


| Basic Information | |
|---|---|
| Family ID | F050750 |
| Family Type | Metagenome |
| Number of Sequences | 145 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MCCQADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKRGK |
| Number of Associated Samples | 114 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.70 % |
| % of genes near scaffold ends (potentially truncated) | 96.55 % |
| % of genes from short scaffolds (< 2000 bps) | 94.48 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (67.586 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (28.276 % of family members) |
| Environment Ontology (ENVO) | Unclassified (80.690 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (90.345 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.81% β-sheet: 0.00% Coil/Unstructured: 61.19% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF03592 | Terminase_2 | 1.38 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.69 |
| PF13578 | Methyltransf_24 | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG3728 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 1.38 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 67.59 % |
| All Organisms | root | All Organisms | 32.41 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2236876001|none_p322928 | Not Available | 503 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10116736 | Not Available | 971 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10122233 | Not Available | 937 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10221830 | Not Available | 568 | Open in IMG/M |
| 3300001450|JGI24006J15134_10032662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 2267 | Open in IMG/M |
| 3300001450|JGI24006J15134_10084743 | All Organisms → Viruses → Predicted Viral | 1176 | Open in IMG/M |
| 3300001450|JGI24006J15134_10213027 | Not Available | 580 | Open in IMG/M |
| 3300001450|JGI24006J15134_10244395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 519 | Open in IMG/M |
| 3300001460|JGI24003J15210_10084615 | Not Available | 949 | Open in IMG/M |
| 3300001589|JGI24005J15628_10213486 | Not Available | 532 | Open in IMG/M |
| 3300005424|Ga0066826_10307379 | All Organisms → Viruses → environmental samples → uncultured virus | 529 | Open in IMG/M |
| 3300006026|Ga0075478_10256132 | Not Available | 523 | Open in IMG/M |
| 3300006027|Ga0075462_10255515 | Not Available | 518 | Open in IMG/M |
| 3300006735|Ga0098038_1176374 | Not Available | 701 | Open in IMG/M |
| 3300006735|Ga0098038_1276485 | All Organisms → Viruses | 525 | Open in IMG/M |
| 3300006735|Ga0098038_1297615 | All Organisms → Viruses | 501 | Open in IMG/M |
| 3300006737|Ga0098037_1224286 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 609 | Open in IMG/M |
| 3300006737|Ga0098037_1246921 | Not Available | 573 | Open in IMG/M |
| 3300006749|Ga0098042_1015555 | Not Available | 2303 | Open in IMG/M |
| 3300006752|Ga0098048_1196037 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 596 | Open in IMG/M |
| 3300006753|Ga0098039_1138335 | All Organisms → Viruses | 834 | Open in IMG/M |
| 3300006802|Ga0070749_10611819 | Not Available | 587 | Open in IMG/M |
| 3300006923|Ga0098053_1006571 | All Organisms → cellular organisms → Bacteria | 2797 | Open in IMG/M |
| 3300006925|Ga0098050_1129741 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 639 | Open in IMG/M |
| 3300007229|Ga0075468_10200586 | Not Available | 582 | Open in IMG/M |
| 3300007236|Ga0075463_10105323 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 910 | Open in IMG/M |
| 3300007344|Ga0070745_1248250 | Not Available | 644 | Open in IMG/M |
| 3300007538|Ga0099851_1328815 | Not Available | 536 | Open in IMG/M |
| 3300009027|Ga0102957_1172392 | Not Available | 771 | Open in IMG/M |
| 3300009074|Ga0115549_1054550 | Not Available | 1413 | Open in IMG/M |
| 3300009428|Ga0114915_1028688 | All Organisms → cellular organisms → Bacteria | 1920 | Open in IMG/M |
| 3300009435|Ga0115546_1165778 | Not Available | 774 | Open in IMG/M |
| 3300009440|Ga0115561_1190118 | Not Available | 786 | Open in IMG/M |
| 3300009476|Ga0115555_1447881 | Not Available | 512 | Open in IMG/M |
| 3300009507|Ga0115572_10554920 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300009508|Ga0115567_10207646 | Not Available | 1264 | Open in IMG/M |
| 3300009508|Ga0115567_10462909 | Not Available | 775 | Open in IMG/M |
| 3300009605|Ga0114906_1267287 | Not Available | 552 | Open in IMG/M |
| 3300009790|Ga0115012_10839775 | Not Available | 747 | Open in IMG/M |
| 3300010148|Ga0098043_1151464 | Not Available | 656 | Open in IMG/M |
| 3300010150|Ga0098056_1330081 | Not Available | 501 | Open in IMG/M |
| 3300010296|Ga0129348_1075468 | Not Available | 1200 | Open in IMG/M |
| 3300010300|Ga0129351_1202648 | Not Available | 770 | Open in IMG/M |
| 3300010368|Ga0129324_10332765 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 593 | Open in IMG/M |
| 3300010368|Ga0129324_10398319 | Not Available | 532 | Open in IMG/M |
| 3300010392|Ga0118731_106952528 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 550 | Open in IMG/M |
| 3300013010|Ga0129327_10891483 | Not Available | 510 | Open in IMG/M |
| 3300017708|Ga0181369_1125140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 519 | Open in IMG/M |
| 3300017713|Ga0181391_1091336 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 691 | Open in IMG/M |
| 3300017724|Ga0181388_1092900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 718 | Open in IMG/M |
| 3300017725|Ga0181398_1074556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 814 | Open in IMG/M |
| 3300017728|Ga0181419_1137375 | Not Available | 590 | Open in IMG/M |
| 3300017734|Ga0187222_1054461 | Not Available | 929 | Open in IMG/M |
| 3300017738|Ga0181428_1158811 | Not Available | 528 | Open in IMG/M |
| 3300017740|Ga0181418_1106215 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 680 | Open in IMG/M |
| 3300017740|Ga0181418_1106744 | Not Available | 678 | Open in IMG/M |
| 3300017741|Ga0181421_1051256 | All Organisms → Viruses → Predicted Viral | 1098 | Open in IMG/M |
| 3300017741|Ga0181421_1192091 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 523 | Open in IMG/M |
| 3300017748|Ga0181393_1087507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 812 | Open in IMG/M |
| 3300017748|Ga0181393_1129832 | Not Available | 636 | Open in IMG/M |
| 3300017749|Ga0181392_1101019 | Not Available | 861 | Open in IMG/M |
| 3300017750|Ga0181405_1123565 | All Organisms → Viruses | 645 | Open in IMG/M |
| 3300017751|Ga0187219_1119837 | Not Available | 781 | Open in IMG/M |
| 3300017753|Ga0181407_1021400 | Not Available | 1780 | Open in IMG/M |
| 3300017753|Ga0181407_1140923 | Not Available | 597 | Open in IMG/M |
| 3300017755|Ga0181411_1065635 | Not Available | 1102 | Open in IMG/M |
| 3300017755|Ga0181411_1101849 | Not Available | 848 | Open in IMG/M |
| 3300017757|Ga0181420_1108623 | Not Available | 849 | Open in IMG/M |
| 3300017758|Ga0181409_1104498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 843 | Open in IMG/M |
| 3300017759|Ga0181414_1084406 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 839 | Open in IMG/M |
| 3300017759|Ga0181414_1090325 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 808 | Open in IMG/M |
| 3300017759|Ga0181414_1102491 | Not Available | 753 | Open in IMG/M |
| 3300017763|Ga0181410_1155901 | Not Available | 640 | Open in IMG/M |
| 3300017767|Ga0181406_1086680 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 952 | Open in IMG/M |
| 3300017767|Ga0181406_1139874 | Not Available | 727 | Open in IMG/M |
| 3300017772|Ga0181430_1055480 | Not Available | 1223 | Open in IMG/M |
| 3300017772|Ga0181430_1139102 | Not Available | 708 | Open in IMG/M |
| 3300017772|Ga0181430_1149635 | Not Available | 678 | Open in IMG/M |
| 3300017773|Ga0181386_1200019 | Not Available | 600 | Open in IMG/M |
| 3300017773|Ga0181386_1267934 | Not Available | 503 | Open in IMG/M |
| 3300017782|Ga0181380_1131383 | Not Available | 859 | Open in IMG/M |
| 3300017783|Ga0181379_1200376 | Not Available | 699 | Open in IMG/M |
| 3300017786|Ga0181424_10045108 | Not Available | 1911 | Open in IMG/M |
| 3300017824|Ga0181552_10241817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 912 | Open in IMG/M |
| 3300017969|Ga0181585_10911625 | Not Available | 564 | Open in IMG/M |
| 3300017989|Ga0180432_11072911 | Not Available | 545 | Open in IMG/M |
| 3300018420|Ga0181563_10140713 | All Organisms → Viruses → Predicted Viral | 1529 | Open in IMG/M |
| 3300018423|Ga0181593_10658383 | Not Available | 747 | Open in IMG/M |
| 3300019721|Ga0194011_1018309 | Not Available | 732 | Open in IMG/M |
| 3300019751|Ga0194029_1036569 | Not Available | 787 | Open in IMG/M |
| 3300020601|Ga0181557_1059563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 2061 | Open in IMG/M |
| 3300021373|Ga0213865_10373828 | Not Available | 640 | Open in IMG/M |
| 3300021959|Ga0222716_10426098 | Not Available | 764 | Open in IMG/M |
| 3300021964|Ga0222719_10321318 | Not Available | 994 | Open in IMG/M |
| 3300022061|Ga0212023_1060539 | Not Available | 525 | Open in IMG/M |
| 3300022074|Ga0224906_1056074 | Not Available | 1249 | Open in IMG/M |
| 3300022074|Ga0224906_1101868 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 847 | Open in IMG/M |
| 3300022168|Ga0212027_1025700 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 790 | Open in IMG/M |
| 3300022183|Ga0196891_1064433 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 656 | Open in IMG/M |
| 3300022200|Ga0196901_1118951 | Not Available | 905 | Open in IMG/M |
| 3300022201|Ga0224503_10296760 | All Organisms → Viruses | 536 | Open in IMG/M |
| 3300022905|Ga0255756_1102590 | Not Available | 1287 | Open in IMG/M |
| 3300022907|Ga0255775_1078359 | Not Available | 1518 | Open in IMG/M |
| 3300023084|Ga0255778_10379621 | Not Available | 618 | Open in IMG/M |
| 3300023178|Ga0255759_10712870 | All Organisms → Viruses | 552 | Open in IMG/M |
| 3300024433|Ga0209986_10302875 | Not Available | 756 | Open in IMG/M |
| 3300024433|Ga0209986_10401373 | Not Available | 625 | Open in IMG/M |
| 3300025070|Ga0208667_1044914 | Not Available | 733 | Open in IMG/M |
| 3300025098|Ga0208434_1066438 | Not Available | 757 | Open in IMG/M |
| 3300025098|Ga0208434_1069881 | Not Available | 731 | Open in IMG/M |
| 3300025102|Ga0208666_1047683 | Not Available | 1212 | Open in IMG/M |
| 3300025110|Ga0208158_1041583 | All Organisms → Viruses → Predicted Viral | 1148 | Open in IMG/M |
| 3300025110|Ga0208158_1152093 | Not Available | 525 | Open in IMG/M |
| 3300025120|Ga0209535_1082084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 1219 | Open in IMG/M |
| 3300025120|Ga0209535_1151129 | Not Available | 732 | Open in IMG/M |
| 3300025127|Ga0209348_1145250 | Not Available | 700 | Open in IMG/M |
| 3300025128|Ga0208919_1004347 | Not Available | 6634 | Open in IMG/M |
| 3300025128|Ga0208919_1061432 | Not Available | 1266 | Open in IMG/M |
| 3300025133|Ga0208299_1114807 | Not Available | 890 | Open in IMG/M |
| 3300025137|Ga0209336_10088225 | Not Available | 894 | Open in IMG/M |
| 3300025138|Ga0209634_1268856 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 606 | Open in IMG/M |
| 3300025151|Ga0209645_1083716 | Not Available | 1057 | Open in IMG/M |
| 3300025151|Ga0209645_1158762 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 692 | Open in IMG/M |
| 3300025151|Ga0209645_1188339 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 616 | Open in IMG/M |
| 3300025168|Ga0209337_1039894 | Not Available | 2522 | Open in IMG/M |
| 3300025168|Ga0209337_1217358 | Not Available | 761 | Open in IMG/M |
| 3300025590|Ga0209195_1109075 | Not Available | 603 | Open in IMG/M |
| 3300025646|Ga0208161_1145966 | Not Available | 596 | Open in IMG/M |
| 3300025671|Ga0208898_1072318 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 1142 | Open in IMG/M |
| 3300025674|Ga0208162_1101204 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 857 | Open in IMG/M |
| 3300025685|Ga0209095_1174784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 609 | Open in IMG/M |
| 3300025830|Ga0209832_1157209 | Not Available | 665 | Open in IMG/M |
| 3300025849|Ga0209603_1058234 | Not Available | 1965 | Open in IMG/M |
| 3300025873|Ga0209757_10293529 | Not Available | 517 | Open in IMG/M |
| 3300025890|Ga0209631_10429669 | Not Available | 606 | Open in IMG/M |
| 3300028600|Ga0265303_10593338 | Not Available | 898 | Open in IMG/M |
| 3300028600|Ga0265303_10998384 | All Organisms → Viruses | 693 | Open in IMG/M |
| 3300031774|Ga0315331_11071978 | Not Available | 544 | Open in IMG/M |
| 3300032136|Ga0316201_11011646 | Not Available | 699 | Open in IMG/M |
| 3300032277|Ga0316202_10633921 | Not Available | 504 | Open in IMG/M |
| 3300033742|Ga0314858_070084 | Not Available | 871 | Open in IMG/M |
| 3300033742|Ga0314858_112744 | Not Available | 693 | Open in IMG/M |
| 3300034374|Ga0348335_165479 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 583 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 28.28% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 25.52% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 11.03% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 7.59% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 6.21% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.45% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.07% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 1.38% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.38% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 1.38% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.38% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 1.38% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.38% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.69% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.69% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.69% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.69% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 0.69% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.69% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.69% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine | 0.69% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.69% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.69% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2236876001 | Marine microbial communities from Columbia River, CM, sample from CR-7km from mouth, GS312-0p1-CR7-chlmax | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300005424 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV49 | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006923 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009440 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 | Environmental | Open in IMG/M |
| 3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017734 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2) | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017989 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_2 metaG | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018423 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019721 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_7-8_MG | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300020601 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011506CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022168 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022201 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022905 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG | Environmental | Open in IMG/M |
| 3300022907 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG | Environmental | Open in IMG/M |
| 3300023084 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG | Environmental | Open in IMG/M |
| 3300023178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG | Environmental | Open in IMG/M |
| 3300024433 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025590 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025685 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 (SPAdes) | Environmental | Open in IMG/M |
| 3300025830 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025873 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300026183 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300028600 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
| 3300032136 | Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| none_3229282 | 2236876001 | Marine Estuarine | MCVKQDEDTPNEYRTEHFRSTMDDAYEYLKKIGYFKRGK |
| DelMOSpr2010_101167364 | 3300000116 | Marine | QADEDTPSEYRTEHFRSTMDDAYEYLEKINYFKRGK* |
| DelMOSpr2010_101222333 | 3300000116 | Marine | QADEDCPAEYRTEHFRSTMDDAYDYLKEIGYFKNE* |
| DelMOWin2010_102218301 | 3300000117 | Marine | CCQADEDCPAEYRTEHFRSTMDDAYDYLREIGYLK* |
| JGI24006J15134_100326621 | 3300001450 | Marine | MCCQADEDCPAEYRTEHFRSTMDDAYEYLEKIGYYKK* |
| JGI24006J15134_100847435 | 3300001450 | Marine | MCCQADEDTPSEYRTEHFRSTMDDAYEYLEKINYFKRDK* |
| JGI24006J15134_102130271 | 3300001450 | Marine | ADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKKG* |
| JGI24006J15134_102443953 | 3300001450 | Marine | ADHLASMCCQADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKK* |
| JGI24003J15210_100846151 | 3300001460 | Marine | LSDHLAGMCCQADEDTPSEYRTEHFRSTMDDAYEYLEKINYFKRSK* |
| JGI24005J15628_102134863 | 3300001589 | Marine | QNTTLADHLASMCCQADEDTPSEHRTKHFRSTMNDAYEYLEKINYFKRDK* |
| Ga0066826_103073791 | 3300005424 | Marine | LAAMCCQADEDCPSEYRTKHFRSTMDDAYDYLKEIGYLK* |
| Ga0075478_102561322 | 3300006026 | Aqueous | CCQADEDCPAEYRTEHFRSTMDDAYNYLKEIGYFKNE* |
| Ga0075462_102555151 | 3300006027 | Aqueous | GMCCQADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKRGK* |
| Ga0098038_11763741 | 3300006735 | Marine | SMCCQADEDTPSEYRTEHFRSTMDDAYEYLEKINYFKRDK*KI* |
| Ga0098038_12764851 | 3300006735 | Marine | MCCQADEDCPAEYRTEHFRSTMDDAYDYLKEIGYLK* |
| Ga0098038_12976151 | 3300006735 | Marine | TNMCCQADEDCPAEYRTRHFRNTMDAAYDYLKEIGYLK* |
| Ga0098037_12242864 | 3300006737 | Marine | CCQADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKRDK* |
| Ga0098037_12469214 | 3300006737 | Marine | TLLADHLASMCCQADEDTPGEYRTEHFRSTMDDAYEYLEKIGYFKRGK*KNIK* |
| Ga0098042_10155551 | 3300006749 | Marine | TQLADHLTNMCCQADEDCPAEYRTRHFRNTMDAAYDYLKEIGYLK* |
| Ga0098048_11960371 | 3300006752 | Marine | ASMCCQADEDCPAEYRTEHFRSTMDDAYDYLKEIGYFKNE* |
| Ga0098039_11383351 | 3300006753 | Marine | MCCQADEDCPSEYRTKHFRSTMDDAYDYLKEIGYLK* |
| Ga0070749_106118194 | 3300006802 | Aqueous | CCQADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKRGK* |
| Ga0098053_10065719 | 3300006923 | Marine | CQADEDCPAEYRTEHFRSTMDDAYEYLEKIGYFKK* |
| Ga0098050_11297411 | 3300006925 | Marine | CCQADEDTPSEYRTEHFRSTMDDAYEYLEKINYFKRDK* |
| Ga0075468_102005861 | 3300007229 | Aqueous | CQADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKRGK* |
| Ga0075463_101053231 | 3300007236 | Aqueous | CQADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKRDK* |
| Ga0070745_12482502 | 3300007344 | Aqueous | MCCQADEDCPAEYRTEHFRSTMDDAYDYLKKIGYFKNE* |
| Ga0099851_13288151 | 3300007538 | Aqueous | DEDTPAEYRTKHFRDAMNEAYEYLEEIGYLKGDK* |
| Ga0102957_11723921 | 3300009027 | Pond Water | ADEDTPAEYRTKHFRDAMNDAYKYLEEIGYLEGDK* |
| Ga0115549_10545501 | 3300009074 | Pelagic Marine | AAMCCQADEDCPAEYRTEHFRSTMDDAYDYLKEIGYLK* |
| Ga0114915_10286881 | 3300009428 | Deep Ocean | LSDHLASMCCQADEDTPSEHRTEHFRSTMDDAYEYLEKINYFKKG* |
| Ga0115546_11657783 | 3300009435 | Pelagic Marine | CQADEDCPAEYRTEHFRSTMDDAYDYLKEIGYLK* |
| Ga0115561_11901182 | 3300009440 | Pelagic Marine | AAMCCQADEDCPSEYRTEHFRSTMDDAYDYLKEIGYLK* |
| Ga0115555_14478811 | 3300009476 | Pelagic Marine | TLSHHLANMCCQADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKRGK* |
| Ga0115572_105549202 | 3300009507 | Pelagic Marine | CQADEDTPSEYRTEHFRSTMDDAYEYLEKIEYFKKG* |
| Ga0115567_102076464 | 3300009508 | Pelagic Marine | CCQADEDCPAEYRTEHFRSTMDDAYDYLKEIGYLK* |
| Ga0115567_104629094 | 3300009508 | Pelagic Marine | CQADEDTPSEYRTEHFRSTMDDAYEYLEKINYFKRGK* |
| Ga0114906_12672871 | 3300009605 | Deep Ocean | MCSQADEDCPAEYRTEHFRSTMDDAYDYLKKIGYLNE* |
| Ga0115012_108397751 | 3300009790 | Marine | DHLASMCCQADEDCPAEYRTRHFRNTMDGAYDYLKEIGYLK* |
| Ga0098043_11514644 | 3300010148 | Marine | LASMCCQADEDTPSEYRTEHFRSTMDDAYEYLEKINYFKRDK* |
| Ga0098056_13300812 | 3300010150 | Marine | LAAMCCQADEDCPSEYRTKHFRSTMDDAYDYLKEIGWLK* |
| Ga0129348_10754681 | 3300010296 | Freshwater To Marine Saline Gradient | TPSEYRTRHFRDAMNEAYEYLEEIGYFKKEGDKND* |
| Ga0129351_12026481 | 3300010300 | Freshwater To Marine Saline Gradient | DHLAGMCCQAAEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKK* |
| Ga0129324_103327651 | 3300010368 | Freshwater To Marine Saline Gradient | DHLAGMCCQADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKRDK* |
| Ga0129324_103983191 | 3300010368 | Freshwater To Marine Saline Gradient | ADEDTPSEYRTRHFRDAMNEAYEYLEEIGYLKKEEK* |
| Ga0118731_1069525281 | 3300010392 | Marine | LAAMCCQADEDCPSEYRTEHFRSTMDDAYDYLKKIGYFKNE* |
| Ga0129327_108914831 | 3300013010 | Freshwater To Marine Saline Gradient | CQADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKK* |
| Ga0181369_11251403 | 3300017708 | Marine | CCQADEDTPSEYRTEHFRSTMDDAYEYLEKINYFKRSK |
| Ga0181391_10913361 | 3300017713 | Seawater | HLANMCCQADEDTPSEYRTEHFRSTMDDAYEYLEKINYFKKG |
| Ga0181388_10929001 | 3300017724 | Seawater | DEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKRGKXKNIK |
| Ga0181398_10745564 | 3300017725 | Seawater | HLANMCCQADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKRGK |
| Ga0181419_11373751 | 3300017728 | Seawater | TLSDHLAGMCCQADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKRGK |
| Ga0187222_10544611 | 3300017734 | Seawater | DTPSEYRTEHFRSTMDDAYEYLEKINYFKRGKXKI |
| Ga0181428_11588111 | 3300017738 | Seawater | CQADEDTPSEYRTEHFRSTMDDAYEYLRKINYFKK |
| Ga0181418_11062151 | 3300017740 | Seawater | AMCCQADEDCPAEYRTEHFRSTMDDAYDYLKEIGYLK |
| Ga0181418_11067443 | 3300017740 | Seawater | CQADEDTPSEYRTEHFRSTMDDAYEYLEKINYFKRDK |
| Ga0181421_10512561 | 3300017741 | Seawater | KTLSDHLAGMCCQADEDTPSEYRTEHFRSTMDDAYEYLEKINYFKRGK |
| Ga0181421_11920911 | 3300017741 | Seawater | SMCSQADEDCPAEYRTEHFRSTMDDAYDYLKEIGYLK |
| Ga0181393_10875074 | 3300017748 | Seawater | CCQADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKRGKXKII |
| Ga0181393_11298321 | 3300017748 | Seawater | DHLAGMCCQADEDTPSEYRTEHFRSTMDDAYEYLEKINYFKRDK |
| Ga0181392_11010194 | 3300017749 | Seawater | ANMCCQADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKRGK |
| Ga0181405_11235654 | 3300017750 | Seawater | LASMCSQADEDCPAEYRTEHFRSTMDDAYDYLKEIGYLK |
| Ga0187219_11198372 | 3300017751 | Seawater | CCQADEDTPSEYRTKHFRSTMDDAYKYLEKIGYFKKG |
| Ga0181407_10214001 | 3300017753 | Seawater | QADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKRGK |
| Ga0181407_11409231 | 3300017753 | Seawater | TLSNHLAGMCCQADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKRGK |
| Ga0181411_10656351 | 3300017755 | Seawater | TLSNHLAGMCCQADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKRGKXKI |
| Ga0181411_11018494 | 3300017755 | Seawater | CQADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKRGK |
| Ga0181420_11086234 | 3300017757 | Seawater | AGMCCQADEDTPSEYRTEHFRSTMDDAYEYLRKINYFKK |
| Ga0181409_11044981 | 3300017758 | Seawater | MCCQADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKRGK |
| Ga0181414_10844061 | 3300017759 | Seawater | HLANMCCQADEDTPSEYRTEHFRSTMDDAYEYLRKINYFKK |
| Ga0181414_10903251 | 3300017759 | Seawater | NKVKTLSDHLAGMCCQADEDTPSEYRTEHFRSTMDDAYEYLEKINYFKRGK |
| Ga0181414_11024911 | 3300017759 | Seawater | MCCQADEDTPSEYRTEHFRSTMDDAYEYLEKINYFKRDK |
| Ga0181410_11559013 | 3300017763 | Seawater | ADYLASMCCQADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKRGK |
| Ga0181406_10866801 | 3300017767 | Seawater | HLAGMCCQADEDTPSEYRTEHFRSTMDDAYEYLRKINYFKK |
| Ga0181406_11398741 | 3300017767 | Seawater | AGMCCQADEDTPSEYRTEHFRSTMDDAYEYLEKINYFKRGK |
| Ga0181430_10554801 | 3300017772 | Seawater | VKTLSDHLAGMCCQADEDTPSEYRTEHFRSTMDDAYEYLEKINYFKRGK |
| Ga0181430_11391023 | 3300017772 | Seawater | QADEDTPSEYRTEHFRSTMDDAYEYLEKINYFKRGKXK |
| Ga0181430_11496351 | 3300017772 | Seawater | QADEDTPSEYRTEHFRSTMDDAYEYLEKINYFKRGK |
| Ga0181386_12000191 | 3300017773 | Seawater | ANMCCQADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKKG |
| Ga0181386_12679341 | 3300017773 | Seawater | LLADHLASMCCQADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKRGK |
| Ga0181380_11313831 | 3300017782 | Seawater | NHLAGMCCQADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKRGKXKNIK |
| Ga0181379_12003761 | 3300017783 | Seawater | DEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKRGKXKI |
| Ga0181424_100451081 | 3300017786 | Seawater | MCCQADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKKG |
| Ga0181552_102418175 | 3300017824 | Salt Marsh | CCQADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKRGK |
| Ga0181585_109116251 | 3300017969 | Salt Marsh | MCCQADEDCPAEYRTEHFRSTMNDAYDYLKEIGYLK |
| Ga0180432_110729111 | 3300017989 | Hypersaline Lake Sediment | ADEDTPAEYRTKHFRSTMDESYEYLEEIGYLKGDK |
| Ga0181563_101407131 | 3300018420 | Salt Marsh | LSEQNTLLADHLANMCCQADEDTPSQYRTEHFRSTMDDAYEYLEKINYFKRDE |
| Ga0181593_106583832 | 3300018423 | Salt Marsh | NMCAQADEDCPAEYRTRHFRSTMDDAYDYLKKIGYLK |
| Ga0194011_10183092 | 3300019721 | Sediment | MCCQADEDCPAEYRTEHFRSTMDDAYDYLKEIGYLK |
| Ga0194029_10365694 | 3300019751 | Freshwater | GMCCQADEDTPSEYRTKHFRSTMDDAYEYLEKIGYFKRDK |
| Ga0181557_10595631 | 3300020601 | Salt Marsh | ADHLASMCCQADEDCPAEYRTEHFRSTMDDAYDYLKKIGYLK |
| Ga0213865_103738283 | 3300021373 | Seawater | LASMCCQADEDCPAEYRTEHFRSTMDDAYDYLKKIGYLK |
| Ga0222716_104260982 | 3300021959 | Estuarine Water | ANMCCQADEDCPAEYRTRHFRSTMDDAYDYLKEIGYLK |
| Ga0222719_103213181 | 3300021964 | Estuarine Water | DHLAGMCCQADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKRDK |
| Ga0212023_10605391 | 3300022061 | Aqueous | LAAMCCQADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKKG |
| Ga0224906_10560745 | 3300022074 | Seawater | NMCCQADEDTPSEYRTEHFRSTMDDAYEYLEKINYFKRGK |
| Ga0224906_11018681 | 3300022074 | Seawater | LASMCCQADEDCPAEYRTEHFRSTMDDAYDYLKEIGYLK |
| Ga0212027_10257004 | 3300022168 | Aqueous | LSDHLANMCCQADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKRGK |
| Ga0196891_10644333 | 3300022183 | Aqueous | NEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKRDKXKNKNG |
| Ga0196901_11189511 | 3300022200 | Aqueous | LAAMCCQADEDCPAEYRTEHFRSTMDDAYDYLKEIGYLKNE |
| Ga0224503_102967601 | 3300022201 | Sediment | HLANMCAQADEDCPAEYRTRHFRSTMDDAYDYLKEIGYLK |
| Ga0255756_11025904 | 3300022905 | Salt Marsh | DHLASMCCQADEDCPAEYRTEHFRSTMDDAYDYLKKIGYLK |
| Ga0255775_10783593 | 3300022907 | Salt Marsh | MCCQADEDCPAEYRTEHFRSTMDDAYDYLKKIGYLK |
| Ga0255778_103796213 | 3300023084 | Salt Marsh | ADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKRGK |
| Ga0255759_107128701 | 3300023178 | Salt Marsh | AAMCCQADEDCPAEYRTEHFRSTMDDAYDYLKEIGYLNEN |
| Ga0209986_103028751 | 3300024433 | Deep Subsurface | MCAQADEDCPAEYRTRHFRSTMDDAYDYLKEIGYLK |
| Ga0209986_104013732 | 3300024433 | Deep Subsurface | CAQADEDCPAEYRTRHFRSTMDDAYDYLKEIGYLK |
| Ga0208667_10449143 | 3300025070 | Marine | QNTLLADHLAGMCCQADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKRDK |
| Ga0208434_10664382 | 3300025098 | Marine | TNMCCQADEDCPAEYRTRHFRNTMDAAYDYLKEIGYLK |
| Ga0208434_10698813 | 3300025098 | Marine | GMCCQADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKRDK |
| Ga0208666_10476831 | 3300025102 | Marine | HLASMCCQADEDCPAEYRTEHFRSTMDDAYDYLKEIGYLK |
| Ga0208158_10415831 | 3300025110 | Marine | NKVKTLSDHLAGMCCQADEDTPSEYRTEHFRSTMDDAYEYLEKINYFKRDK |
| Ga0208158_11520932 | 3300025110 | Marine | KQNTLLADHLAGMCCQADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKRDK |
| Ga0209535_10820841 | 3300025120 | Marine | AMCCQADEDCPAEYRTEHFRSTMDDAYEYLEKIGYFKK |
| Ga0209535_11511294 | 3300025120 | Marine | DHLAGMCCQADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKRGK |
| Ga0209348_11452504 | 3300025127 | Marine | QADQDTPSEYRTRHFRNTMDMAYEYLEEIGYIKIDRD |
| Ga0208919_10043471 | 3300025128 | Marine | DHLTNMCCQADEDCPAEYRTRHFRNTMDAAYDYLKEIGYLK |
| Ga0208919_10614323 | 3300025128 | Marine | ASMCCQADEDCPAEYRTEHFRSTMDDAYDYLKEIGYLK |
| Ga0208299_11148075 | 3300025133 | Marine | TMCCQADLDCPSEYRTKHFRSTMDDAYGYLKEIGYLK |
| Ga0209336_100882254 | 3300025137 | Marine | CCQADEDCPAEYRTEHFRSTMDDAYEYLEKIGYYKK |
| Ga0209634_12688562 | 3300025138 | Marine | LAAMCCQADEDCPAEYRTKHFRSTMDDAYDYLIEIGYLK |
| Ga0209645_10837165 | 3300025151 | Marine | TLLADHLASMCCQADEDTPSEYRTRHFRNTMDGAYEYLEKIGYFKKG |
| Ga0209645_11587621 | 3300025151 | Marine | NTLLADHLASMCCQADEDTPSEYRTRHFRNTMDSAYEYLEKINYFKRDE |
| Ga0209645_11883391 | 3300025151 | Marine | TLLADHLASMCCQADEDTPSEYRTRHFRNTMDGAYEYLEKIGYFKRDK |
| Ga0209337_10398946 | 3300025168 | Marine | HLASMCCQADEDCPAEYRTDHFRSTMDDAYDYLKKIGYLK |
| Ga0209337_12173582 | 3300025168 | Marine | LAAMCCQADEDCPAEYRTEHFRSTMDDAYDYLKKIGYLNE |
| Ga0209195_11090751 | 3300025590 | Pelagic Marine | CCQADEDCPAEYRTEHFRSTMDDAYDYLKKIGYLNE |
| Ga0208161_11459663 | 3300025646 | Aqueous | NADEDTPSEYRTRHFRDAMNEAYEYLEEIGYFKKEEK |
| Ga0208898_10723181 | 3300025671 | Aqueous | NKVKTLSDHLAGMCCQADEDTPSEYRTEHFRSTMDDAYEYLRKINYFKK |
| Ga0208162_11012045 | 3300025674 | Aqueous | AGMCCQADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKK |
| Ga0209095_11747841 | 3300025685 | Pelagic Marine | LSDHLAGMCCQADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKK |
| Ga0209832_11572092 | 3300025830 | Pelagic Marine | AMCCQADEDCPAEYRTEHFRSTMDDAYDYLREIGYLK |
| Ga0209603_10582341 | 3300025849 | Pelagic Marine | CQADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKK |
| Ga0208645_11949851 | 3300025853 | Aqueous | TPAEYRTEHFRSAMTDSYDYLEKIGYIKKEEKDED |
| Ga0209757_102935292 | 3300025873 | Marine | LASMCCQADEDCPAEYRTKHFRSTMEDAYDYLKEIGYLK |
| Ga0209631_104296691 | 3300025890 | Pelagic Marine | SDHLAGMCCQADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKK |
| Ga0209932_11074582 | 3300026183 | Pond Water | QADEDTPAEYRTEHFRSAMTDGYDYLKEIGYLKEENNED |
| Ga0265303_105933381 | 3300028600 | Sediment | NMCAQADEDCPAEYRTEHFRSTMDDAYDYLKEIGYLK |
| Ga0265303_109983841 | 3300028600 | Sediment | HLAAMCCQADEDCPAEYRTEHFRSTMDDAYDYLKEIGYLK |
| Ga0315331_110719783 | 3300031774 | Seawater | TLSDHLAGMCCQADEDTPSEYRTEHFRSTMDDAYEYLEKINYFKRDK |
| Ga0316201_110116461 | 3300032136 | Worm Burrow | LAAMCCQADEDCPAEYRTEHFRSTMDDAYDYLKEIGYLNEN |
| Ga0316202_106339213 | 3300032277 | Microbial Mat | GMCCQADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKRGK |
| Ga0314858_070084_2_112 | 3300033742 | Sea-Ice Brine | QADEDTPSEYRTEHFRSTMDDAYEYLEKIGYFKRDK |
| Ga0314858_112744_2_109 | 3300033742 | Sea-Ice Brine | CCQADEDCPAEYRTEHFRSTMDDAYDYLKEIGYLK |
| Ga0348335_165479_32_154 | 3300034374 | Aqueous | MCCQADEDTPSEYRTRHFRNTMDEAYEYLDEIGYFKKGEK |
| ⦗Top⦘ |