDTLNFTGDAVTYLGLIGVISTLIIVVTSFRRYFN |
| Ga0116204_11656053 | 3300010293 | Anoxic Lake Water | NFTGDAVTYLGLIGVISTGIILVLCFTRYYNSPLRK* |
| Ga0129348_12476801 | 3300010296 | Freshwater To Marine Saline Gradient | HFICWWYYFILQSGLSMTPDTFNFTGDAVTVIGFIGVASTLIILYTAFTRYYNSPLRK* |
| Ga0129345_10774251 | 3300010297 | Freshwater To Marine Saline Gradient | QMTPDTLNFTGDAVTYLGLIGVISTLIIVVTSFRRYFNSPLRK* |
| Ga0136656_10853431 | 3300010318 | Freshwater To Marine Saline Gradient | NFTGDSVTLLGFVGVTSTLVILVSVFRSYFNSPLRK* |
| Ga0129333_100626035 | 3300010354 | Freshwater To Marine Saline Gradient | MPDTYGFGGDAITFLGLIGVASTLIIVVTSFRRYYNSPLRK* |
| Ga0129333_102609265 | 3300010354 | Freshwater To Marine Saline Gradient | MIDTLNFTGDAVTVLGFVGVISTLIIMVSVFRSFANSPVRK* |
| Ga0129333_102815471 | 3300010354 | Freshwater To Marine Saline Gradient | TGDAVTFLGLVGVASTFIIVVTAFRRYYSSPLRK* |
| Ga0129333_106129133 | 3300010354 | Freshwater To Marine Saline Gradient | MTPDTLNFNGDAITFLGLIGVDSTFIIVVTSFRRYFNSPLRK* |
| Ga0133913_105020611 | 3300010885 | Freshwater Lake | QRKLRLLMPDTLNFTGDGITFLGLIGVISTAIIVVTVFRSYYNSPLRK* |
| Ga0139324_11227753 | 3300010997 | Sediment | MSDSMFYSFTGDGVTFLGLIGIVSTGIILVSVFRSYMNSP |
| Ga0129334_107828418 | 3300012471 | Aqueous | MTPDTLNFNGDAITFLGLIGVVSTFIIVVTSFRRYFNSPLRK* |
| Ga0129341_11516653 | 3300012966 | Aqueous | MTPSTFDFTGDAVTYLGLIGVISTLIIVVTSFRRYFNS |
| (restricted) Ga0172366_1001447615 | 3300013128 | Sediment | MTPDTLNFTGDAVTYLGLIGVISTGIILVLCFTRYYNSPLRK* |
| (restricted) Ga0172362_101660894 | 3300013133 | Sediment | MNPDTLNFTGDAVTFLGLIGVTSTLIILVTVFRSYFNSPLRK* |
| (restricted) Ga0172376_101425374 | 3300014720 | Freshwater | MNPDTLNFNGDIVTVLGFVGVVSTFIILVTVFRSYFNSPLRK* |
| Ga0181356_10397731 | 3300017761 | Freshwater Lake | MTPDTLNFTGDTVTYLGLIGVISTGIILVLCFTRYFNSPLRK |
| Ga0180431_108741471 | 3300017987 | Hypersaline Lake Sediment | MMNPDTYNFAGDGVTILGFIGVLSTVIILYTAFNRYFNSPL |
| Ga0180431_110705791 | 3300017987 | Hypersaline Lake Sediment | MMTPDNYSFVGDGVTILGFIGVLSTVIILYTAFNRYFNSPL |
| Ga0180432_101743163 | 3300017989 | Hypersaline Lake Sediment | MMTPDTYNFAGDGVTILGFIGVLSTVIILYTAFNRYFNSPLRK |
| Ga0181563_103476943 | 3300018420 | Salt Marsh | MNPDTLNFNGDAVTFLGLVGVISTFIILVSIFRSYW |
| Ga0188836_10012910 | 3300018558 | Freshwater Lake | MGKAVMNPTTFDFSGDVVTFLGLIGVTSTLIILISVFRSYFNS |
| Ga0188851_10084651 | 3300018682 | Freshwater Lake | FTGDAVTYLGLVGVISTAIIVVSVFRSYFNSPLRK |
| Ga0193543_100466443 | 3300019034 | Marine | MTPDTFNFTGDAITVIGFIGVASTGIILFTAFTRYFNSPLRK |
| Ga0188856_10002364 | 3300019076 | Freshwater Lake | MTPDSLNFTGDAVTFLGLIGVTSTLIILVSVFRSYFNSPLRK |
| Ga0211732_10702227 | 3300020141 | Freshwater | MNPDTLNFTGDAVTYLGLIGVTSTLIILMTVFRSYFNSPLRK |
| Ga0211736_1033335910 | 3300020151 | Freshwater | MTFTGDAVTFLGLIGVISTAIIVITVFRSYYNSPLRK |
| Ga0211736_107730213 | 3300020151 | Freshwater | MMPETMTFTGDAVTFLGLIGVISTAIIVITVFRSYSKSPLRK |
| Ga0211736_107943824 | 3300020151 | Freshwater | MNPDTLNFTGDAVTFLGLIGVISTAIIVVTVFRSYFNSPLRK |
| Ga0211734_104436785 | 3300020159 | Freshwater | MNADTLNFSGDAVTFLGLIGVISTAIIVITVFRSYYNSPLRK |
| Ga0211734_110893419 | 3300020159 | Freshwater | MMPVDTLGFQGDGVTILGFVGVLSTLLIITTAFRRYNNSPLRK |
| Ga0211734_1132154315 | 3300020159 | Freshwater | MMPNTLNFTGDATTYLGLVGIISTAVILVTVFRSYWSSPLNK |
| Ga0211726_104177892 | 3300020161 | Freshwater | MTPDTLNFTGDGITFLGLIGVISTAIIVVTVFRSYYNSPLRK |
| Ga0211726_105965971 | 3300020161 | Freshwater | TMTFTGDGVTFLGLIGVISTAIIVITVFRSYSKSPLRK |
| Ga0211501_1000004119 | 3300020239 | Marine | MTPDTYSFAGDAVTILGFIGVASTGIILFTAFTRYFNSPLRK |
| Ga0211542_10216355 | 3300020312 | Marine | LQSSLSMTPDTFNFTGDAVTVIGFIGVASTLIILYTAFTRYYNSPLRK |
| Ga0211542_10552054 | 3300020312 | Marine | LQSSLSMTPDTFNFTGDAITVIGFIGVASTGIILFTAFTRYFNSPLRK |
| Ga0211528_100012295 | 3300020417 | Marine | MTPDTFNFTGDAVTVIGFIGVASTGIILFTAFTRYFNSPLRK |
| Ga0208084_10046475 | 3300020499 | Freshwater | MMTPDTLNFTGNAVTFLGLIGVISTAIIVVTVFRSYFNSPLRK |
| Ga0213865_103635453 | 3300021373 | Seawater | MTPDTLNFTGDAVTYLGLIGVISTLIIVVTSFRRYFNSPLRK |
| Ga0213866_100147011 | 3300021425 | Seawater | LSQMTPDTLNFTGDAVTYLGLIGVISTLIIVVTSFRRYFNSPLRK |
| Ga0213866_102399051 | 3300021425 | Seawater | TVTGDTVTVLGLVGVISTGIILVLCFTRYFNSPLLKQTK |
| Ga0222714_104201141 | 3300021961 | Estuarine Water | MPDTYGFGGDAITFLGLIGVASTLIIVVTSFRRYYNSPLRK |
| Ga0222712_100943281 | 3300021963 | Estuarine Water | MPDTFNFTGDAVTFLGMVGVISTGIIIVTAFSRYFNSPLRKXTISL |
| Ga0181351_10001932 | 3300022407 | Freshwater Lake | MTNPDTLTFAGDAVTFLGLIGVVSTAIILVTVFRAFAKSPLRK |
| Ga0181351_11102135 | 3300022407 | Freshwater Lake | MNLDTLNFTGDAFTYLGFVGVISTLIILVTAFTRFYKSPLNK |
| Ga0214921_101382433 | 3300023174 | Freshwater | MTPDTLTFSGNAVTYLGSVGVISTLIIVVSVFRSYFNSPLRK |
| Ga0210003_12173873 | 3300024262 | Deep Subsurface | MTPDALNFTGDAVTYLGLIGVISTLIIVVTSFRRYFNSPLRK |
| Ga0244775_100066887 | 3300024346 | Estuarine | MTPDSYTFTGDTVTYLGLIGIISTAIIVVSVFRSFYKSPLNK |
| Ga0209498_10837213 | 3300025135 | Sediment | MIETLDFSGNIVTAIGFVGVISTAIIVVTSFRRYFNSPLRK |
| Ga0208864_10193346 | 3300025578 | Freshwater | MTTPDTLTFTGDAVTFLGLLGVASTAVILVTIFRAFAKSPLNK |
| Ga0208443_10013422 | 3300027084 | Estuarine | MTTSTLTLITEMTPSTLNFTGDAVTYLGLIGVISTAIIVVSVFRSYFNSPLRK |
| Ga0208009_10018249 | 3300027114 | Deep Subsurface | MIPDTYSFSGDAVTVLGLVGIISTGIILVVAYTRYWNSPLRK |
| Ga0208167_100351110 | 3300027219 | Estuarine | MTPSTLNFTGDAVTYLGLIGVISTAIIVVSVFRSYFNS |
| Ga0208557_10004969 | 3300027221 | Estuarine | MTPSTLNFTGDAVTYLGLIGVISTAIIVVSVFRSYFNSPLRK |
| Ga0208974_11582141 | 3300027608 | Freshwater Lentic | MTPDTLNFTGDGITFLGLIGVISTAIIVVSVFRSFYKSPLNK |
| Ga0209357_11547853 | 3300027656 | Freshwater Lake | MTPDTLNFTGDGITFLGLIGVISTAIIVVSVFRSYFNSPLRK |
| Ga0209704_10129173 | 3300027693 | Freshwater Sediment | MTPDTLNFTGNAVTYLGLIGVVSTLIIVVSVFRSFANSPVRK |
| Ga0209188_101399710 | 3300027708 | Freshwater Lake | MPPTLSFTGDAVTFLGAVGVVSTLIIVYTSFVRFYKSPLNK |
| Ga0209188_12330711 | 3300027708 | Freshwater Lake | TKMMPDFYSFSGDGVTYLGAVGIVSSFVILYTAFRRYYNSPLRK |
| (restricted) Ga0247836_11709984 | 3300027728 | Freshwater | MPDTLNFTGDTITYLGFLGVISTLIILVSVFRSFYKSPLNK |
| Ga0209088_1000029323 | 3300027763 | Freshwater Lake | MPDTLNFTGDGITFLGLIGVISTAIIVVTVFRSYYNSPLRK |
| Ga0209088_100164815 | 3300027763 | Freshwater Lake | MPETMTFTGDGVTFLGLIGVISTAIIVITVFRSYYNSPLRK |
| Ga0209768_102774531 | 3300027772 | Freshwater Lake | MPQTLDFTGDWITFLGLIGIASTALIVFTSFRRFHNSPLR |
| Ga0209246_101665704 | 3300027785 | Freshwater Lake | TEFTNKQMPQTLDFTGDWITFLGLIGIASTALIVFTSFRRFHNSPLRK |
| Ga0209107_104430231 | 3300027797 | Freshwater And Sediment | SYLLMTPDTLNFTGDGITFLGLIGVISTAIIVVSVFRSYFNSPLRK |
| (restricted) Ga0247837_12249093 | 3300027970 | Freshwater | MPDTLNFTGDTITYLGFLGVISTLIILVTVFRSFYKSPLNK |
| (restricted) Ga0233418_103355712 | 3300027995 | Sediment | MSPSVYSFVGDGVTYLGVIGIASSFVILFTAFRRYFNSPLRK |
| Ga0265594_10282731 | 3300028193 | Saline Water | TPDTLNFTGDAVTYLGLVGVISTAIILVSVFRSFYKSPLNK |
| Ga0265594_11914021 | 3300028193 | Saline Water | MTPDTLNFTGDAVTYLGLVGVISTAIILVSVFRSFYKSPLNK |
| Ga0168647_10092611 | 3300029199 | Deep Subsurface | MTPDTLNFTGDAVTYLGLIGVISTLIIVVTSFRRYFNSPLKK |
| Ga0185543_10767243 | 3300029318 | Marine | FICWWYYFILQSSLSMTPDTFNFTGDAVTVIGFIGVASTLIILYTAFTRYYNSPLRK |
| Ga0307380_108070631 | 3300031539 | Soil | NSYLLMMPETMTFTGDGVTFLGLIGVISTAIIVITVFRSYSKSPLRK |
| Ga0307379_108037175 | 3300031565 | Soil | RKLRLLMPETMTFTGDGVTFLGLIGVISTAIIVVTVFRSFGNSPLRK |
| Ga0307378_110222383 | 3300031566 | Soil | MNPETLNFTGDAVTFLGLIGVTSTLIILVSVFRSYFNSPLRK |
| Ga0307375_102124164 | 3300031669 | Soil | MPETMTFTGDGVTFLGLIGVISTAIIVNTVFRSYSKSPLRK |
| Ga0315291_105043893 | 3300031707 | Sediment | MPDTLNFTGDGITFLGLIGVISTAIIVITVFRSYYNSPLRK |
| Ga0315293_102924631 | 3300031746 | Sediment | TPDTLNFTGDTVTYLGLVGIISTAIIVVTVFRSYYNSPLRK |
| Ga0315293_105283611 | 3300031746 | Sediment | LMPETMTFTGDGVTFLGLIGVISTTIIVITVFRSYYNSPLRK |
| Ga0315293_107717351 | 3300031746 | Sediment | MMNPDTLNFTGDAFTYLGFVGVISTLIILVTAFTRFYKSPLI |
| Ga0315907_104397096 | 3300031758 | Freshwater | MTPDTLNFTGDATTVLGFIGVISTLIILIAVYRSYWKSPYRR |
| Ga0315907_110634161 | 3300031758 | Freshwater | MPTTLNFTGDAVTYLGLIGVISTLIIVVSVFRSFY |
| Ga0315295_1003607111 | 3300032156 | Sediment | MMPETMTFTGDGVTFLGLIGVISTAIIVVTVFRSYYNSPLRK |
| Ga0315281_105641101 | 3300032163 | Sediment | TKMTPDTLNFTGDTVTYLGLVGIISTAIIVVSVFRSFYKSPLNK |
| Ga0315268_102499053 | 3300032173 | Sediment | MPDSYGFVGDSVTFLGLIGVASTAIILVTIFRSFYNSSLNK |
| Ga0315268_110235391 | 3300032173 | Sediment | LLMPETMTFTGDGVTFLGLIGVISTAIIVVSVFRSFYKSPLRK |
| Ga0315286_120422811 | 3300032342 | Sediment | MMNPDTLNFTGDAFTYLGFVGVISTLIILVTAFTRFYKS |
| Ga0334722_101036464 | 3300033233 | Sediment | MPETMTFTGDGVTFLGLIGVISTAIIVISVFRSFYKSPLRK |
| Ga0334722_101508543 | 3300033233 | Sediment | MINSYDFGGDVVTFLGLIGVISTAIIIVSVFRSYSKSPLRK |
| Ga0316625_1001372844 | 3300033418 | Soil | MNPDTYSFSGDAVTVLGLVGIISTGIILVVAYTRYWNSPLRK |
| Ga0334981_0000728_7364_7489 | 3300033980 | Freshwater | MPEIMTFTGDAVTYLGLIGVISTAIIVVSVFRSYFNSPLRK |
| Ga0334996_0530154_2_109 | 3300033994 | Freshwater | FNGDTVTVLGLVGVISTGIILVLCFTRYFNSPLRK |
| Ga0335028_0467915_63_191 | 3300034071 | Freshwater | MTPDTLNFTGDGITFLGLIGVISTAIIVVSVFRSYYNSPLRK |
| Ga0335058_0008367_3363_3488 | 3300034121 | Freshwater | MPDTFNFTGDAITFLGMVGVVSTGIILVTAFTRYYHSPFRK |
| ⦗Top⦘ |