


| Basic Information | |
|---|---|
| Family ID | F050964 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 144 |
| Average Sequence Length | 47 residues |
| Representative Sequence | LAERLARRHGMTVAVTNRKRSPSHEIDEAAIRALRSQADLVVSGIGD |
| Number of Associated Samples | 129 |
| Number of Associated Scaffolds | 144 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.69 % |
| % of genes near scaffold ends (potentially truncated) | 95.14 % |
| % of genes from short scaffolds (< 2000 bps) | 90.28 % |
| Associated GOLD sequencing projects | 125 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.667 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.806 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.778 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (33.333 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.33% β-sheet: 0.00% Coil/Unstructured: 78.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 144 Family Scaffolds |
|---|---|---|
| PF00296 | Bac_luciferase | 7.64 |
| PF13580 | SIS_2 | 6.94 |
| PF01042 | Ribonuc_L-PSP | 4.86 |
| PF13378 | MR_MLE_C | 3.47 |
| PF14064 | HmuY | 2.78 |
| PF01380 | SIS | 2.78 |
| PF01641 | SelR | 2.08 |
| PF07969 | Amidohydro_3 | 2.08 |
| PF05685 | Uma2 | 2.08 |
| PF01575 | MaoC_dehydratas | 1.39 |
| PF00920 | ILVD_EDD | 1.39 |
| PF00583 | Acetyltransf_1 | 0.69 |
| PF00449 | Urease_alpha | 0.69 |
| PF08445 | FR47 | 0.69 |
| PF00578 | AhpC-TSA | 0.69 |
| PF05258 | DciA | 0.69 |
| PF02771 | Acyl-CoA_dh_N | 0.69 |
| PF01738 | DLH | 0.69 |
| PF00152 | tRNA-synt_2 | 0.69 |
| PF13594 | Obsolete Pfam Family | 0.69 |
| PF07238 | PilZ | 0.69 |
| PF13416 | SBP_bac_8 | 0.69 |
| PF01547 | SBP_bac_1 | 0.69 |
| PF02518 | HATPase_c | 0.69 |
| PF00487 | FA_desaturase | 0.69 |
| PF13622 | 4HBT_3 | 0.69 |
| PF01207 | Dus | 0.69 |
| PF03466 | LysR_substrate | 0.69 |
| PF02515 | CoA_transf_3 | 0.69 |
| PF00561 | Abhydrolase_1 | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
|---|---|---|---|
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 7.64 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 4.86 |
| COG0129 | Dihydroxyacid dehydratase/phosphogluconate dehydratase | Carbohydrate transport and metabolism [G] | 2.78 |
| COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 2.08 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 2.08 |
| COG0017 | Aspartyl/asparaginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| COG0173 | Aspartyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| COG0804 | Urease alpha subunit | Amino acid transport and metabolism [E] | 0.69 |
| COG1190 | Lysyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.69 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.69 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.69 |
| COG2269 | Elongation factor P--beta-lysine ligase (EF-P beta-lysylation pathway) | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.69 |
| COG5512 | Predicted nucleic acid-binding protein, contains Zn-ribbon domain (includes truncated derivatives) | General function prediction only [R] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.67 % |
| Unclassified | root | N/A | 7.64 % |
| Thermosipho africanus | species | Thermosipho africanus | 0.69 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000550|F24TB_11621284 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1173 | Open in IMG/M |
| 3300000955|JGI1027J12803_103704889 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300000955|JGI1027J12803_108867966 | All Organisms → cellular organisms → Bacteria | 1485 | Open in IMG/M |
| 3300001990|JGI24737J22298_10228243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharomonospora → Saccharomonospora marina | 549 | Open in IMG/M |
| 3300003347|JGI26128J50194_1013129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 520 | Open in IMG/M |
| 3300004009|Ga0055437_10221612 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300004267|Ga0066396_10099619 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300005166|Ga0066674_10240059 | Not Available | 861 | Open in IMG/M |
| 3300005175|Ga0066673_10257521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1011 | Open in IMG/M |
| 3300005175|Ga0066673_10878745 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300005180|Ga0066685_11034362 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300005293|Ga0065715_10335254 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300005332|Ga0066388_107734081 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300005457|Ga0070662_101808992 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 528 | Open in IMG/M |
| 3300005467|Ga0070706_100609417 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300005468|Ga0070707_100311326 | All Organisms → cellular organisms → Bacteria | 1530 | Open in IMG/M |
| 3300005468|Ga0070707_101231701 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300005569|Ga0066705_10881464 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300005586|Ga0066691_10130352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1434 | Open in IMG/M |
| 3300005616|Ga0068852_101910426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 616 | Open in IMG/M |
| 3300006845|Ga0075421_102512390 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300006846|Ga0075430_101154367 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300006853|Ga0075420_100326967 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
| 3300006853|Ga0075420_100755444 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300006880|Ga0075429_101292970 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 636 | Open in IMG/M |
| 3300006894|Ga0079215_10441324 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300007076|Ga0075435_100371575 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
| 3300007076|Ga0075435_100596346 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300009038|Ga0099829_10858773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 753 | Open in IMG/M |
| 3300009090|Ga0099827_10609980 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 941 | Open in IMG/M |
| 3300009137|Ga0066709_103116166 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 606 | Open in IMG/M |
| 3300009147|Ga0114129_10146945 | All Organisms → cellular organisms → Bacteria | 3228 | Open in IMG/M |
| 3300009147|Ga0114129_13373990 | Not Available | 514 | Open in IMG/M |
| 3300009156|Ga0111538_13721497 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300009799|Ga0105075_1043634 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300009816|Ga0105076_1111726 | Not Available | 537 | Open in IMG/M |
| 3300009821|Ga0105064_1050231 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300009836|Ga0105068_1041169 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. CG24C | 823 | Open in IMG/M |
| 3300010047|Ga0126382_11688415 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300010304|Ga0134088_10117771 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
| 3300010358|Ga0126370_10266163 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
| 3300010359|Ga0126376_10230426 | All Organisms → cellular organisms → Bacteria | 1560 | Open in IMG/M |
| 3300010359|Ga0126376_10947763 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 856 | Open in IMG/M |
| 3300010359|Ga0126376_11148220 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300010362|Ga0126377_10201276 | All Organisms → cellular organisms → Bacteria | 1909 | Open in IMG/M |
| 3300010366|Ga0126379_13157312 | Not Available | 552 | Open in IMG/M |
| 3300011270|Ga0137391_10841056 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300012034|Ga0137453_1132020 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300012035|Ga0137445_1122464 | Not Available | 530 | Open in IMG/M |
| 3300012202|Ga0137363_10594098 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300012203|Ga0137399_10361674 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
| 3300012203|Ga0137399_11680358 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300012211|Ga0137377_10537732 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
| 3300012211|Ga0137377_11487978 | Not Available | 603 | Open in IMG/M |
| 3300012353|Ga0137367_11195712 | Not Available | 508 | Open in IMG/M |
| 3300012358|Ga0137368_10263233 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1185 | Open in IMG/M |
| 3300012359|Ga0137385_10769213 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300012360|Ga0137375_10644044 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 874 | Open in IMG/M |
| 3300012361|Ga0137360_10927779 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300012402|Ga0134059_1074701 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300012929|Ga0137404_11057884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 743 | Open in IMG/M |
| 3300012951|Ga0164300_10791165 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300012977|Ga0134087_10756773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 521 | Open in IMG/M |
| 3300012986|Ga0164304_11175281 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300012989|Ga0164305_11893618 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300013308|Ga0157375_11714776 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300014302|Ga0075310_1022451 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300014497|Ga0182008_10119770 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
| 3300015371|Ga0132258_12496880 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
| 3300015373|Ga0132257_100076837 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3793 | Open in IMG/M |
| 3300016357|Ga0182032_10152520 | All Organisms → cellular organisms → Bacteria | 1710 | Open in IMG/M |
| 3300016387|Ga0182040_11500711 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300016445|Ga0182038_10694362 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300017944|Ga0187786_10057787 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
| 3300017973|Ga0187780_10341606 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300017994|Ga0187822_10113215 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300018079|Ga0184627_10285689 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300019259|Ga0184646_1017381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 734 | Open in IMG/M |
| 3300019789|Ga0137408_1462907 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1244 | Open in IMG/M |
| 3300019879|Ga0193723_1003730 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5363 | Open in IMG/M |
| 3300020070|Ga0206356_10751716 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300020109|Ga0194112_10289798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1248 | Open in IMG/M |
| 3300021088|Ga0210404_10483275 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300022756|Ga0222622_11469109 | Not Available | 502 | Open in IMG/M |
| 3300023067|Ga0247743_1063535 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300025324|Ga0209640_11340798 | Not Available | 527 | Open in IMG/M |
| 3300025560|Ga0210108_1026281 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300025711|Ga0207696_1083898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SE158 | 878 | Open in IMG/M |
| 3300025925|Ga0207650_10402808 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300025933|Ga0207706_10249447 | All Organisms → cellular organisms → Bacteria | 1551 | Open in IMG/M |
| 3300025933|Ga0207706_10929874 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300025934|Ga0207686_10075385 | All Organisms → cellular organisms → Bacteria | 2184 | Open in IMG/M |
| 3300025941|Ga0207711_11320063 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300025972|Ga0207668_10955273 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 765 | Open in IMG/M |
| 3300025999|Ga0208417_101479 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300026296|Ga0209235_1285243 | Not Available | 505 | Open in IMG/M |
| 3300026315|Ga0209686_1030465 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2075 | Open in IMG/M |
| 3300026324|Ga0209470_1043974 | All Organisms → cellular organisms → Bacteria | 2192 | Open in IMG/M |
| 3300026329|Ga0209375_1061404 | All Organisms → cellular organisms → Bacteria | 1821 | Open in IMG/M |
| 3300026331|Ga0209267_1056538 | All Organisms → cellular organisms → Bacteria | 1753 | Open in IMG/M |
| 3300026535|Ga0256867_10078583 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
| 3300026552|Ga0209577_10011076 | All Organisms → cellular organisms → Bacteria | 8175 | Open in IMG/M |
| 3300027013|Ga0209884_1038946 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 513 | Open in IMG/M |
| 3300027277|Ga0209846_1039598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 737 | Open in IMG/M |
| 3300027490|Ga0209899_1100139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 554 | Open in IMG/M |
| 3300027490|Ga0209899_1104939 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300027655|Ga0209388_1033918 | All Organisms → cellular organisms → Bacteria | 1465 | Open in IMG/M |
| 3300027682|Ga0209971_1000085 | All Organisms → cellular organisms → Bacteria | 28632 | Open in IMG/M |
| 3300027787|Ga0209074_10494811 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300027821|Ga0209811_10082499 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
| 3300027882|Ga0209590_10383468 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300028590|Ga0247823_11379321 | Not Available | 528 | Open in IMG/M |
| 3300028812|Ga0247825_10672741 | Thermosipho africanus → Thermosipho africanus H17ap60334 | 744 | Open in IMG/M |
| 3300028889|Ga0247827_10011905 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3445 | Open in IMG/M |
| 3300030336|Ga0247826_11665036 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300031170|Ga0307498_10147390 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10191056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 571 | Open in IMG/M |
| 3300031226|Ga0307497_10033787 | All Organisms → cellular organisms → Bacteria | 1689 | Open in IMG/M |
| 3300031228|Ga0299914_10618259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 924 | Open in IMG/M |
| 3300031548|Ga0307408_100122669 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2015 | Open in IMG/M |
| 3300031719|Ga0306917_10156378 | All Organisms → cellular organisms → Bacteria | 1696 | Open in IMG/M |
| 3300031720|Ga0307469_10298010 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300031740|Ga0307468_100670039 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300031748|Ga0318492_10763065 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300031764|Ga0318535_10491353 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300031793|Ga0318548_10138408 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
| 3300031795|Ga0318557_10042452 | All Organisms → cellular organisms → Bacteria | 1889 | Open in IMG/M |
| 3300031835|Ga0318517_10225384 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300031854|Ga0310904_10049807 | All Organisms → cellular organisms → Bacteria | 2083 | Open in IMG/M |
| 3300031890|Ga0306925_12021253 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300031894|Ga0318522_10258839 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300031897|Ga0318520_10413180 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300031913|Ga0310891_10207329 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 661 | Open in IMG/M |
| 3300031943|Ga0310885_10642286 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300032004|Ga0307414_11277322 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300032055|Ga0318575_10013359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3250 | Open in IMG/M |
| 3300032066|Ga0318514_10292777 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300032067|Ga0318524_10319240 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300032180|Ga0307471_100070734 | All Organisms → cellular organisms → Bacteria | 3008 | Open in IMG/M |
| 3300032180|Ga0307471_100109287 | All Organisms → cellular organisms → Bacteria | 2538 | Open in IMG/M |
| 3300032180|Ga0307471_102974673 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300032180|Ga0307471_103621009 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300032205|Ga0307472_100334042 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
| 3300034176|Ga0364931_0112792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 865 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.94% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.94% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 5.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.86% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.47% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.08% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.08% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.08% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.39% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.39% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.39% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.39% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.39% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.39% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.39% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.39% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.39% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.39% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.39% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.39% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.69% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.69% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.69% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.69% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.69% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.69% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.69% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.69% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.69% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Host-Associated | Open in IMG/M |
| 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Host-Associated | Open in IMG/M |
| 3300004009 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009799 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 | Environmental | Open in IMG/M |
| 3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
| 3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
| 3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012034 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2 | Environmental | Open in IMG/M |
| 3300012035 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012402 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014302 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D2 | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300023067 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S221-509R-5 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025560 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025999 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_201 (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027013 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027277 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027490 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F24TB_116212844 | 3300000550 | Soil | FNSDTLLRKLADRLHRRHGMTVSITTRKRSPSHEIDEAGIRALRSQADLVVSGIGD* |
| JGI1027J12803_1037048891 | 3300000955 | Soil | LLRLADRLGRLHGMTVSRMERKRSPSHEVDEAAIDALRKQSDFVVSGIGD* |
| JGI1027J12803_1088679662 | 3300000955 | Soil | MTVSITNRKRSPSHEIDEAGIRALRSQADLVVSGIGD* |
| JGI24737J22298_102282431 | 3300001990 | Corn Rhizosphere | NTKFNAKPILEKLAERLGRRHQTTVTFRTRKRSASHEVDGDAIKALRAQCDLVISGIGD* |
| JGI26128J50194_10131291 | 3300003347 | Arabidopsis Thaliana Rhizosphere | KLADRLAARXHMTVSVTSRKRSPSHEVDEAGIAALRAQADLVISGIGD* |
| Ga0055437_102216122 | 3300004009 | Natural And Restored Wetlands | RRHGMQVALTSRKRSPSHEIDERAIEALRSQADLVISGIGD* |
| Ga0066396_100996193 | 3300004267 | Tropical Forest Soil | GRRHGMTVARMVRKRSPSHEVDEAAVEALRKQSDFVVSGIGD* |
| Ga0066674_102400591 | 3300005166 | Soil | LLLRLADRLGRRHRMTVAGMVRKRSPSHEVDEAAIASLRKQSDFVVSGIGD* |
| Ga0066673_102575213 | 3300005175 | Soil | TLLHKLAERLGRRHGATVTLTSRKRSPSHEIDEAAVKALRSQADLVISGIGD* |
| Ga0066673_108787452 | 3300005175 | Soil | TLLHKLAERLGRRHGATVTLTSRKRSPSHEIDEAAVKALRRQADLVVSGIGD* |
| Ga0066685_110343623 | 3300005180 | Soil | SDKLLLRLADRLGRRHGMTVSRMVRKRSPSHEVDEAAIGALRKQSDFVVSGIGD* |
| Ga0065715_103352543 | 3300005293 | Miscanthus Rhizosphere | NSDTLLRKLAERLQQRHDTRVTVTRRKRSPSHEIDENDIKTLRSQADLVVSGIGD* |
| Ga0066388_1077340813 | 3300005332 | Tropical Forest Soil | LAARHGMQVTVTNRKRSPSHEIDEAGIKSLRAQADLVISGIGD* |
| Ga0070662_1018089921 | 3300005457 | Corn Rhizosphere | LRKLAERLQQRHDTRVTVTRRKRSPSHEIDENDIKTLRSQADLVVSGIGD* |
| Ga0070706_1006094173 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | ARHHMTVSATNRKRSPSHEIDEAGVAALRAQTDLVISGIGD* |
| Ga0070707_1003113261 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | HHMTVSATNRKRSPSHEIDEAGVAALRAQTDLVISGIGD* |
| Ga0070707_1012317013 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | HQMTVTVRNRKRSASHEVDGDGIKALRAQADLVISGIGD* |
| Ga0066705_108814641 | 3300005569 | Soil | AERLGRRHGATVTLTSRKRSPSHEIDEAAVKALRSQADLVISGIGD* |
| Ga0066691_101303523 | 3300005586 | Soil | LGRRHGATVTLTSRKRSPSHEIDEAAVKALRSQADLVVSGIGD* |
| Ga0068852_1019104263 | 3300005616 | Corn Rhizosphere | KPILEKLAERLGRRHQTTVTFRTRKRSASHEVDGDAIKALRAQCDLVISGIGD* |
| Ga0075421_1025123901 | 3300006845 | Populus Rhizosphere | LHGMTVARMVRKRSPSHEVDEASVEALRKQSDFVVSGIGD* |
| Ga0075430_1011543671 | 3300006846 | Populus Rhizosphere | ALLRKLADRLHRRHGMTVSITNRKRSPSHEIDEAGIRALRSQADLVVSGIGD* |
| Ga0075420_1003269674 | 3300006853 | Populus Rhizosphere | NSDTLLRKLADRLHRRHGMTVSITNRKRSPSHEIDEAGIRALRSQADLVVSGIGD* |
| Ga0075420_1007554441 | 3300006853 | Populus Rhizosphere | AQQLGVRHGMTVAHLDRKRSASHEVAETAIEAFKRRVDFVVSGIGD* |
| Ga0075429_1012929701 | 3300006880 | Populus Rhizosphere | GDRLRDRHGMVVAPMTTKRSPSHEVEEAQIKTLRKQADLVVSGIGD* |
| Ga0079215_104413243 | 3300006894 | Agricultural Soil | FNSEPILQRLAQRLGTRHGMTVAHLDRKRSASHEVAETAIEAFKRRVDFVVSGIGD* |
| Ga0075435_1003715751 | 3300007076 | Populus Rhizosphere | HQMTVTVRNRKRSASHEVDEGGIQALRAQADLVISGIGD* |
| Ga0075435_1005963461 | 3300007076 | Populus Rhizosphere | MTVARMVRKRSPSHEVDEASLEVLRAQADFVVSGIGD* |
| Ga0099829_108587731 | 3300009038 | Vadose Zone Soil | ILEKVAARLAARHGTSVTVRNRKRSPSHEIDEAAVRDLHARTDLVISGIGD* |
| Ga0099827_106099802 | 3300009090 | Vadose Zone Soil | VLLLRLADRLGRRHGMTVARMVRKRSPSREVDEAAIDALRAQSDFVVSGIGD* |
| Ga0066709_1031161661 | 3300009137 | Grasslands Soil | DTLLHKLAERLGRRHGATVTLTSRKRSPSHEIDEAAVKALRGQADLVVSGIGD* |
| Ga0114129_101469455 | 3300009147 | Populus Rhizosphere | NTKFNASPILERLAERLAQRHQMTVTVRNRKRSASHEVDEGGIQALRAQTDLVISGIGD* |
| Ga0114129_133739903 | 3300009147 | Populus Rhizosphere | TVTVTNRKRSPSHEVDGAGIAALRAQSDLVISGIGD* |
| Ga0111538_137214972 | 3300009156 | Populus Rhizosphere | DVLLQRMADRLGRRHGMTVARMVRKRSPSHEVDEVSIEALRAQSDFVVSGIGD* |
| Ga0105075_10436343 | 3300009799 | Groundwater Sand | RLGRRHGMTVACMVRKRSPSHEVDEAAIDALRRQSDFIVSGIGD* |
| Ga0105076_11117263 | 3300009816 | Groundwater Sand | AERLARRHGMTVAVTNRKRSPSHEIDEAAVRALRSQADLVVSGIGD* |
| Ga0105064_10502313 | 3300009821 | Groundwater Sand | LADRLGRRHGMTVARMVRKRSPSHEVDEAAIDALRRQSDFIVSGIGD* |
| Ga0105068_10411694 | 3300009836 | Groundwater Sand | RHGMTVAVTNRKRSPSHEIDEAAIRALRSQADLVVSGIGD* |
| Ga0126382_116884153 | 3300010047 | Tropical Forest Soil | LGKLADRLRRRHGMTVSVTNRKRSPSHEIDEAGIRALRSQADLVVSGIGD* |
| Ga0134088_101177711 | 3300010304 | Grasslands Soil | ARMVRKRSPSHEVDEAAIDALRRQSDFVVSGIGD* |
| Ga0126370_102661631 | 3300010358 | Tropical Forest Soil | TLLRKLAERLAARHGMQVTVTNRKRSPSHEIDEAGIKALRAQADLVISGIGD* |
| Ga0126376_102304264 | 3300010359 | Tropical Forest Soil | LLRRLADRLGQRHGMTVARMVRKRSPSHEVDEAAVEALRAQSDFVVSGIGD* |
| Ga0126376_109477631 | 3300010359 | Tropical Forest Soil | KLADRLRRRHGMTVSVTNRKRSPSHEIDEAGIRALRSQADLVVSGIGD* |
| Ga0126376_111482203 | 3300010359 | Tropical Forest Soil | RHGMQVTVTNRKRSPSHEIDEAGIKALRDQTDLVISGIGD* |
| Ga0126377_102012765 | 3300010362 | Tropical Forest Soil | LLRKLADRLAARHHMTVSVTNRKRSPSHEVDEAGIAALRAQADLVISGIGD* |
| Ga0126379_131573123 | 3300010366 | Tropical Forest Soil | KKLAERLAKRHDMTVTATNRKRSPSHEIDEAGVKALRAQCDLVISGIGD* |
| Ga0137391_108410564 | 3300011270 | Vadose Zone Soil | THMARKRSPSHEVDEAAVAALRAQSDVVIAGIGD* |
| Ga0137453_11320201 | 3300012034 | Soil | MVTVRNRKRSASHEVDGDGIRALRAQADLVISGIGD* |
| Ga0137445_11224641 | 3300012035 | Soil | FNASPILEKLAERLARRHHMTVTVRNRKRSASHEVDGDGIRALRAQADLVISGIGD* |
| Ga0137363_105940983 | 3300012202 | Vadose Zone Soil | FNASPILERLAERLARRHQMTVTVRNRKRSASHEVDGDGIKALRAQADLVISGIGD* |
| Ga0137399_103616743 | 3300012203 | Vadose Zone Soil | RHGATVTVTNRKRSPSHEIDEAGVRALRDAHLVVSGIGD* |
| Ga0137399_116803583 | 3300012203 | Vadose Zone Soil | AERLGRRHGATVTLTSRKRSPSHEIDEAAVKALRSQADLVVSGIGD* |
| Ga0137377_105377321 | 3300012211 | Vadose Zone Soil | PILEKLAERLAQRHQMTVTVRNRKRSASHEVDGDGIKALRAQADLVISGIGD* |
| Ga0137377_114879783 | 3300012211 | Vadose Zone Soil | HGATVTLTSRKRSPSHEIDEAVVKALRSQADLVVSGIGD* |
| Ga0137367_111957123 | 3300012353 | Vadose Zone Soil | DTLLRKLAERLARRHGMTVAVTNRKRSPSHEIDEAAIRALRSQADLVVSGIGD* |
| Ga0137368_102632331 | 3300012358 | Vadose Zone Soil | LRKLAERLARRHGMTVAVTNRKRSPSHEIDEAAIRALRSQADLVVSGIGD* |
| Ga0137385_107692133 | 3300012359 | Vadose Zone Soil | NTKFNASPILEKLAERLAQRHQMTVTVRNRKRSASHEVDGDGIKALRAQADLVISGIGD* |
| Ga0137375_106440441 | 3300012360 | Vadose Zone Soil | HGMTVAVTNRKRSPSHEIDEAAIRALRSRADLVVSGIGD* |
| Ga0137360_109277793 | 3300012361 | Vadose Zone Soil | LRLADRLGRRHGMSVASMARKRSPSHEVDEAAITALRAQSDFVVSGIGD* |
| Ga0134059_10747011 | 3300012402 | Grasslands Soil | LLLRLADRLGRRHRMTVAGMVRKRSPSHEVDEAAIASLREQSDFVVSGIGD* |
| Ga0137404_110578841 | 3300012929 | Vadose Zone Soil | KLAERLGRRHGATVTLISRKRSPSHEIDEAAVKALRSQADLVVSGIGD* |
| Ga0164300_107911651 | 3300012951 | Soil | SPILERLAERLAQRHQMTVTVRNRKRSASHEVDEAGIQALRAQADLVISGIGD* |
| Ga0134087_107567731 | 3300012977 | Grasslands Soil | LAERLARRHGMTVTLTSRKRSPSHEIDEAAVRALRKQADFVVSGIGD* |
| Ga0164304_111752811 | 3300012986 | Soil | AERLSRRHQMTVTFRTRKRSASHEVDGDAIKALRAQCDLVISGIGD* |
| Ga0164305_118936181 | 3300012989 | Soil | HGMTVTRMVRKRSPSHEVDETALEALRAESDFVVSGIGD* |
| Ga0157375_117147763 | 3300013308 | Miscanthus Rhizosphere | FNSDTLLVKLAQRLRQRHGAQVTVTRRKRSPSHEIDENDIKTLRTQADLVVSGIGD* |
| Ga0075310_10224511 | 3300014302 | Natural And Restored Wetlands | RHGTRVTATRRKRSPSHEIDENDIKTLRSQADLVVSGIGD* |
| Ga0182008_101197703 | 3300014497 | Rhizosphere | QTTVTFRTRKRSASHEVDGDAIKALRAQCDLVISGIGD* |
| Ga0132258_124968801 | 3300015371 | Arabidopsis Rhizosphere | RRLADRLGRRHGMTVTRMVRKRSPSHEVDETALETLRAESDFVVSGIGD* |
| Ga0132257_1000768371 | 3300015373 | Arabidopsis Rhizosphere | HRLADRLGRLHGMTVARMVRKRSPSHEVDETSVEALRKQSDFVVSGIGD* |
| Ga0182032_101525203 | 3300016357 | Soil | LHGMTVARMVRKRSPSHEVDEVSIEALRTQADFVVSGIGD |
| Ga0182040_115007113 | 3300016387 | Soil | GMTVSRMARKRSPSHEVDEASLEALRAQSDFVVSGIGD |
| Ga0182038_106943623 | 3300016445 | Soil | LGRRHGMTVSRMARKRSPSHEVDEASLEALRAQSDFVVSGIGD |
| Ga0187786_100577873 | 3300017944 | Tropical Peatland | KLAERLARRHQMTVTVRNRKRSASHEIDEGAIKALRAQVDLVISGIGD |
| Ga0187780_103416061 | 3300017973 | Tropical Peatland | HQMKVSVTNRKRSPSHEVDEAGIRALRAQADLVISGIGD |
| Ga0187822_101132153 | 3300017994 | Freshwater Sediment | EKLAERLAQRHQMRVTVRNRKRSASHEVDGDGIKALRAQADLVISGIGD |
| Ga0184627_102856891 | 3300018079 | Groundwater Sediment | TVTATNRKRSPSHEIDEAGIRALRAQSDLVISGIGD |
| Ga0184646_10173811 | 3300019259 | Groundwater Sediment | LAERLARRHGMTVAVTNRKRSPSHEIDEAAIRALRSQADLVVSGIGD |
| Ga0137408_14629071 | 3300019789 | Vadose Zone Soil | KFNSDTLLQKLAERLGRRHGATVTLTSRKRSPSHEIDEAAVKALRSQADLVVSGIGD |
| Ga0193723_10037301 | 3300019879 | Soil | ERLAQRHHMTVTVRNRKRSASHEVDADGIKALRAQADLVISGIGD |
| Ga0206356_107517161 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | KLAERLGRRHQTTVTFRTRKRSASHEVDGDAIKALRAQCDLVISGIGD |
| Ga0194112_102897983 | 3300020109 | Freshwater Lake | KVNSSAILEKLAERLAARHGTTVTVRNSKRSMSHEIDDAAIAALRGGADVVISGIGD |
| Ga0210404_104832753 | 3300021088 | Soil | LSQRHQMTVTVRNRKRSASHEVDEAGIQALRAQTDLVISGIGD |
| Ga0222622_114691091 | 3300022756 | Groundwater Sediment | GAEVTVTRRKRSPSHEIDENDIKTLRTQADLVVSGIGD |
| Ga0247743_10635351 | 3300023067 | Soil | DTLLRKLADRLAARHHMTVSVTSRKRSPSHEVDEAGIAALRAQADLVISGIGD |
| Ga0209640_113407983 | 3300025324 | Soil | KKLAERLARRHQMTVTATNRKRSPSHEIDEAGIRALRAQSDLVISGIGD |
| Ga0210108_10262811 | 3300025560 | Natural And Restored Wetlands | LLAKLAERLRRRHGMQVALTSRKRSPSHEIDERAVEALRSQADLVISGIGD |
| Ga0207696_10838983 | 3300025711 | Switchgrass Rhizosphere | MTVALTSRKRSPSHEIDEAAVKTLRAQADLVVSGIGD |
| Ga0207650_104028082 | 3300025925 | Switchgrass Rhizosphere | VKLAERLRQRHGAQVTVTRRKRSPSHEIDENDIKTLRTQADLVVSGIGD |
| Ga0207706_102494474 | 3300025933 | Corn Rhizosphere | HMTVSVTSRKRSPSHEVDEAGIAALRAQADLVISGIGD |
| Ga0207706_109298741 | 3300025933 | Corn Rhizosphere | LAERLQQRHDTRVTVTRRKRSPSHEIDENDIKTLRSQADLVVSGIGD |
| Ga0207686_100753851 | 3300025934 | Miscanthus Rhizosphere | KLADRLARRHGMTVALTSRKRSPSHEIDEAAVKTLRAQADLVVSGIGD |
| Ga0207711_113200631 | 3300025941 | Switchgrass Rhizosphere | NTKFNAKPILEKLAERLGRRHQTTVTFRTRKRSASHEVDGDAIKALRAQCDLVISGIGD |
| Ga0207668_109552733 | 3300025972 | Switchgrass Rhizosphere | KLADRLRRRHGMTVSVTNRKRSPSHEIDEAGIRALRSQADLVVSGIGD |
| Ga0208417_1014791 | 3300025999 | Rice Paddy Soil | RKLAERLAKRHRMTVTVTNRKRSPSHEVDEAGIRALRAQSDLVISGIGD |
| Ga0209235_12852431 | 3300026296 | Grasslands Soil | SDTLLRKLAERLARRHGMTVAVTNRKRSPSHEIDEAAIRALRSQADLVVSGIGD |
| Ga0209686_10304651 | 3300026315 | Soil | SDTLLHKLAERLGRRHGATVTLTSRKRSPSHEIDEAAVKALRSQADLVVSGIGD |
| Ga0209470_10439744 | 3300026324 | Soil | RRHGMSVSRMVRKRSPSHEVDEAAIDALRKQSDFIVSGIGD |
| Ga0209375_10614044 | 3300026329 | Soil | LADRLGRRHGMTVSRMVRKRSPSHEVDEAAIGALRKQSDFVVSGIGD |
| Ga0209267_10565384 | 3300026331 | Soil | DTLLTRLAERLARRHGMTVMLTSRKRSPSHEIDEAAVRALRKQADFVVSGIGD |
| Ga0256867_100785831 | 3300026535 | Soil | LAARHQMTVSATNRKRSPSHEIDEAGIRALRAQSDLVISGIGD |
| Ga0209577_1001107615 | 3300026552 | Soil | LARRHGMTVTLTSRKRSPSHEIDEAAVRALRKQADFVVSGIGD |
| Ga0209884_10389461 | 3300027013 | Groundwater Sand | MTVAVTNRKRSPSHEIDEAAIRALRSQADLVVSGIGD |
| Ga0209846_10395983 | 3300027277 | Groundwater Sand | DTLLRKLAERLARRHGMAVAVTNRKRSPSHEIDEAAIRALRSQADLVVSGIGD |
| Ga0209899_11001393 | 3300027490 | Groundwater Sand | KLADRLHRRFGMRVTLLDRKRSPSHEVTEAAVAALRRQADFVVSGIGD |
| Ga0209899_11049391 | 3300027490 | Groundwater Sand | LLRLADRLGRRHGMTVARMVRKRSPSHEVDEAAIDALRRQSDFIVSGIGD |
| Ga0209388_10339181 | 3300027655 | Vadose Zone Soil | LRLAERLGRRHGMTVSRMVRKRSPSHEVDEAAINALRKQSDFVVSGIGD |
| Ga0209971_100008532 | 3300027682 | Arabidopsis Thaliana Rhizosphere | NSDTLLRKLADRLAARHHMTVSVTSRKRSPSHEVDEAGIAALRAQADLVISGIGD |
| Ga0209074_104948111 | 3300027787 | Agricultural Soil | NTKFNARPILEKLAERLGRRHQMTVTVRTRKRSASHEVDGDAIKALRAQCDLVISGVGD |
| Ga0209811_100824995 | 3300027821 | Surface Soil | TRVTLTRRKRSPSHEIDENDIKTLRSQADLVVSGIGD |
| Ga0209590_103834683 | 3300027882 | Vadose Zone Soil | VLLLRLADRLGRRHGMTVARMVRKRSPSREVDEAAIDALRAQSDFVVSGIGD |
| Ga0247823_113793211 | 3300028590 | Soil | RRHQTTVTFRTRKRSASHEVDGDAIKALRAQCDLVISGIGD |
| Ga0247825_106727411 | 3300028812 | Soil | YGVSMTHMARKRSPSHEVDDAALATLKAQSDVVVSGIGD |
| Ga0247827_100119051 | 3300028889 | Soil | LLRKLADRLHRRHGMTVSITNRKRSPSHEIDEAGIRALRSQADLVVSGIGD |
| Ga0247826_116650361 | 3300030336 | Soil | DTLLGKLAERLRARHGTTVALTSRKRSPSHEIDEAAVHALRRQADLVISGIGD |
| Ga0307498_101473903 | 3300031170 | Soil | GMTVSRMVRKRSPSHEVDEAAIDALRKQSDFVVSGIGD |
| (restricted) Ga0255310_101910563 | 3300031197 | Sandy Soil | ERLARRHQMTVTVRTRKRSASHEVDEAGIKALRAQADLVISGIGD |
| Ga0307497_100337874 | 3300031226 | Soil | HGMTVSVTNRKRSPSHEIDEAGIRALRSQADLVVSGIGD |
| Ga0299914_106182591 | 3300031228 | Soil | RVLLQKLAERLDRRHRMTVAHVDRKRSPSHEVTELAVAALRRQADFVVSGIGD |
| Ga0307408_1001226695 | 3300031548 | Rhizosphere | ADRLARRHGVTVTVTNRKRSPSHEIDEAGIRALRAQADLVVSGIGD |
| Ga0306917_101563781 | 3300031719 | Soil | WLGRLHGMTVARMVRKRSPSHEVDEVSIEALRTQADFVVSGIGD |
| Ga0307469_102980103 | 3300031720 | Hardwood Forest Soil | LLRLGDRLARRYGMTVARMVRKRSPSHEVDEAAIEALRKQSDFVVSGIGD |
| Ga0307468_1006700393 | 3300031740 | Hardwood Forest Soil | MRVTLTSRKRSPSHEIDEGAVKTLRAQADLVVSGIGD |
| Ga0318492_107630651 | 3300031748 | Soil | LLKRLADRLGRRHGMTVSRMARKRSPSHEVDEASVEALRAQSDFVVSGIGD |
| Ga0318535_104913531 | 3300031764 | Soil | HGMTVARMVRKRSPSHEVDEVSIEALRTQADFVVSGIGD |
| Ga0318548_101384083 | 3300031793 | Soil | LRRLADRLGRLHGMTVARMVRKRSPSHEVDEVSIEALRTQADFVVSGIGD |
| Ga0318557_100424525 | 3300031795 | Soil | HGMQVTVTNRKRSPSHEIDEARIKALRAQADLVISGIGD |
| Ga0318517_102253844 | 3300031835 | Soil | MQVTVTNRKRSPSHEIDEAGIKALRAQADLVISGIGD |
| Ga0310904_100498073 | 3300031854 | Soil | MTVTRMVRKRSPSHEVDETALETLRAESDFVVSGIGD |
| Ga0306925_120212533 | 3300031890 | Soil | SDVLLRRLADRLGRLHGMTVARMVRKRSPSHEVDEVSIEALRTQADFVVSGIGD |
| Ga0318522_102588391 | 3300031894 | Soil | FNSDTLLRKLAERLTARHGMQVTVTNRKRSPSHEIDEAGIKALRAQADLVISGIGD |
| Ga0318520_104131801 | 3300031897 | Soil | TVSRMARKRSPSHEVDEASVEALRAQSDFVVSGIGD |
| Ga0310891_102073291 | 3300031913 | Soil | LADRLHRRHGMTVSITNRKRSPSHEIDEAGIRALRSQADLVVSGIGD |
| Ga0310885_106422861 | 3300031943 | Soil | MTHMARKRSPSHEVDDAALATLKAQSDVVVSGIGD |
| Ga0307414_112773221 | 3300032004 | Rhizosphere | RHGVRVTVTRRKRSPSHEIDENDIKTLRSQADLVVSGIGD |
| Ga0318575_100133591 | 3300032055 | Soil | ARHGMQVTVTNRKRSPSHEIDEARIKALRAQADLVISGIGD |
| Ga0318514_102927774 | 3300032066 | Soil | LTARHGMQVTVTNRKRSPSHEIDEARIKALRAQADLVISGIGD |
| Ga0318524_103192401 | 3300032067 | Soil | KFNSDTLLRKLAERLTARHGMQVTVTNRKRSPSHEIDEAGIKALRAQADLVISGIGD |
| Ga0307471_1000707341 | 3300032180 | Hardwood Forest Soil | KFNSDTLLNKLAARLVARHHMTVSATNRKRSPSHEIDEAGVAALRAQTDLVISGIGD |
| Ga0307471_1001092871 | 3300032180 | Hardwood Forest Soil | SDKLLLRLADRLGRRHGMTVSRMVRKRSPSHEVDEAAIDALRKQSDFVVSGIGD |
| Ga0307471_1029746731 | 3300032180 | Hardwood Forest Soil | HGMTVSRMVRKRSPSHEVDEAAIEALRKQSDFVVSGIGD |
| Ga0307471_1036210093 | 3300032180 | Hardwood Forest Soil | KLAERLGRRHGATVTLTSRKRSPSHEIDEAAVKALRSQADLVVSGIGD |
| Ga0307472_1003340421 | 3300032205 | Hardwood Forest Soil | LQRMADRLGRRHGMTVSRMVRKRSPSHEVDEASVEALRAQSDFVVSGIGD |
| Ga0364931_0112792_696_863 | 3300034176 | Sediment | NSDTLLVKLAERLNRRHGTRVTITRRKRSPSHEIDEGAIKALRSQADLVVSGIGD |
| ⦗Top⦘ |