


| Basic Information | |
|---|---|
| Family ID | F050967 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 144 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MEKPPIRKDYFESECGCRRWYESVPGGPVEELEEVVEYCEIHDVESGSA |
| Number of Associated Samples | 120 |
| Number of Associated Scaffolds | 144 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 31.25 % |
| % of genes near scaffold ends (potentially truncated) | 20.14 % |
| % of genes from short scaffolds (< 2000 bps) | 81.25 % |
| Associated GOLD sequencing projects | 111 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.278 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (12.500 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) (30.556 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 18.18% Coil/Unstructured: 81.82% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 144 Family Scaffolds |
|---|---|---|
| PF00296 | Bac_luciferase | 27.78 |
| PF07883 | Cupin_2 | 12.50 |
| PF13343 | SBP_bac_6 | 3.47 |
| PF08240 | ADH_N | 2.78 |
| PF01063 | Aminotran_4 | 2.08 |
| PF07969 | Amidohydro_3 | 2.08 |
| PF01243 | Putative_PNPOx | 1.39 |
| PF03446 | NAD_binding_2 | 1.39 |
| PF04909 | Amidohydro_2 | 1.39 |
| PF07690 | MFS_1 | 1.39 |
| PF02653 | BPD_transp_2 | 0.69 |
| PF02515 | CoA_transf_3 | 0.69 |
| PF00561 | Abhydrolase_1 | 0.69 |
| PF14833 | NAD_binding_11 | 0.69 |
| PF14691 | Fer4_20 | 0.69 |
| PF01113 | DapB_N | 0.69 |
| PF05015 | HigB-like_toxin | 0.69 |
| PF09084 | NMT1 | 0.69 |
| PF00596 | Aldolase_II | 0.69 |
| PF00378 | ECH_1 | 0.69 |
| PF12706 | Lactamase_B_2 | 0.69 |
| PF01061 | ABC2_membrane | 0.69 |
| PF16113 | ECH_2 | 0.69 |
| PF01547 | SBP_bac_1 | 0.69 |
| PF12697 | Abhydrolase_6 | 0.69 |
| PF03773 | ArsP_1 | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
|---|---|---|---|
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 27.78 |
| COG0115 | Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase | Amino acid transport and metabolism [E] | 4.17 |
| COG0701 | Uncharacterized membrane protein YraQ, UPF0718 family | Function unknown [S] | 0.69 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.69 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.69 |
| COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.69 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.97 % |
| Unclassified | root | N/A | 9.03 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2007427000|2007534805 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 861 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c1882178 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 667 | Open in IMG/M |
| 3300000956|JGI10216J12902_101966498 | All Organisms → cellular organisms → Bacteria | 4900 | Open in IMG/M |
| 3300000956|JGI10216J12902_110532675 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 708 | Open in IMG/M |
| 3300000956|JGI10216J12902_111185467 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-F19 | 1655 | Open in IMG/M |
| 3300002907|JGI25613J43889_10161897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. DOA9 | 586 | Open in IMG/M |
| 3300003319|soilL2_10129483 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1174 | Open in IMG/M |
| 3300003991|Ga0055461_10029814 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| 3300004009|Ga0055437_10076812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 946 | Open in IMG/M |
| 3300004019|Ga0055439_10278633 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300004020|Ga0055440_10069754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 799 | Open in IMG/M |
| 3300004052|Ga0055490_10002157 | All Organisms → cellular organisms → Bacteria | 3375 | Open in IMG/M |
| 3300004067|Ga0055485_10074452 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300004074|Ga0055518_10038370 | Not Available | 989 | Open in IMG/M |
| 3300004114|Ga0062593_102735056 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 562 | Open in IMG/M |
| 3300004156|Ga0062589_100652516 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 924 | Open in IMG/M |
| 3300004157|Ga0062590_102198237 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 577 | Open in IMG/M |
| 3300004266|Ga0055457_10117406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 730 | Open in IMG/M |
| 3300004480|Ga0062592_100246703 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-F19 | 1305 | Open in IMG/M |
| 3300004643|Ga0062591_100635665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 951 | Open in IMG/M |
| 3300004778|Ga0062383_10222545 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300004778|Ga0062383_10466482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 629 | Open in IMG/M |
| 3300004779|Ga0062380_10046928 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1443 | Open in IMG/M |
| 3300005169|Ga0066810_10151398 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 554 | Open in IMG/M |
| 3300005213|Ga0068998_10088089 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 675 | Open in IMG/M |
| 3300005218|Ga0068996_10213548 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 504 | Open in IMG/M |
| 3300005295|Ga0065707_11064185 | Not Available | 524 | Open in IMG/M |
| 3300005829|Ga0074479_11157247 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 606 | Open in IMG/M |
| 3300005830|Ga0074473_10692002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1538 | Open in IMG/M |
| 3300005836|Ga0074470_10446504 | All Organisms → cellular organisms → Bacteria | 18543 | Open in IMG/M |
| 3300005836|Ga0074470_11165286 | All Organisms → cellular organisms → Bacteria | 5702 | Open in IMG/M |
| 3300005836|Ga0074470_11342299 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8070 | Open in IMG/M |
| 3300006845|Ga0075421_100249733 | All Organisms → cellular organisms → Bacteria | 2175 | Open in IMG/M |
| 3300006845|Ga0075421_100336549 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-F19 | 1827 | Open in IMG/M |
| 3300006845|Ga0075421_102209140 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300006845|Ga0075421_102503655 | Not Available | 538 | Open in IMG/M |
| 3300006847|Ga0075431_101081684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 767 | Open in IMG/M |
| 3300006847|Ga0075431_101286088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 693 | Open in IMG/M |
| 3300006865|Ga0073934_10000751 | All Organisms → cellular organisms → Bacteria | 87787 | Open in IMG/M |
| 3300006880|Ga0075429_101639738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300006930|Ga0079303_10331667 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 634 | Open in IMG/M |
| 3300007004|Ga0079218_12271869 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300009078|Ga0105106_10212671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1409 | Open in IMG/M |
| 3300009091|Ga0102851_11748799 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 699 | Open in IMG/M |
| 3300009100|Ga0075418_13142493 | Not Available | 503 | Open in IMG/M |
| 3300009147|Ga0114129_10498944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1590 | Open in IMG/M |
| 3300009162|Ga0075423_10507011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1269 | Open in IMG/M |
| 3300009167|Ga0113563_10583799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1235 | Open in IMG/M |
| 3300009171|Ga0105101_10641559 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 529 | Open in IMG/M |
| 3300009678|Ga0105252_10000281 | All Organisms → cellular organisms → Bacteria | 40834 | Open in IMG/M |
| 3300010037|Ga0126304_10123888 | All Organisms → cellular organisms → Bacteria | 1654 | Open in IMG/M |
| 3300010391|Ga0136847_10517040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 935 | Open in IMG/M |
| 3300010391|Ga0136847_13171411 | Not Available | 1140 | Open in IMG/M |
| 3300010399|Ga0134127_10616032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1116 | Open in IMG/M |
| 3300011405|Ga0137340_1023980 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300011414|Ga0137442_1092834 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 654 | Open in IMG/M |
| 3300011417|Ga0137326_1081612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 727 | Open in IMG/M |
| 3300011429|Ga0137455_1085838 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 913 | Open in IMG/M |
| 3300011430|Ga0137423_1174880 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 648 | Open in IMG/M |
| 3300011434|Ga0137464_1090703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 893 | Open in IMG/M |
| 3300011435|Ga0137426_1030048 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300011438|Ga0137451_1181638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 665 | Open in IMG/M |
| 3300012038|Ga0137431_1005109 | All Organisms → cellular organisms → Bacteria | 3743 | Open in IMG/M |
| 3300012040|Ga0137461_1000246 | All Organisms → cellular organisms → Bacteria | 12481 | Open in IMG/M |
| 3300012041|Ga0137430_1057825 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1058 | Open in IMG/M |
| 3300012179|Ga0137334_1049689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 890 | Open in IMG/M |
| 3300012912|Ga0157306_10322483 | Not Available | 575 | Open in IMG/M |
| 3300013308|Ga0157375_12350935 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-F19 | 636 | Open in IMG/M |
| 3300014260|Ga0075307_1123047 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 559 | Open in IMG/M |
| 3300014304|Ga0075340_1024027 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 937 | Open in IMG/M |
| 3300014308|Ga0075354_1106762 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 593 | Open in IMG/M |
| 3300014870|Ga0180080_1016116 | Not Available | 1025 | Open in IMG/M |
| 3300014872|Ga0180087_1048204 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Halobacteriales → Haloarculaceae → Natronomonas → unclassified Natronomonas → Natronomonas sp. ZY43 | 798 | Open in IMG/M |
| 3300014875|Ga0180083_1017064 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1335 | Open in IMG/M |
| 3300015371|Ga0132258_12131895 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-F19 | 1408 | Open in IMG/M |
| 3300015374|Ga0132255_103175726 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-F19 | 701 | Open in IMG/M |
| 3300018000|Ga0184604_10070934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1016 | Open in IMG/M |
| 3300018031|Ga0184634_10202325 | Not Available | 904 | Open in IMG/M |
| 3300018053|Ga0184626_10041259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1918 | Open in IMG/M |
| 3300018063|Ga0184637_10208991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1196 | Open in IMG/M |
| 3300018071|Ga0184618_10475022 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300018074|Ga0184640_10387537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 631 | Open in IMG/M |
| 3300018074|Ga0184640_10426587 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300018076|Ga0184609_10392467 | Not Available | 646 | Open in IMG/M |
| 3300018077|Ga0184633_10582588 | Not Available | 530 | Open in IMG/M |
| 3300018079|Ga0184627_10122517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1376 | Open in IMG/M |
| 3300018082|Ga0184639_10030601 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2741 | Open in IMG/M |
| 3300018082|Ga0184639_10340083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 784 | Open in IMG/M |
| 3300018084|Ga0184629_10013257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3259 | Open in IMG/M |
| 3300018084|Ga0184629_10384800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 738 | Open in IMG/M |
| 3300018422|Ga0190265_10163313 | All Organisms → cellular organisms → Bacteria | 2196 | Open in IMG/M |
| 3300018429|Ga0190272_10270425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1292 | Open in IMG/M |
| 3300018429|Ga0190272_11866994 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 630 | Open in IMG/M |
| 3300018432|Ga0190275_10017061 | All Organisms → cellular organisms → Bacteria | 5545 | Open in IMG/M |
| 3300018432|Ga0190275_10471276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1283 | Open in IMG/M |
| 3300018466|Ga0190268_10030433 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1905 | Open in IMG/M |
| 3300018466|Ga0190268_11072811 | Not Available | 652 | Open in IMG/M |
| 3300018469|Ga0190270_10006126 | All Organisms → cellular organisms → Bacteria | 6376 | Open in IMG/M |
| 3300018476|Ga0190274_13137550 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-F19 | 556 | Open in IMG/M |
| 3300018476|Ga0190274_13909214 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
| 3300018481|Ga0190271_10676358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1154 | Open in IMG/M |
| 3300019263|Ga0184647_1511241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 932 | Open in IMG/M |
| 3300019884|Ga0193741_1019336 | All Organisms → cellular organisms → Bacteria | 1754 | Open in IMG/M |
| 3300020197|Ga0194128_10101397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1783 | Open in IMG/M |
| 3300021051|Ga0206224_1000102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6590 | Open in IMG/M |
| 3300021081|Ga0210379_10331613 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 668 | Open in IMG/M |
| 3300021082|Ga0210380_10058552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1670 | Open in IMG/M |
| 3300021412|Ga0193736_1022729 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-F19 | 833 | Open in IMG/M |
| 3300022214|Ga0224505_10024077 | All Organisms → cellular organisms → Bacteria | 2704 | Open in IMG/M |
| 3300023102|Ga0247754_1149286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 580 | Open in IMG/M |
| 3300025310|Ga0209172_10000948 | All Organisms → cellular organisms → Bacteria | 70304 | Open in IMG/M |
| 3300025324|Ga0209640_10435419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1078 | Open in IMG/M |
| 3300025901|Ga0207688_10026103 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3210 | Open in IMG/M |
| 3300025951|Ga0210066_1025403 | Not Available | 947 | Open in IMG/M |
| 3300025971|Ga0210102_1062781 | Not Available | 801 | Open in IMG/M |
| 3300026320|Ga0209131_1013218 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5084 | Open in IMG/M |
| 3300027573|Ga0208454_1000182 | All Organisms → cellular organisms → Bacteria | 43846 | Open in IMG/M |
| 3300027815|Ga0209726_10100979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1745 | Open in IMG/M |
| 3300027815|Ga0209726_10172942 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1172 | Open in IMG/M |
| 3300027815|Ga0209726_10175684 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
| 3300027815|Ga0209726_10435332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 603 | Open in IMG/M |
| 3300027815|Ga0209726_10457421 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300027831|Ga0209797_10040848 | All Organisms → cellular organisms → Bacteria | 2087 | Open in IMG/M |
| 3300027909|Ga0209382_10816704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 991 | Open in IMG/M |
| 3300028145|Ga0247663_1027550 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300028578|Ga0272482_10320872 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10153135 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 634 | Open in IMG/M |
| 3300031548|Ga0307408_100146586 | All Organisms → cellular organisms → Bacteria | 1859 | Open in IMG/M |
| 3300031548|Ga0307408_100492444 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1071 | Open in IMG/M |
| 3300031854|Ga0310904_10859235 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 638 | Open in IMG/M |
| 3300031908|Ga0310900_10262338 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1250 | Open in IMG/M |
| 3300031965|Ga0326597_10030442 | All Organisms → cellular organisms → Bacteria | 6875 | Open in IMG/M |
| 3300031965|Ga0326597_10140443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2894 | Open in IMG/M |
| 3300031965|Ga0326597_10221576 | All Organisms → cellular organisms → Bacteria | 2203 | Open in IMG/M |
| 3300032002|Ga0307416_100027317 | All Organisms → cellular organisms → Bacteria | 4224 | Open in IMG/M |
| 3300032163|Ga0315281_11323014 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300032180|Ga0307471_100332007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1623 | Open in IMG/M |
| 3300033412|Ga0310810_10650812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 996 | Open in IMG/M |
| 3300033433|Ga0326726_10011148 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7933 | Open in IMG/M |
| 3300033485|Ga0316626_12202651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 500 | Open in IMG/M |
| 3300033551|Ga0247830_10719539 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300034090|Ga0326723_0229306 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 826 | Open in IMG/M |
| 3300034165|Ga0364942_0143908 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300034178|Ga0364934_0065909 | All Organisms → cellular organisms → Bacteria | 1346 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.50% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 11.81% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 9.72% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 8.33% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.64% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 4.17% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 3.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.47% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.78% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.08% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.08% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.08% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.39% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 1.39% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.39% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 1.39% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.39% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.39% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.39% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.39% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.69% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.69% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.69% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.69% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.69% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.69% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.69% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.69% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.69% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.69% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.69% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2007427000 | Uranium contaminated groundwater from Oak Ridge Integrated Field Research Center, Tennessee | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300003991 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004009 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004020 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004052 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004067 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004074 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004266 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
| 3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
| 3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
| 3300005213 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2 | Environmental | Open in IMG/M |
| 3300005218 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011405 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2 | Environmental | Open in IMG/M |
| 3300011414 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2 | Environmental | Open in IMG/M |
| 3300011417 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2 | Environmental | Open in IMG/M |
| 3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
| 3300011430 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2 | Environmental | Open in IMG/M |
| 3300011434 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2 | Environmental | Open in IMG/M |
| 3300011435 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2 | Environmental | Open in IMG/M |
| 3300011438 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2 | Environmental | Open in IMG/M |
| 3300012038 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2 | Environmental | Open in IMG/M |
| 3300012040 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2 | Environmental | Open in IMG/M |
| 3300012041 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2 | Environmental | Open in IMG/M |
| 3300012179 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2 | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014260 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
| 3300014304 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300014308 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014870 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10D | Environmental | Open in IMG/M |
| 3300014872 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT790_16_10D | Environmental | Open in IMG/M |
| 3300014875 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_1_16_10D | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019263 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
| 3300020197 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m | Environmental | Open in IMG/M |
| 3300021051 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos A1 | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021412 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m1 | Environmental | Open in IMG/M |
| 3300022214 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300023102 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5 | Environmental | Open in IMG/M |
| 3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025951 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025971 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027573 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028145 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04 | Environmental | Open in IMG/M |
| 3300028578 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT160D0 | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2007564094 | 2007427000 | Groundwater | MEKPPIRKDYFEAECGCRQWYESVPGGPVEELEEVVEYCEMHDVESGSA |
| ICChiseqgaiiDRAFT_18821781 | 3300000033 | Soil | MEKPPIRKDYFEAECGCRQWYESVPGRPVXXLEEVXEYCXTHDVESGSA* |
| JGI10216J12902_1019664986 | 3300000956 | Soil | MEKPPIRKEYFEAECGCRQWYESVAGGPVEELEEVVEYCELHDIESGSA* |
| JGI10216J12902_1105326752 | 3300000956 | Soil | MEKPPIRKDYFESDCGCRKWFEPVAGGALDEFEEVVEYCEIHDVESGSA* |
| JGI10216J12902_1111854672 | 3300000956 | Soil | MEKPPIRQDFFESECGCRRWFEPVSDGAAEELQEVVEYCEIHDIESGSA* |
| JGI25613J43889_101618972 | 3300002907 | Grasslands Soil | RRDYFESDCGCKQWYESVPGGPVEELMEFVEYCEIHDVESGSA* |
| soilL2_101294831 | 3300003319 | Sugarcane Root And Bulk Soil | MEKPPIRKDYFESECGCRRWYESVPGGPVEELEEVVEYCETHEVESGSA* |
| Ga0055461_100298142 | 3300003991 | Natural And Restored Wetlands | MEKPPIRKDYFEAECGCRQWYESVPGGPVEELVEVVEYCETHDVESGSA* |
| Ga0055437_100768121 | 3300004009 | Natural And Restored Wetlands | MEKPPIRKDYFESECGCRRWYESVPGGPAEELEEVVEYCETHEIESGSA* |
| Ga0055439_102786331 | 3300004019 | Natural And Restored Wetlands | IRKDYFESECGCKRWYESVPGGPVEVLEEVVEYCEIHDVESGSV* |
| Ga0055440_100697541 | 3300004020 | Natural And Restored Wetlands | LPYGVCNPMEKPPIRKDYFESECGCRRWYESVPGGPAEELEEVVEYCETHEIESGSA* |
| Ga0055490_100021572 | 3300004052 | Natural And Restored Wetlands | METPPIRKDYFEAECGCRQWYESVPGGPVEELVEVVEYCQTHDVESGSA* |
| Ga0055485_100744521 | 3300004067 | Natural And Restored Wetlands | MEKPPIRKDYFESECGCRRWYEFVAGGPVEELEKVVEYCETHDVESGRA* |
| Ga0055518_100383701 | 3300004074 | Natural And Restored Wetlands | MNTGKDKAMGKPPIRKDYFESECGCRRWYESVPGGPVEELEEVVEYCETHDIESGSA |
| Ga0062593_1027350561 | 3300004114 | Soil | MEKPPIRKDYFEAECGCRQWYESVPDGPVEELVEVVEYCEIHDV |
| Ga0062589_1006525162 | 3300004156 | Soil | MEKPPIRKDYFEAECGCRQWYESVPGGPVEELEEVVEYCEMHDVESGSA* |
| Ga0062590_1021982372 | 3300004157 | Soil | MEKPPIRKDYFEAECGCRQWYESVPDGPVEELVEVVEYCEIHDVESGSA* |
| Ga0055457_101174062 | 3300004266 | Natural And Restored Wetlands | RKDYFERECGCKRWHEFVAGGPVEELEEVVEYCETHDVESGSA* |
| Ga0062592_1002467032 | 3300004480 | Soil | MEKPPIRKDFFESECGCRRWYESVTDGSAEEFEEIVEYCEIHDIESGSA* |
| Ga0062591_1006356651 | 3300004643 | Soil | KLSMEKPPIRKDYFEAECGCRQWYESVPGGPVEELEEVVEYCEMHDVESGSA* |
| Ga0062383_102225452 | 3300004778 | Wetland Sediment | MEKPPIRKDYFEAECGCRQWYESVPGGPVEVLEEVVEYCETHDVESGSA* |
| Ga0062383_104664822 | 3300004778 | Wetland Sediment | MEKPPVRKDYFEAECGCRQWYESVPGGPVEELVEVVEYCDTHDIESGSA* |
| Ga0062380_100469281 | 3300004779 | Wetland Sediment | MEKPPIRKDYFVAECGCRQWYESVPGGPVEVLEEVVEYCEIHDIESGSA* |
| Ga0066810_101513981 | 3300005169 | Soil | MEKPPIRKDYFKAECGCRQWYESVPGSPVEELVEVVEYCETHDVESGSA* |
| Ga0068998_100880892 | 3300005213 | Natural And Restored Wetlands | MEKPPIRKDYFEAECGCRQWYESVPGGPVEELVEVVEYCETHDLESGSA* |
| Ga0068996_102135481 | 3300005218 | Natural And Restored Wetlands | MEKPPIRKDYFEAECGCRQWYESVPGRPAEELEEVVEYCETHDVEGGSA* |
| Ga0065707_110641852 | 3300005295 | Switchgrass Rhizosphere | MEKPPIRKDYFESECGCRRWYESVPGGPVDELEEVVEYCEIHDVESGSA* |
| Ga0074479_111572472 | 3300005829 | Sediment (Intertidal) | MEKPPIRKDYFEAECGCRQWYESVPGGPVDELVEVVEYCEMHDIESGSA* |
| Ga0074473_106920022 | 3300005830 | Sediment (Intertidal) | MEKPPIRKDYFEAECGCRQWYESVPGGPVEELVEVVEYCETHDIESGSA* |
| Ga0074470_104465043 | 3300005836 | Sediment (Intertidal) | MEKPPIRRDYFEAECGCRQWYESVPGGPVEELVEVVEYCETHDVESGSA* |
| Ga0074470_111652865 | 3300005836 | Sediment (Intertidal) | MERPPIRKDYFESECGCRRWYESVPGGAAEELEEVVEYCETHEIESGSA* |
| Ga0074470_113422995 | 3300005836 | Sediment (Intertidal) | MEKPPIRKDYFEAECGCRQWYESIPGRPVEELEEVVEYCETHDIESGSA* |
| Ga0075421_1002497334 | 3300006845 | Populus Rhizosphere | MEKPPIRTDFIEHDCGCRRWYESVVGRPVEELTEVVEYCAIHEIESDSS* |
| Ga0075421_1003365493 | 3300006845 | Populus Rhizosphere | MEQRPPIRKDFFESECGCRRWYESVSDDSLEELEEVVEYCEIHDIESGSA* |
| Ga0075421_1022091401 | 3300006845 | Populus Rhizosphere | MEKPPIRKDFFESECGCRRWYESVPDGSVDELEEVVEYCEMHDIESGSA* |
| Ga0075421_1025036552 | 3300006845 | Populus Rhizosphere | MEKPPIRKDFFESECGCRRWYESVTDGSAEELEEVVEYCDIHDIESGSA* |
| Ga0075431_1010816842 | 3300006847 | Populus Rhizosphere | MEKPPIRKDYFESECGCRRWYESVPGGPVDELEEVVEYCEIH |
| Ga0075431_1012860882 | 3300006847 | Populus Rhizosphere | MEKPPIRKDFFESECGCRRWYESVSDDSLEELEEVVEYCEIHDIESGSA* |
| Ga0073934_1000075151 | 3300006865 | Hot Spring Sediment | MERPPIRKDFFESECGCRRWYESVPGGPVEELEEVVEYCEMHEIESGSA* |
| Ga0075429_1016397381 | 3300006880 | Populus Rhizosphere | MEKPPIRKDYFESECGCRRWYESVSDDSTDELEEVVEY |
| Ga0079303_103316672 | 3300006930 | Deep Subsurface | MEKPPIRKDYFEAECGCRQWYESVPGRPVEELEEVVEYCETHDVESGSA* |
| Ga0079218_122718692 | 3300007004 | Agricultural Soil | IRTDFIEHDCGCRRWYESIVGRPVEELREVVEYCAIHEIESDSS* |
| Ga0105106_102126712 | 3300009078 | Freshwater Sediment | MEKPPIRKDYFEAECGCRQWYESVPGGPVDELVEVVEYCETHDVESGSA* |
| Ga0102851_117487991 | 3300009091 | Freshwater Wetlands | MEKPPIRKDYFEAECGCRQWYESVPGGPVEELVEVVEYGETHD |
| Ga0075418_131424931 | 3300009100 | Populus Rhizosphere | MEKPPIRRDFFESECGCRRWYESVSDGSLEELEEVVEYCEIHDIESGSA* |
| Ga0114129_104989441 | 3300009147 | Populus Rhizosphere | MEKSPIRKDYFESECGCRRWYESVSDGSLEELEEVVEYCEIHDIESGSA* |
| Ga0075423_105070112 | 3300009162 | Populus Rhizosphere | MEKPPIRKDYFESECGCRRWYEAVSDDSTEELEEVVEYCETHDIESGSA* |
| Ga0113563_105837991 | 3300009167 | Freshwater Wetlands | MEKPPIRKDYFEAECGCRQWYESVPGGPVEELVEVVEYCETHDVESGS |
| Ga0105101_106415591 | 3300009171 | Freshwater Sediment | MKKPPIRKDYFEAECGCRQWYESVPGGAVDELVEVVEYCETHDVESGSA* |
| Ga0105252_1000028113 | 3300009678 | Soil | MRRNSSFMVKPVIRKDHVERECGCRRWHESVLGDPVEELEEVVEYCEMHDIESRSA* |
| Ga0126304_101238882 | 3300010037 | Serpentine Soil | MEKPPIRKDYFESDCGCRKWFEPVPGGALDEFEEVVEYCEIHDVESGSA* |
| Ga0136847_105170401 | 3300010391 | Freshwater Sediment | MEKPPIRKDYFESECGCRRWYESVPGGPVEELEEVVEYCEMHEVESGSA* |
| Ga0136847_131714112 | 3300010391 | Freshwater Sediment | MVKPLIRKDHVERECGCRRWYESVPGGPVEELEEVVEYCEIHDVESGSA* |
| Ga0134127_106160321 | 3300010399 | Terrestrial Soil | MEKPPIRKDYFESECGCRRWYESVSDDSTEELEEVVEYCETHDIESGSA* |
| Ga0137340_10239802 | 3300011405 | Soil | MEKPPIRKDYFEAECGCRQWYESVPGGPVEELEEVVEYCETHDIESGSA* |
| Ga0137442_10928342 | 3300011414 | Soil | MEKPPVRKDYFEAECGCRQWYESVPGGPVEELEEVVEYCETHDIESGSA* |
| Ga0137326_10816121 | 3300011417 | Soil | MEKPPIRKDFFESECGCRRWYESVTDGSAEELEEVVEYCDIHDI |
| Ga0137455_10858382 | 3300011429 | Soil | MEKPPIRKDYFEAECGCRQWYESVPGGPVEELEEIVEYCE |
| Ga0137423_11748802 | 3300011430 | Soil | MEKPPIRKDYFEAECGCRQWYESVPGGPVEELEEVVEYCETHD |
| Ga0137464_10907032 | 3300011434 | Soil | MEKPPIRKDYFEAECGCRQWYESVPDGPVEELVEVVEYCETHDVESGSA* |
| Ga0137426_10300481 | 3300011435 | Soil | MVKPVIRKDHVERECGCRRWHESVLGDPVEELEEVVEYCEMHDI |
| Ga0137451_11816382 | 3300011438 | Soil | MEKPPIRKDYFESECGCRRWYESVPGGPVDELEEVVEYCEIHDIESGSA* |
| Ga0137431_10051091 | 3300012038 | Soil | MGKPPIRKDYFESECGCRRWYESVPGGPVDELEEVVEYCEIHDIESSSA* |
| Ga0137461_100024610 | 3300012040 | Soil | MEKPPIRKDYFESECGCRKWYESVPGGPVEVLEEVVEYCEMHEIESGSA* |
| Ga0137430_10578252 | 3300012041 | Soil | MEKPPIRKHYFEAECGCRQWYESVPGGPVEELVEVVEYCETHDVESGSA* |
| Ga0137334_10496892 | 3300012179 | Soil | MEKPPIRKDYFESECGCRRWYESVPGGPVDKLEEVVEYCEIHDVES |
| Ga0157306_103224832 | 3300012912 | Soil | MEKPPIRKDFFESECGCRRWYESVSDGSVEELEEVVEYCEMHDIESGSA* |
| Ga0157375_123509351 | 3300013308 | Miscanthus Rhizosphere | MEKPPIRKDYFESECGCRRWYESVSDGSVEELEEVVEYCEMHDIESGSA* |
| Ga0075307_11230472 | 3300014260 | Natural And Restored Wetlands | MEKPPIRKDYFEAECGCRQWYESVPGAPVEELVEVVEYCETHDVESGSA* |
| Ga0075340_10240272 | 3300014304 | Natural And Restored Wetlands | METPPIRKGYFEAECGCRQWYESVPGGPVEELVEVVEYCQTHDVESGSA* |
| Ga0075354_11067622 | 3300014308 | Natural And Restored Wetlands | MEKPPIRKDYFEAECGCRQWYESVPGSPVEELVEVVEYCETHDVESGSA* |
| Ga0180080_10161161 | 3300014870 | Soil | MEKPPIRKDYFESDCGCRRWYESVPGGPVEVLEEVVEYCEIHDVESGSS* |
| Ga0180087_10482043 | 3300014872 | Soil | MEKPPIRKDYFESECGCRRWYESVPGGPGEEFEQV |
| Ga0180083_10170642 | 3300014875 | Soil | MEKPPIRKDYFEAECGCRQWYESVPGGSVEELVEVVEYCETHDVESGSA* |
| Ga0132258_121318952 | 3300015371 | Arabidopsis Rhizosphere | LEKPPIRKDFFESECGCRRWYESVSDGSAEELEEIVEYCEMHDIESGSA* |
| Ga0132255_1031757262 | 3300015374 | Arabidopsis Rhizosphere | LEKPPIRKDFFESECGCRRWYESVSDGSAEELEEVVEYCEMHDIESGSA* |
| Ga0184604_100709342 | 3300018000 | Groundwater Sediment | MEKPPIRKDFFESECGCRRWYESVSDDSAEELEEVVEYCEIHDVESGSA |
| Ga0184634_102023252 | 3300018031 | Groundwater Sediment | MEKPPIRRDYFESECGCRRWYESVPGGPVEELEEVVEYCEMHEIESGSA |
| Ga0184626_100412592 | 3300018053 | Groundwater Sediment | MEKPPIRKDYFESECGCRRWYESVPGGPVEELEEVVEYCAIHDVESGSA |
| Ga0184637_102089913 | 3300018063 | Groundwater Sediment | MEKPPIRKDYFESECGCRCWYESVPGGPVEELEEVVEYCEIHDVERGSA |
| Ga0184618_104750222 | 3300018071 | Groundwater Sediment | MEKSPIRKDFFESECGCRRWYESVSDDSAEELEEVVEYCEIHDVESGSA |
| Ga0184640_103875371 | 3300018074 | Groundwater Sediment | MEKLPIRKDYFESECGCRRWYESVPGGPVEELEEVVEYCEMHDVESGSA |
| Ga0184640_104265872 | 3300018074 | Groundwater Sediment | MEKPPIRRDYFESECGCRRWYESVPGGPVEELEEVVEYCEMHDVESGSA |
| Ga0184609_103924672 | 3300018076 | Groundwater Sediment | MEKPPIRKDFFESECGCRRWYELVSDGSAEELEEVVEYCEIHDVESGSA |
| Ga0184633_105825881 | 3300018077 | Groundwater Sediment | MEKPPIRKDYFESECGCRRWYESVPGGPVEELEEVVEYCEIHDVESGSA |
| Ga0184627_101225171 | 3300018079 | Groundwater Sediment | DYFESECGCRCWYESVPGGPVEELEEVVEYCEIHDVESGSA |
| Ga0184639_100306012 | 3300018082 | Groundwater Sediment | MEKPPIRRDYFESDCGCKRWYESVAGGPVEKLEEVVEYCEIHDVESGSA |
| Ga0184639_103400832 | 3300018082 | Groundwater Sediment | MEKPPIRKDYFESECGCRRWYESVPGGPVDELEEIVEYCDMHDVEGGSA |
| Ga0184629_100132574 | 3300018084 | Groundwater Sediment | MEKPPIRKDYFESECGCRRWYESVPGGPVDELEEVVEYCEIHDIESGSA |
| Ga0184629_103848002 | 3300018084 | Groundwater Sediment | MEKPPIRKDYFESECGCRRWYESVPGGPVDELEEVVEYCEIHDVESGSA |
| Ga0190265_101633131 | 3300018422 | Soil | MEKPPIRKDYFEAECGCRQWYESVPGGPVEELVEVVEYCETHDIESGSA |
| Ga0190272_102704252 | 3300018429 | Soil | MEKPPIRKDYFEAECGCRQWYESVAGGPAEELEEVVEYCEMHDIESGSA |
| Ga0190272_118669942 | 3300018429 | Soil | MEKPPIRKDYFEAECGCRQWYESVPGGPVEELEEIVEYCETHDIESGSA |
| Ga0190275_100170613 | 3300018432 | Soil | MEKPPIRKAYFEAECGCRQWYESVAGGPVEELEEVVEYCELHDIESGSA |
| Ga0190275_104712763 | 3300018432 | Soil | MEKPPIRKDYFEAECGCRQWYESVPGGPVEELVEVVEYCETHDTESGSA |
| Ga0190268_100304332 | 3300018466 | Soil | MEKPPIRKEYFEAECGCRQWYESVAGGPVEELEEVVEYCELHDIESGSA |
| Ga0190268_110728111 | 3300018466 | Soil | MEKPPIRQDFFESECGCRRWFEPVSDGAAEELQEVVEYCEIHDIESGSA |
| Ga0190270_100061265 | 3300018469 | Soil | MEKPPIRKDFFESECGCRRWYESVTDGSAEELEEVVEYCDIHDIESGSA |
| Ga0190274_131375501 | 3300018476 | Soil | PIRKDFFESECGCRRWYESVTDGSAEELEEVVEYCDIHDIESGSA |
| Ga0190274_139092142 | 3300018476 | Soil | MEKPPIRKDYFESDCGCRKWFEPVPGGALDEFEEVVEYCEIHDVESGSA |
| Ga0190271_106763582 | 3300018481 | Soil | MERPPIRKDYFEAECGCRQWYESVPGGPVEELEEVVEYCETHDIESGSA |
| Ga0184647_15112411 | 3300019263 | Groundwater Sediment | MEKPPIRKDYFESECGCRRWYESVSDGSVEELEEVVEYCEMHDIESGSA |
| Ga0193741_10193361 | 3300019884 | Soil | VEKPPIRKDFFESECGCRRWYESVSDGAVEEFEEVVEYCEIHDIESGSA |
| Ga0194128_101013974 | 3300020197 | Freshwater Lake | MEKPPIRKDYFESECGCRKWYESVPGGPVEELEEVVEYCETHDNESGSA |
| Ga0206224_10001028 | 3300021051 | Deep Subsurface Sediment | MEKPPIRKDYFESDCGCRRWYESVPGGPVEALEEVVEYCEIHDVESGSS |
| Ga0210379_103316132 | 3300021081 | Groundwater Sediment | MEKPPIRKDYFEAECGCRQWYESVPDGPVEELVEVVEYCE |
| Ga0210380_100585521 | 3300021082 | Groundwater Sediment | MEKPPIRKDYFEAECGCRQWYESVPGGPVEELEEVVEYCETHDIESGSA |
| Ga0193736_10227292 | 3300021412 | Soil | VEKPPIRKDFFESECGCRRWYESVSDGAVEELEEVVEYCEIHDIESGSA |
| Ga0224505_100240773 | 3300022214 | Sediment | MEKPPIRKDYFEAECGCRQWYESVPGGPVEVLEEVVEYCETHDVESGSA |
| Ga0247754_11492861 | 3300023102 | Soil | PMEKPPIRKDYFEAECGCRQWYESVPGSPVEELVEVVEYCETHDVESGSA |
| Ga0209172_1000094851 | 3300025310 | Hot Spring Sediment | MERPPIRKDFFESECGCRRWYESVPGGPVEELEEVVEYCEMHEIESGSA |
| Ga0209640_104354191 | 3300025324 | Soil | MEKPPIRKDYFESECGCRRWYESVPGGPVEELEEVVEYCETHDVESGSA |
| Ga0207688_100261033 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | KDYFEAECGCRQWYESVPGSPVEELVEVVEYCETHDVESGSA |
| Ga0210066_10254032 | 3300025951 | Natural And Restored Wetlands | MEKPPIRKDYFESECGCRRWYEFVAGGPVEELEKVVEYCETHDVESGRA |
| Ga0210102_10627812 | 3300025971 | Natural And Restored Wetlands | MEKPPIRKDYFESECGCRRWYEFVAGGPVEELEVVEYCETHDIESGSA |
| Ga0209131_10132183 | 3300026320 | Grasslands Soil | MEKPPIRRDYFESDCGCRQWYESVPGGPVEELMEFVEYCEIHDVESGSA |
| Ga0208454_100018235 | 3300027573 | Soil | MRRNSSFMVKPVIRKDHVERECGCRRWHESVLGDPVEELEEVVEYCEMHDIESRSA |
| Ga0209726_101009792 | 3300027815 | Groundwater | MTLMEKPPIRKDYFESECGCRKWFESVPGGPVEVLEEVVEYCETHEIESGSA |
| Ga0209726_101729421 | 3300027815 | Groundwater | MDRPPIRKDYFESECGCRKWFESVPGGPVEELEEVVEYCETHDVESGSA |
| Ga0209726_101756843 | 3300027815 | Groundwater | MEKPPIRKDYFESECGCRKWFESVPGGPVEELEEVVEYCEMHDIESGSA |
| Ga0209726_104353322 | 3300027815 | Groundwater | MFLTEKPPIRKHYFESECGCRRWYESIPGGPVEELEEVVEYYKIHDVESGSA |
| Ga0209726_104574211 | 3300027815 | Groundwater | MPPMEKPPIRKDYFESDCGCKRWYESVPGGPVEELEEVVEYCEMHEIESGSA |
| Ga0209797_100408482 | 3300027831 | Wetland Sediment | MEKPPIRKDYFVAECGCRQWYESVPGGPVEVLEEVVEYCEIHDIESGSA |
| Ga0209382_108167042 | 3300027909 | Populus Rhizosphere | MEKPPIRTDFIEHDCGCRRWYESVVGRPVEELTEVVEYCAIHEIESDSS |
| Ga0247663_10275502 | 3300028145 | Soil | MATMEKPPIRRDYFESDCGCKRWYESVPGGPVEELMEYVEYCEIHDVESGSA |
| Ga0272482_103208721 | 3300028578 | Soil | MEKPPIRKDYFEAECGCRQWYEPVAGGPAEELEEVVE |
| (restricted) Ga0255310_101531352 | 3300031197 | Sandy Soil | MLSTEKPLIRKDYFESECGCRRWYESTAGRPVEELEEVVEYCEIHNVESGSA |
| Ga0307408_1001465862 | 3300031548 | Rhizosphere | MTPYRSMEEPPIRTDYIEHDCGCRRWYESVVGGPVEELREVVEYCAIHEIESDSS |
| Ga0307408_1004924441 | 3300031548 | Rhizosphere | MEKSPIRKDYFESDCGCRKWFEPVPGGALDEFEEVVEYCEIHDVESGSA |
| Ga0310904_108592352 | 3300031854 | Soil | MEKPPIRRDYFESDCGCRKWFEPVPGGALDEFEEVVEYCEIHDVESGSA |
| Ga0310900_102623382 | 3300031908 | Soil | MEKPPIRKDYFEAECGCRQWYESVPGSPVEELVEVVEYCETHDVESGSA |
| Ga0326597_100304421 | 3300031965 | Soil | MEKPPIRKDYFESECGCRRWYESVPGGPVEELEEVVEYCET |
| Ga0326597_101404433 | 3300031965 | Soil | PMEKPPIRKDYFESECGCRRWYESVPGGPVEELEEVVEYCETHDVESGSA |
| Ga0326597_102215761 | 3300031965 | Soil | MEKPPIRKNYFESECGCRRWYESVPGGPVEELEEVVEYCEIHDVESGS |
| Ga0307416_1000273172 | 3300032002 | Rhizosphere | MTPYRSMEEPPIRTDYIEHDCGCRRWYESVVGRSVEELREVVEYCAIHEIESDSS |
| Ga0315281_113230142 | 3300032163 | Sediment | MEKPPIRKDYFESECGCRKWYESVPGGPVEDLEEVVEYCEMHEIESGSA |
| Ga0307471_1003320071 | 3300032180 | Hardwood Forest Soil | MEKPPIRKDYFESECGCRRWYESVLGGPVDELEEVVEYCEIHD |
| Ga0310810_106508122 | 3300033412 | Soil | MEKPPIRRDYFESDCGCKQWYESVPGGPVEELMEFVEYCEIHDVESGSA |
| Ga0326726_100111482 | 3300033433 | Peat Soil | MEKPPIRKDYFEAECGCRQWYESVPGRPVEELVEVVEYCETHDIESGSA |
| Ga0316626_122026511 | 3300033485 | Soil | MEKPPIRKDYFEAECGCRQWYESVPGRPVEELEEVVEYCETHDVESGSA |
| Ga0247830_107195392 | 3300033551 | Soil | MEKPPIRTDFIEHDCGCRRWYESVVGRPVDELREVVEYCAIHEIESDSS |
| Ga0326723_0229306_1_138 | 3300034090 | Peat Soil | MEKPPIRKDYFEAECGCRQWYESVPGGPVEELVEVVEYCETHDIES |
| Ga0364942_0143908_379_528 | 3300034165 | Sediment | MEKPPIRKDYFEGECGCRRWYESVPGGPVEELEEVVEYCEVHDVESGSA |
| Ga0364934_0065909_769_918 | 3300034178 | Sediment | MEKPLIRKDYFESECGCKRWYESVPGGPVEELEEIVEYCEIHDVESGSA |
| ⦗Top⦘ |