


| Basic Information | |
|---|---|
| Family ID | F050703 |
| Family Type | Metagenome |
| Number of Sequences | 145 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MRDAIFMLAPVALIIYFVAYPDQFSAFLNWAGQFLH |
| Number of Associated Samples | 121 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 80.69 % |
| % of genes near scaffold ends (potentially truncated) | 24.83 % |
| % of genes from short scaffolds (< 2000 bps) | 63.45 % |
| Associated GOLD sequencing projects | 116 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (81.379 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (8.276 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.103 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (37.931 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.56% β-sheet: 0.00% Coil/Unstructured: 48.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF00856 | SET | 40.69 |
| PF00892 | EamA | 4.14 |
| PF07883 | Cupin_2 | 4.14 |
| PF14497 | GST_C_3 | 3.45 |
| PF05681 | Fumerase | 2.07 |
| PF05683 | Fumerase_C | 2.07 |
| PF02566 | OsmC | 2.07 |
| PF08734 | GYD | 2.07 |
| PF07729 | FCD | 0.69 |
| PF01541 | GIY-YIG | 0.69 |
| PF13458 | Peripla_BP_6 | 0.69 |
| PF12680 | SnoaL_2 | 0.69 |
| PF13545 | HTH_Crp_2 | 0.69 |
| PF13354 | Beta-lactamase2 | 0.69 |
| PF00221 | Lyase_aromatic | 0.69 |
| PF07378 | FlbT | 0.69 |
| PF04280 | Tim44 | 0.69 |
| PF06808 | DctM | 0.69 |
| PF13467 | RHH_4 | 0.69 |
| PF03588 | Leu_Phe_trans | 0.69 |
| PF00990 | GGDEF | 0.69 |
| PF13505 | OMP_b-brl | 0.69 |
| PF03466 | LysR_substrate | 0.69 |
| PF07732 | Cu-oxidase_3 | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 2.07 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 2.07 |
| COG1838 | Tartrate dehydratase beta subunit/Fumarate hydratase class I, C-terminal domain | Energy production and conversion [C] | 2.07 |
| COG1951 | Tartrate dehydratase alpha subunit/Fumarate hydratase class I, N-terminal domain | Energy production and conversion [C] | 2.07 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 2.07 |
| COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.69 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.69 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.69 |
| COG2360 | Leu/Phe-tRNA-protein transferase | Posttranslational modification, protein turnover, chaperones [O] | 0.69 |
| COG2986 | Histidine ammonia-lyase | Amino acid transport and metabolism [E] | 0.69 |
| COG4395 | Predicted lipid-binding transport protein, Tim44 family | Lipid transport and metabolism [I] | 0.69 |
| COG5443 | Flagellar biosynthesis regulator FlbT | Cell motility [N] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.38 % |
| Unclassified | root | N/A | 18.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090015|GPICI_9029450 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2137 | Open in IMG/M |
| 2199352025|deepsgr__Contig_23443 | Not Available | 559 | Open in IMG/M |
| 2228664021|ICCgaii200_c0832451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1431 | Open in IMG/M |
| 3300000041|ARcpr5oldR_c000138 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 12428 | Open in IMG/M |
| 3300000156|NODE_c0684193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3172 | Open in IMG/M |
| 3300000550|F24TB_10815614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4415 | Open in IMG/M |
| 3300000953|JGI11615J12901_10798171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1721 | Open in IMG/M |
| 3300004479|Ga0062595_101309707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys | 653 | Open in IMG/M |
| 3300004480|Ga0062592_100206175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1393 | Open in IMG/M |
| 3300005163|Ga0066823_10012265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1230 | Open in IMG/M |
| 3300005290|Ga0065712_10117018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1726 | Open in IMG/M |
| 3300005529|Ga0070741_10011414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 16416 | Open in IMG/M |
| 3300005543|Ga0070672_100000433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 24368 | Open in IMG/M |
| 3300005548|Ga0070665_100427940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys | 1333 | Open in IMG/M |
| 3300005564|Ga0070664_100046775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3656 | Open in IMG/M |
| 3300005713|Ga0066905_100033371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2952 | Open in IMG/M |
| 3300005713|Ga0066905_100172383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1586 | Open in IMG/M |
| 3300005713|Ga0066905_100374311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23 | 1146 | Open in IMG/M |
| 3300005764|Ga0066903_100002666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 14124 | Open in IMG/M |
| 3300005764|Ga0066903_104177411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 773 | Open in IMG/M |
| 3300005841|Ga0068863_102291639 | Not Available | 550 | Open in IMG/M |
| 3300005842|Ga0068858_100049404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3896 | Open in IMG/M |
| 3300005843|Ga0068860_100329387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1500 | Open in IMG/M |
| 3300005937|Ga0081455_10003308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 18643 | Open in IMG/M |
| 3300006028|Ga0070717_10000575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 23445 | Open in IMG/M |
| 3300006047|Ga0075024_100862788 | Not Available | 512 | Open in IMG/M |
| 3300006163|Ga0070715_10676058 | Not Available | 614 | Open in IMG/M |
| 3300006172|Ga0075018_10008671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3708 | Open in IMG/M |
| 3300006173|Ga0070716_100083669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1911 | Open in IMG/M |
| 3300006178|Ga0075367_10482318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 786 | Open in IMG/M |
| 3300006804|Ga0079221_10426294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 832 | Open in IMG/M |
| 3300006852|Ga0075433_10421851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1177 | Open in IMG/M |
| 3300006854|Ga0075425_101008934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys | 949 | Open in IMG/M |
| 3300006854|Ga0075425_102819597 | Not Available | 534 | Open in IMG/M |
| 3300006871|Ga0075434_100079741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3270 | Open in IMG/M |
| 3300006881|Ga0068865_100274123 | Not Available | 1340 | Open in IMG/M |
| 3300006903|Ga0075426_10430498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 976 | Open in IMG/M |
| 3300006903|Ga0075426_10682309 | Not Available | 770 | Open in IMG/M |
| 3300006914|Ga0075436_100508646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys | 882 | Open in IMG/M |
| 3300006954|Ga0079219_10083607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys | 1509 | Open in IMG/M |
| 3300009093|Ga0105240_10622364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys | 1186 | Open in IMG/M |
| 3300009093|Ga0105240_11579944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 687 | Open in IMG/M |
| 3300009156|Ga0111538_10014995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 10200 | Open in IMG/M |
| 3300009162|Ga0075423_10000467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 32790 | Open in IMG/M |
| 3300009166|Ga0105100_10987844 | Not Available | 527 | Open in IMG/M |
| 3300009174|Ga0105241_10868473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys | 835 | Open in IMG/M |
| 3300009545|Ga0105237_10393557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1390 | Open in IMG/M |
| 3300010046|Ga0126384_11867207 | Not Available | 572 | Open in IMG/M |
| 3300010047|Ga0126382_10004116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6378 | Open in IMG/M |
| 3300010047|Ga0126382_10045004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2542 | Open in IMG/M |
| 3300010358|Ga0126370_11075836 | Not Available | 740 | Open in IMG/M |
| 3300010359|Ga0126376_13106531 | Not Available | 514 | Open in IMG/M |
| 3300010362|Ga0126377_10039444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 4051 | Open in IMG/M |
| 3300010362|Ga0126377_12152363 | Not Available | 634 | Open in IMG/M |
| 3300010371|Ga0134125_10291353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1813 | Open in IMG/M |
| 3300010371|Ga0134125_10560358 | Not Available | 1264 | Open in IMG/M |
| 3300010375|Ga0105239_11079656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 924 | Open in IMG/M |
| 3300010375|Ga0105239_12429279 | Not Available | 610 | Open in IMG/M |
| 3300010399|Ga0134127_10152145 | Not Available | 2102 | Open in IMG/M |
| 3300010399|Ga0134127_10688863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1061 | Open in IMG/M |
| 3300011269|Ga0137392_10399423 | Not Available | 1141 | Open in IMG/M |
| 3300012357|Ga0137384_10135352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23 | 2063 | Open in IMG/M |
| 3300012897|Ga0157285_10001588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3762 | Open in IMG/M |
| 3300012958|Ga0164299_10137348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1333 | Open in IMG/M |
| 3300012958|Ga0164299_11551932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 519 | Open in IMG/M |
| 3300012960|Ga0164301_10067380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1924 | Open in IMG/M |
| 3300012961|Ga0164302_10407613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys | 930 | Open in IMG/M |
| 3300012971|Ga0126369_10576621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1192 | Open in IMG/M |
| 3300012971|Ga0126369_12525871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys | 599 | Open in IMG/M |
| 3300012987|Ga0164307_10084615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1938 | Open in IMG/M |
| 3300013307|Ga0157372_10668641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys | 1209 | Open in IMG/M |
| 3300014318|Ga0075351_1009459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1361 | Open in IMG/M |
| 3300014326|Ga0157380_12808131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300015371|Ga0132258_10011404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 18602 | Open in IMG/M |
| 3300015371|Ga0132258_11189547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys | 1927 | Open in IMG/M |
| 3300015371|Ga0132258_11401046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1766 | Open in IMG/M |
| 3300015373|Ga0132257_100043373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4972 | Open in IMG/M |
| 3300015373|Ga0132257_100425271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1618 | Open in IMG/M |
| 3300015373|Ga0132257_102839390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys | 631 | Open in IMG/M |
| 3300015374|Ga0132255_100980566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1267 | Open in IMG/M |
| 3300017936|Ga0187821_10161803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys | 849 | Open in IMG/M |
| 3300017944|Ga0187786_10014406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys | 1991 | Open in IMG/M |
| 3300017947|Ga0187785_10000517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 14425 | Open in IMG/M |
| 3300017959|Ga0187779_10028998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3177 | Open in IMG/M |
| 3300017966|Ga0187776_10000909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 14459 | Open in IMG/M |
| 3300017966|Ga0187776_10342825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 984 | Open in IMG/M |
| 3300017973|Ga0187780_10195787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys | 1408 | Open in IMG/M |
| 3300017974|Ga0187777_10589032 | Not Available | 783 | Open in IMG/M |
| 3300017993|Ga0187823_10231819 | Not Available | 618 | Open in IMG/M |
| 3300017994|Ga0187822_10156049 | Not Available | 736 | Open in IMG/M |
| 3300018028|Ga0184608_10024065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23 | 2238 | Open in IMG/M |
| 3300018060|Ga0187765_10015817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3500 | Open in IMG/M |
| 3300018060|Ga0187765_10018613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3266 | Open in IMG/M |
| 3300018072|Ga0184635_10019140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2493 | Open in IMG/M |
| 3300019356|Ga0173481_10001451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 5722 | Open in IMG/M |
| 3300019361|Ga0173482_10000071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 13866 | Open in IMG/M |
| 3300019362|Ga0173479_10000285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9473 | Open in IMG/M |
| 3300021560|Ga0126371_11719363 | Not Available | 751 | Open in IMG/M |
| 3300023168|Ga0247748_1008354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1341 | Open in IMG/M |
| 3300025711|Ga0207696_1163191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys | 592 | Open in IMG/M |
| 3300025711|Ga0207696_1181475 | Not Available | 556 | Open in IMG/M |
| 3300025900|Ga0207710_10007780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 4537 | Open in IMG/M |
| 3300025912|Ga0207707_10288245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1421 | Open in IMG/M |
| 3300025914|Ga0207671_10523294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys | 946 | Open in IMG/M |
| 3300025916|Ga0207663_10035748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2983 | Open in IMG/M |
| 3300025917|Ga0207660_10250519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1398 | Open in IMG/M |
| 3300025919|Ga0207657_10072415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2915 | Open in IMG/M |
| 3300025920|Ga0207649_10198574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1415 | Open in IMG/M |
| 3300025921|Ga0207652_10256954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1576 | Open in IMG/M |
| 3300025925|Ga0207650_10150898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys | 1834 | Open in IMG/M |
| 3300025926|Ga0207659_11092902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys | 686 | Open in IMG/M |
| 3300025933|Ga0207706_10043857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3963 | Open in IMG/M |
| 3300025965|Ga0210090_1028187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys | 767 | Open in IMG/M |
| 3300026088|Ga0207641_10824717 | Not Available | 918 | Open in IMG/M |
| 3300026116|Ga0207674_10089234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3075 | Open in IMG/M |
| 3300026319|Ga0209647_1025839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3529 | Open in IMG/M |
| 3300026725|Ga0207474_101324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys | 730 | Open in IMG/M |
| 3300027787|Ga0209074_10009384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2375 | Open in IMG/M |
| 3300027894|Ga0209068_10001621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 11172 | Open in IMG/M |
| 3300027910|Ga0209583_10199189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 854 | Open in IMG/M |
| 3300027915|Ga0209069_10832485 | Not Available | 554 | Open in IMG/M |
| 3300028592|Ga0247822_10177172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1584 | Open in IMG/M |
| 3300028802|Ga0307503_10162763 | Not Available | 1024 | Open in IMG/M |
| 3300031170|Ga0307498_10004392 | Not Available | 2427 | Open in IMG/M |
| 3300031231|Ga0170824_114990514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4190 | Open in IMG/M |
| 3300031241|Ga0265325_10000093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 63498 | Open in IMG/M |
| 3300031562|Ga0310886_10099850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1443 | Open in IMG/M |
| 3300031716|Ga0310813_10184923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23 | 1699 | Open in IMG/M |
| 3300031740|Ga0307468_100020578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2902 | Open in IMG/M |
| 3300031942|Ga0310916_10700434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys | 857 | Open in IMG/M |
| 3300031944|Ga0310884_10100144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys | 1417 | Open in IMG/M |
| 3300032180|Ga0307471_101968003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys | 732 | Open in IMG/M |
| 3300032211|Ga0310896_10000994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6801 | Open in IMG/M |
| 3300032770|Ga0335085_10148314 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2947 | Open in IMG/M |
| 3300032770|Ga0335085_11724162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys | 644 | Open in IMG/M |
| 3300032782|Ga0335082_10013431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 8879 | Open in IMG/M |
| 3300032782|Ga0335082_10062463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3801 | Open in IMG/M |
| 3300032828|Ga0335080_10370553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1542 | Open in IMG/M |
| 3300032828|Ga0335080_11211244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys | 758 | Open in IMG/M |
| 3300032893|Ga0335069_10391306 | Not Available | 1633 | Open in IMG/M |
| 3300032893|Ga0335069_11647066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys | 686 | Open in IMG/M |
| 3300032897|Ga0335071_11043896 | Not Available | 763 | Open in IMG/M |
| 3300033004|Ga0335084_10134442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2572 | Open in IMG/M |
| 3300033433|Ga0326726_10047024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3772 | Open in IMG/M |
| 3300033486|Ga0316624_10000032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 37493 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.28% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 7.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.90% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.21% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.21% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 5.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.83% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.45% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.76% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.07% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.07% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.07% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.07% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.38% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.38% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.38% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.69% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.69% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.69% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.69% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.69% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.69% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.69% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.69% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090015 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Host-Associated | Open in IMG/M |
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014318 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300023168 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S064-202C-5 | Environmental | Open in IMG/M |
| 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025965 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026725 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G07A5-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPICI_01870360 | 2088090015 | Soil | MRDLMFMLAPVALVLYFVVYPDQFSYFLGWAGRLLH |
| deepsgr_03412920 | 2199352025 | Soil | MRDLIFMLAPVALIIYFVVFPDQFGALLGWAGHYVH |
| ICCgaii200_08324512 | 2228664021 | Soil | MRDAIFMLAPVALVIYFVAYPDQFSAFLNWAGQFLR |
| ARcpr5oldR_00013813 | 3300000041 | Arabidopsis Rhizosphere | MRDAIFMLAPVALIIYFVAYPDQFSAFLNWAGQFLH* |
| NODE_06841937 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MRDAVFMLAPVALVIYFVAYPDQFSAFLNWAGQFLH* |
| F24TB_108156147 | 3300000550 | Soil | MRDLMFMLAPVALVLYFVVYPDQFSYFLGWAGRLLH* |
| JGI11615J12901_107981712 | 3300000953 | Soil | MRDAIFMLAPVALVIYFVAYPDQFSAFLNWAGRFLH* |
| Ga0062595_1013097071 | 3300004479 | Soil | SRCQLGNRPMRDLMFMLFPVALVIYFVIYPDQFSAFVDWAGQLFH* |
| Ga0062592_1002061751 | 3300004480 | Soil | MSVQGNPMRDAIFMLAPVALVIYFVAYPDQFSAFLNWAGQFL |
| Ga0066823_100122653 | 3300005163 | Soil | NVSARGIPMRDLMFMLAPVALVLYFVVYPDQFSLFVGWAGSLLR* |
| Ga0065712_101170181 | 3300005290 | Miscanthus Rhizosphere | MSVQGNPMRDAIFMLAPVALVIYFVAYPDQFSAFLNWAGQFLH* |
| Ga0070741_1001141417 | 3300005529 | Surface Soil | MRDLMFMLAPVALVIYFVVYPDQFSAFLSWAGRFLH* |
| Ga0070672_10000043315 | 3300005543 | Miscanthus Rhizosphere | MRDAIFMLAPVALVIYFVAYPDQFSAFLNWAGQFLH* |
| Ga0070665_1004279404 | 3300005548 | Switchgrass Rhizosphere | MRDLIFMLAPVALIIYFVVFPDQFGALLGWAGHYVH* |
| Ga0070664_1000467756 | 3300005564 | Corn Rhizosphere | MRDLVFMLAPVALIIYFVVFPDQFSALLGWAGHYVH* |
| Ga0066905_1000333711 | 3300005713 | Tropical Forest Soil | MRDLMFMLAPVALVLYFVVYPDQFSSFLGWAGRFLH* |
| Ga0066905_1001723831 | 3300005713 | Tropical Forest Soil | MRDAIFMLAPVALVIYFVAYPDQFSAFLNWAGQFVR* |
| Ga0066905_1003743112 | 3300005713 | Tropical Forest Soil | MRDAIFMLAPVALVIYFVAYPDQFSAFLNWAGQFIR* |
| Ga0066903_10000266618 | 3300005764 | Tropical Forest Soil | MRDLIFMLAPVALILYFVVFPDQFSAFLGWAGQYVH* |
| Ga0066903_1041774112 | 3300005764 | Tropical Forest Soil | MRDAIFMLAPVALVVYFVAYPDQFSAFLNWAGQFIR* |
| Ga0068863_1022916392 | 3300005841 | Switchgrass Rhizosphere | MRDVIFMLAPVALVIYFVVYPDQFSAFLNWAGQFL |
| Ga0068858_1000494044 | 3300005842 | Switchgrass Rhizosphere | MRDVIFMLAPVALVIYFVVYPDQFSAFLNWAGQFLH* |
| Ga0068860_1003293872 | 3300005843 | Switchgrass Rhizosphere | MRDLIFMLAPVALIIYFVVFPDQFGALLGWASHYVH* |
| Ga0081455_1000330814 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MRDLMFMLAPVALVLYFVVYPDQFSSFLGWAGRLLH* |
| Ga0070717_100005754 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDLMFMLAPVALVLYFVVYPDQFSLFVGWAGSLLR* |
| Ga0075024_1008627882 | 3300006047 | Watersheds | MRDLMFMLAPVALILYFLVYPGQFSALLSWAGQFVH* |
| Ga0070715_106760581 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDSMFMLAPVGLIIYFLIYPDQFHAFLAWAGQYLR* |
| Ga0075018_100086716 | 3300006172 | Watersheds | MRDLMFMLAPVGLIIYFVVYPDQFSALVSWAGQYVH* |
| Ga0070716_1000836692 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDFMFMLAPVALIIYFLLYPDQFNAFLAWAGQYLH* |
| Ga0075367_104823183 | 3300006178 | Populus Endosphere | MRDAIFMLAPVALVIYFVAYPDQFSAFLSWAGQFIH* |
| Ga0079221_104262942 | 3300006804 | Agricultural Soil | MRDLFFMLAPIGLIIYFVIYPDQFSALLNWAGQFMH* |
| Ga0075433_104218513 | 3300006852 | Populus Rhizosphere | DLMFMLAPVALILYFVVYPDQFSSFVGWAGSLLH* |
| Ga0075425_1010089341 | 3300006854 | Populus Rhizosphere | DLMFMLAPVALILYFVVYPDQFSSFVGWAGSLLL* |
| Ga0075425_1028195972 | 3300006854 | Populus Rhizosphere | MRDLMFMLAPVALILYFVVYPDQFSSFVGWAGSLL |
| Ga0075434_1000797412 | 3300006871 | Populus Rhizosphere | MRDLMFMLAPVALILYFVVYPDQFSSFVGWAGSLLH* |
| Ga0068865_1002741232 | 3300006881 | Miscanthus Rhizosphere | MRDLMFMLAPVALVLYFVVYPDQFSSFVGWAGSLLH* |
| Ga0075426_104304982 | 3300006903 | Populus Rhizosphere | MRDLMFMLAPVALILYFVVYPDQFSSFVGWAGQLLY* |
| Ga0075426_106823092 | 3300006903 | Populus Rhizosphere | MRDAIFMLAPVALVIYFVAYPDQFSAFLNWAGQFL |
| Ga0075436_1005086461 | 3300006914 | Populus Rhizosphere | PMRDLMFMLAPVALILYFVVYPDQFSSFVGWAGQLLY* |
| Ga0079219_100836073 | 3300006954 | Agricultural Soil | MRDLIFMLAPVALIIYFVVYPDQFNALLGWAGQYVH* |
| Ga0105240_106223641 | 3300009093 | Corn Rhizosphere | RPMRDLVFMLAPVALIIYFVVFPDQFSALLGWAGHYVH* |
| Ga0105240_115799441 | 3300009093 | Corn Rhizosphere | MRDLMFMLFPVALVIYFVIYPDQFSAFVDWAGQLFH* |
| Ga0111538_1001499510 | 3300009156 | Populus Rhizosphere | MRDLMFMMAPVALILYFVVYPDQFSSFVGWAGSLLH* |
| Ga0075423_1000046730 | 3300009162 | Populus Rhizosphere | MRDLMFMLAPVALLYFVVYPDQFSYFLGWAGRLLH* |
| Ga0105100_109878441 | 3300009166 | Freshwater Sediment | MRDVIFMVAPVAIAIYFLVYPDEFHALVAWAMQFIR* |
| Ga0105241_108684731 | 3300009174 | Corn Rhizosphere | DAIFMLAPVALIIYFVAYPDQFSAFLNWAGQFLH* |
| Ga0105237_103935572 | 3300009545 | Corn Rhizosphere | MRDLVFMLAPVALIIYFVVFPDQFSALLGWASHYVH* |
| Ga0126384_118672072 | 3300010046 | Tropical Forest Soil | MRDAIFMLAPVALVVYFVAYPDQFSAFLNWAGQFLH* |
| Ga0126382_100041161 | 3300010047 | Tropical Forest Soil | MRDLMFMLAPVALIFYFVVYPDQFSSFLGWAGRLLH* |
| Ga0126382_100450043 | 3300010047 | Tropical Forest Soil | MRDAIFMLAPVALVIYFVAYPDQFSAFLSWAGQFIR* |
| Ga0126370_110758361 | 3300010358 | Tropical Forest Soil | MRDLMFMLAPVALILYFVVYPDQFSSFVGWAGQLLH |
| Ga0126376_131065311 | 3300010359 | Tropical Forest Soil | MRDLFFMLAPIGLIIYFVVYPDQFTAFLNWAGQFMH* |
| Ga0126377_100394444 | 3300010362 | Tropical Forest Soil | MRDLMFMLAPVALIIYFVVYPDQFSSFLGWAGRFIH* |
| Ga0126377_121523632 | 3300010362 | Tropical Forest Soil | MRDAIFMLAPVALIIYFVAYPDQFSAFLYWAGQFIR* |
| Ga0134125_102913532 | 3300010371 | Terrestrial Soil | MRDAIFILAPVALIIYFVAYPDQFSAFLNWAGQFLH* |
| Ga0134125_105603582 | 3300010371 | Terrestrial Soil | MRDLIFMLAPVVLVIYFVVYPDQFNALLGWAGQYVH* |
| Ga0105239_110796561 | 3300010375 | Corn Rhizosphere | MRDLIFMLAPVALIIYFVVFPDQFGALLGWAGQYVR* |
| Ga0105239_124292791 | 3300010375 | Corn Rhizosphere | MRDAIFMLAPVALIIYFVAYPDQFTAFLNWAGQFLH* |
| Ga0134127_101521453 | 3300010399 | Terrestrial Soil | MRDAIFMLAPVALVIYFVAYPDQFSAFLYWAGQFLR* |
| Ga0134127_106888633 | 3300010399 | Terrestrial Soil | ERPMRDLIFMLAPVALIIYFVVFPDQFGALLGWAGHYVH* |
| Ga0137392_103994232 | 3300011269 | Vadose Zone Soil | MRDLLFMLAPVGLIIYFVIYPDQFNALLTWAGHYIR* |
| Ga0137384_101353522 | 3300012357 | Vadose Zone Soil | MRDLLFMLAPVGLIIYFVFYPDQFNALLTWAGQYIR* |
| Ga0157285_100015883 | 3300012897 | Soil | MSVQGNPMRDAIFMLAPVALVIYFVAYPDQFTAFLNWAGQFLH* |
| Ga0164299_101373481 | 3300012958 | Soil | PMRDLMFMLAPVALILYFVVYPDQFSSFVGWAGSLLH* |
| Ga0164299_115519322 | 3300012958 | Soil | KNPMRDLIFMLAPVAFIIYFVVYPEQFNAFVGWISHLLH* |
| Ga0164301_100673803 | 3300012960 | Soil | MRDLIFMLAPVAFIIYFVVYPEQFNAFVGWISHLLH* |
| Ga0164302_104076133 | 3300012961 | Soil | MRDLVFMFAQVALIIYFVVFPDQFGALLGWAGHYVH* |
| Ga0126369_105766211 | 3300012971 | Tropical Forest Soil | MRDVVFMLAPVALILYFVVYPDQFSSFVGWAGQLLH* |
| Ga0126369_125258711 | 3300012971 | Tropical Forest Soil | SVRDLMFMLAPVALVLYFVVFPDQFSAFLGWAGQYLH* |
| Ga0164307_100846153 | 3300012987 | Soil | MRDLIFMLAPVVLVIYFLVYPDQFNALLGWAGQYVH* |
| Ga0157372_106686412 | 3300013307 | Corn Rhizosphere | MRDLVFMLAPVALIIYFVVFPDQFSALLGWAGQYVH* |
| Ga0075351_10094593 | 3300014318 | Natural And Restored Wetlands | CRVNPMRDAIFMLAPVALIIYFVAYPDQFTAFPNWAGQFLH* |
| Ga0157380_128081311 | 3300014326 | Switchgrass Rhizosphere | MRDAIFMLAPVALIIYFVAYPDQFTAFLNWAGQFLH |
| Ga0132258_100114045 | 3300015371 | Arabidopsis Rhizosphere | MRDVIFMVAPVALIVYFVVYPDQFSAFVNWAGRLLH* |
| Ga0132258_111895473 | 3300015371 | Arabidopsis Rhizosphere | MRDLIFMLAPVALIVYFVVFPDQFGALLGWAGHYVH* |
| Ga0132258_114010462 | 3300015371 | Arabidopsis Rhizosphere | MRDAIFMLAPVALVIYFVAYPDQFSAFLNWAGQFLR* |
| Ga0132257_1000433732 | 3300015373 | Arabidopsis Rhizosphere | MRDAIFMLAPVALIIYFVANPDQFSAFLNWAGQFLH* |
| Ga0132257_1004252713 | 3300015373 | Arabidopsis Rhizosphere | GTTMRDLMFMLAPVALILYFVVYPDQFSSFVGWAGSLLL* |
| Ga0132257_1028393901 | 3300015373 | Arabidopsis Rhizosphere | MRDIVFMVAPVALIVYFVVYPDQFSAFVNWAGRLLH* |
| Ga0132255_1009805662 | 3300015374 | Arabidopsis Rhizosphere | MRDTIFMLAPVALVIYFVAYPDQFSAFLNWAGQFLR* |
| Ga0187821_101618031 | 3300017936 | Freshwater Sediment | MRDLMFMLAPVALIIYFVINPDQFSALVNWAGQVFH |
| Ga0187786_100144062 | 3300017944 | Tropical Peatland | MRDLLFMLSPVALIIYFLIYPDQFNAFLAWARQLLH |
| Ga0187785_1000051711 | 3300017947 | Tropical Peatland | MRDLMFMLAPVALIFYFVVYPDQFSALLSWAGQYVR |
| Ga0187779_100289983 | 3300017959 | Tropical Peatland | MRDVIFMVAPVGLIVYFVMYPDQFNAFLAWAGRFLH |
| Ga0187776_100009096 | 3300017966 | Tropical Peatland | MRDLIFMVAPVALVIYFVVFPDQFSAFVNWAGQFLH |
| Ga0187776_103428251 | 3300017966 | Tropical Peatland | GKPMRDLMFMLAPVALIIYFVVYPDQFSALLSWAGQYVH |
| Ga0187780_101957871 | 3300017973 | Tropical Peatland | MRDFMFMLAPVALIIYFLLYPDQFNAFLAWAGQYLH |
| Ga0187777_105890321 | 3300017974 | Tropical Peatland | MRDFLFMLAPVGLVIYFLLYPDQFNAFLVWAGQYLH |
| Ga0187823_102318191 | 3300017993 | Freshwater Sediment | MRDLMFMLAPVALIIYFVIYPDQFSAFVNWAGQLLH |
| Ga0187822_101560491 | 3300017994 | Freshwater Sediment | MRDLFFMLAPIGLIIYFVIYPDQFSALLNWAGQFMH |
| Ga0184608_100240652 | 3300018028 | Groundwater Sediment | MRDFMFMLAPVALIIYFVVYPDKFSSFLGWAGQLLH |
| Ga0187765_100158173 | 3300018060 | Tropical Peatland | MRDLMFMLAPVALILYFVVYPDQFSSFVGWAGSFLR |
| Ga0187765_100186134 | 3300018060 | Tropical Peatland | MRDLIFMLAPVALIIYFVIFPDQFSAFLGWAGQYVH |
| Ga0184635_100191404 | 3300018072 | Groundwater Sediment | MRDWMFMLAPVVLIMYFVVYPDQFYSFVGWAGQFLR |
| Ga0173481_100014513 | 3300019356 | Soil | MRDAIFMLAPVALIIYFVAYPDQFSAFLNWAGQFLH |
| Ga0173482_100000717 | 3300019361 | Soil | MSVQGNPMRDAIFMLAPVALVIYFVAYPDQFSAFLNWAGQFLH |
| Ga0173479_1000028510 | 3300019362 | Soil | MRDAIFMLAPVALVIYFVAYPDQFSAFLNWAGQFLH |
| Ga0126371_117193632 | 3300021560 | Tropical Forest Soil | MRDVVFMLAPVALILYFVVYPDQFSSFVGWAGQLLH |
| Ga0247748_10083541 | 3300023168 | Soil | RINMSVQGNPMRDAIFMLAPVALVIYFVAYPDQFSAFLNWAGQFLH |
| Ga0207696_11631911 | 3300025711 | Switchgrass Rhizosphere | PMRDAIFMLAPVALVIYFVAYPDQFSAFLNWAGQFLH |
| Ga0207696_11814752 | 3300025711 | Switchgrass Rhizosphere | MRDLIFMLAPVALIIYFVVFPDQFSALLGWAGHYVH |
| Ga0207710_100077807 | 3300025900 | Switchgrass Rhizosphere | MRDLMFMLAPVALVLYFVVYPDQFSSFVGWAGSLLH |
| Ga0207707_102882451 | 3300025912 | Corn Rhizosphere | MRDLIFMLAPVALIIYFVVFPDQFGALLGWAGHYV |
| Ga0207671_105232943 | 3300025914 | Corn Rhizosphere | PMRDLVFMLAPVALIIYFVVFPDQFSALLGWAGHYVH |
| Ga0207663_100357485 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDLMFMLAPVALILYFVVYPDQFSSFVGWAGSLLH |
| Ga0207660_102505191 | 3300025917 | Corn Rhizosphere | MRDAIFMLAPVALVIYFVAYPDQFSAFLYWAGQFLR |
| Ga0207657_100724151 | 3300025919 | Corn Rhizosphere | MRDLMFMLAPVALVLYFVVYPDQFSLFVGWAGSLLH |
| Ga0207649_101985741 | 3300025920 | Corn Rhizosphere | MRDLIFMLAPVALIIYFVVFPDQFGALLGWAGQYVH |
| Ga0207652_102569541 | 3300025921 | Corn Rhizosphere | RDAVFMLAPVALVIYFVAYPDQFSAFLNWAGQFLH |
| Ga0207650_101508983 | 3300025925 | Switchgrass Rhizosphere | MRDVIFMLAPVALVIYFVVYPDQFSAFLNWAGQFLH |
| Ga0207659_110929021 | 3300025926 | Miscanthus Rhizosphere | PMRDLIFMLAPVALIIYFVVFPDQFGALLGWAGHYVH |
| Ga0207706_100438575 | 3300025933 | Corn Rhizosphere | MRDLIFMLAPVALIIYFVVFPDQFGALLGWASHYVH |
| Ga0210090_10281872 | 3300025965 | Natural And Restored Wetlands | MRDAIFMLAPVALIIYFVAYPDQFTAFPNWAGQFLH |
| Ga0207641_108247171 | 3300026088 | Switchgrass Rhizosphere | MRDAIFMLAPVALIIYFVAYPDQFSAFLNWAGQFIH |
| Ga0207674_100892343 | 3300026116 | Corn Rhizosphere | MRDAIFMLAPVALIIYFVAYPDQFRAFLNWAGQFLH |
| Ga0209647_10258394 | 3300026319 | Grasslands Soil | MRDLLFMLAPVGLIIYFVIYPDQFNALLTWAGHYIR |
| Ga0207474_1013242 | 3300026725 | Soil | STCRCRVTPMRDAIFMLAPVALIIYFVAYPDQFSAFLNWAGQFLH |
| Ga0209074_100093841 | 3300027787 | Agricultural Soil | MRDAVFMLAPVALVIYFVAYPDQFSAFLNWAGQFLH |
| Ga0209068_100016214 | 3300027894 | Watersheds | MRDLMFMLAPVGLIIYFVVYPDQFSALVSWAGQYVH |
| Ga0209583_101991892 | 3300027910 | Watersheds | MRDLMFMLAPVALIIYFVVYPGQFSALLSWAGQFVH |
| Ga0209069_108324851 | 3300027915 | Watersheds | MRDLMFMLAPVALILYFLVYPGQFSALLSWAGQFVH |
| Ga0247822_101771721 | 3300028592 | Soil | MSVQGNPMRDAIFMLAPVALIIYFVAYPDQFSAFLNWAGQFLH |
| Ga0307503_101627633 | 3300028802 | Soil | MRDIIFMLAPIGLIIYFVVYPDQFNAFLSWAGQYVH |
| Ga0307498_100043922 | 3300031170 | Soil | MSARGYPMRDLMFMLAPVALIVYFVVYPDQFSSFVGWAGRLLH |
| Ga0170824_1149905146 | 3300031231 | Forest Soil | MSARGCPMQDLMFMLAPVALVVYFLVSPDQFSSFVGWAGRLLH |
| Ga0265325_1000009325 | 3300031241 | Rhizosphere | MRDSMFMLAPVALIIYFLIYPDQFNAFLAWAGQYLR |
| Ga0310886_100998503 | 3300031562 | Soil | CQRGGLPMRDLMFMLAPVALILYFVVYPDQFSSFVGWAGSLLH |
| Ga0310813_101849231 | 3300031716 | Soil | MRDLIFMLAPVAFIIYFVVYPEQFNAFVGWISHLLH |
| Ga0307468_1000205781 | 3300031740 | Hardwood Forest Soil | MRDAIFMLAPVALVIYFVAYPDQFSAFLNWAGQFIR |
| Ga0310916_107004341 | 3300031942 | Soil | VRGEEPVRDLMFMLAPVALVLYFVVFPDQFSAFLGWAGQYLH |
| Ga0310884_101001443 | 3300031944 | Soil | MSVQGNPMRDAIFMLGPVALVIYFVAYPDQFSAFLNWAGQFLH |
| Ga0307471_1019680032 | 3300032180 | Hardwood Forest Soil | NISARERPMRDLIFMLAPVALIIYFVVFPDQFGALLGWAGHYVH |
| Ga0310896_100009941 | 3300032211 | Soil | MSVQGNPMRDAIFMLAPVALVIYFVAYPDQFSAFLNWAGQFLR |
| Ga0335085_101483144 | 3300032770 | Soil | MRDLIFMVAPIGAAIYFLFYPDQFHAFLDWLMNLVG |
| Ga0335085_117241621 | 3300032770 | Soil | RDSMLMLVPVALIIYFLVYPDQFHALLAWAGQYLH |
| Ga0335082_1001343110 | 3300032782 | Soil | MRDSMLMLVPVALIIYFLVYPDQFHALLAWAGQYLH |
| Ga0335082_100624632 | 3300032782 | Soil | MRDLMFMLAPVALIIYFVVYPDQLSALISWASQYVH |
| Ga0335080_103705533 | 3300032828 | Soil | MRDIMFMLAPVAFVVYFLLYPDQFNAFLTWAGQYLH |
| Ga0335080_112112441 | 3300032828 | Soil | REGKPMRDLMFMLAPVALIIYFVVYPDQFSALLSWAGQYVH |
| Ga0335069_103913063 | 3300032893 | Soil | MRDLLFMLAPVALIIYFLIYPDQFSVFLAWARQLLH |
| Ga0335069_116470661 | 3300032893 | Soil | TARRLMRDLLFMLAPVALIIYFLIYPDQFSVFLAWARQLLH |
| Ga0335071_110438961 | 3300032897 | Soil | MRDLIMLLAPIALVFYFVVYPDQFSAFVYWASHLIG |
| Ga0335084_101344422 | 3300033004 | Soil | MRDAIFMLAPVALIVYFVAYPDQFSAFLNWAGKFLH |
| Ga0326726_100470244 | 3300033433 | Peat Soil | MRDLMFMLAPVALIIYFVVYPDQLSALISWAGQYVH |
| Ga0316624_1000003218 | 3300033486 | Soil | MRDWVLPVAPIALVVYFIVFPDQFSALLGWAADLMH |
| ⦗Top⦘ |