


| Basic Information | |
|---|---|
| Family ID | F050593 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 145 |
| Average Sequence Length | 44 residues |
| Representative Sequence | LTPAVLHKAIAAAPLLGKEQVLERLDELHARYVAAIDWP |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.38 % |
| % of genes near scaffold ends (potentially truncated) | 97.24 % |
| % of genes from short scaffolds (< 2000 bps) | 90.34 % |
| Associated GOLD sequencing projects | 109 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.60 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.483 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (24.138 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.034 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.345 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.79% β-sheet: 0.00% Coil/Unstructured: 58.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF01432 | Peptidase_M3 | 3.45 |
| PF08239 | SH3_3 | 3.45 |
| PF00248 | Aldo_ket_red | 0.69 |
| PF07992 | Pyr_redox_2 | 0.69 |
| PF13565 | HTH_32 | 0.69 |
| PF02233 | PNTB | 0.69 |
| PF08281 | Sigma70_r4_2 | 0.69 |
| PF14357 | DUF4404 | 0.69 |
| PF01565 | FAD_binding_4 | 0.69 |
| PF03372 | Exo_endo_phos | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG0339 | Zn-dependent oligopeptidase, M3 family | Posttranslational modification, protein turnover, chaperones [O] | 3.45 |
| COG1164 | Oligoendopeptidase F | Amino acid transport and metabolism [E] | 3.45 |
| COG1282 | NAD/NADP transhydrogenase beta subunit | Energy production and conversion [C] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.48 % |
| Unclassified | root | N/A | 25.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908007|FWIRElOz_GKZ9IRQ01AK4WC | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101446861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 581 | Open in IMG/M |
| 3300004101|Ga0058896_1431041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1129 | Open in IMG/M |
| 3300004152|Ga0062386_100105086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2173 | Open in IMG/M |
| 3300004631|Ga0058899_12234749 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300004635|Ga0062388_101055394 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 794 | Open in IMG/M |
| 3300004635|Ga0062388_102702563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 523 | Open in IMG/M |
| 3300005644|Ga0075036_1456068 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 660 | Open in IMG/M |
| 3300005944|Ga0066788_10082095 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 786 | Open in IMG/M |
| 3300005994|Ga0066789_10106418 | Not Available | 1203 | Open in IMG/M |
| 3300005995|Ga0066790_10282276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 708 | Open in IMG/M |
| 3300006173|Ga0070716_101264719 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300006174|Ga0075014_100886391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 533 | Open in IMG/M |
| 3300006176|Ga0070765_100867904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 853 | Open in IMG/M |
| 3300007265|Ga0099794_10031258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2492 | Open in IMG/M |
| 3300007265|Ga0099794_10804436 | Not Available | 503 | Open in IMG/M |
| 3300007788|Ga0099795_10000110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 13519 | Open in IMG/M |
| 3300009093|Ga0105240_10054469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 5013 | Open in IMG/M |
| 3300009500|Ga0116229_11507706 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300009525|Ga0116220_10149601 | Not Available | 1002 | Open in IMG/M |
| 3300009632|Ga0116102_1037607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1579 | Open in IMG/M |
| 3300009709|Ga0116227_10122285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2082 | Open in IMG/M |
| 3300009709|Ga0116227_11058808 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300009787|Ga0116226_10723697 | Not Available | 983 | Open in IMG/M |
| 3300010866|Ga0126344_1258036 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300011120|Ga0150983_10354586 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300011120|Ga0150983_10974927 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300011120|Ga0150983_11871465 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 577 | Open in IMG/M |
| 3300011120|Ga0150983_13237035 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300011269|Ga0137392_10122511 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2075 | Open in IMG/M |
| 3300011270|Ga0137391_10584073 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300011271|Ga0137393_10216322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → unclassified Bdellovibrionales → Bdellovibrionales bacterium RIFOXYB2_FULL_36_6 | 1620 | Open in IMG/M |
| 3300011271|Ga0137393_10493541 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300012363|Ga0137390_11676498 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 571 | Open in IMG/M |
| 3300012582|Ga0137358_10752299 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300012923|Ga0137359_11089802 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300012924|Ga0137413_11634883 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300012925|Ga0137419_10292191 | Not Available | 1243 | Open in IMG/M |
| 3300014165|Ga0181523_10396947 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300014167|Ga0181528_10698057 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300014491|Ga0182014_10497285 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300014501|Ga0182024_11695332 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300014657|Ga0181522_10549951 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300015068|Ga0167645_101258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3855 | Open in IMG/M |
| 3300015082|Ga0167662_1001801 | All Organisms → cellular organisms → Bacteria | 2555 | Open in IMG/M |
| 3300015193|Ga0167668_1004958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2955 | Open in IMG/M |
| 3300015193|Ga0167668_1036453 | Not Available | 1068 | Open in IMG/M |
| 3300015206|Ga0167644_1075765 | Not Available | 1084 | Open in IMG/M |
| 3300018014|Ga0187860_1065176 | Not Available | 1770 | Open in IMG/M |
| 3300018085|Ga0187772_10954718 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300019886|Ga0193727_1075116 | Not Available | 1035 | Open in IMG/M |
| 3300020199|Ga0179592_10000100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 36137 | Open in IMG/M |
| 3300020199|Ga0179592_10250025 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300020579|Ga0210407_10259902 | Not Available | 1353 | Open in IMG/M |
| 3300020579|Ga0210407_10747589 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300020579|Ga0210407_11275550 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300020580|Ga0210403_10978306 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300020580|Ga0210403_11039659 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300021086|Ga0179596_10102888 | Not Available | 1300 | Open in IMG/M |
| 3300021168|Ga0210406_10791427 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300021401|Ga0210393_11025730 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300021401|Ga0210393_11214680 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300021405|Ga0210387_10705098 | Not Available | 894 | Open in IMG/M |
| 3300021405|Ga0210387_10881649 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300021475|Ga0210392_10108733 | Not Available | 1837 | Open in IMG/M |
| 3300021479|Ga0210410_10961325 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300022506|Ga0242648_1046775 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300022530|Ga0242658_1106771 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 677 | Open in IMG/M |
| 3300022532|Ga0242655_10263135 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300022533|Ga0242662_10042197 | Not Available | 1147 | Open in IMG/M |
| 3300022711|Ga0242674_1028610 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300022715|Ga0242678_1046491 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300022720|Ga0242672_1016747 | Not Available | 970 | Open in IMG/M |
| 3300022721|Ga0242666_1027086 | Not Available | 1112 | Open in IMG/M |
| 3300022726|Ga0242654_10100255 | Not Available | 909 | Open in IMG/M |
| 3300022726|Ga0242654_10146622 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300022726|Ga0242654_10215327 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300022726|Ga0242654_10358856 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 550 | Open in IMG/M |
| 3300023101|Ga0224557_1297222 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300024249|Ga0247676_1066036 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300025474|Ga0208479_1034165 | Not Available | 1046 | Open in IMG/M |
| 3300025878|Ga0209584_10065900 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
| 3300025913|Ga0207695_10545756 | Not Available | 1041 | Open in IMG/M |
| 3300026281|Ga0209863_10072515 | Not Available | 1017 | Open in IMG/M |
| 3300026291|Ga0209890_10076879 | Not Available | 1186 | Open in IMG/M |
| 3300026557|Ga0179587_10000534 | All Organisms → cellular organisms → Bacteria | 15771 | Open in IMG/M |
| 3300027684|Ga0209626_1030568 | Not Available | 1314 | Open in IMG/M |
| 3300027737|Ga0209038_10047975 | Not Available | 1278 | Open in IMG/M |
| 3300027795|Ga0209139_10357789 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
| 3300027824|Ga0209040_10323625 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300027895|Ga0209624_10481333 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300027910|Ga0209583_10662778 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300028765|Ga0302198_10178432 | Not Available | 1069 | Open in IMG/M |
| 3300028775|Ga0302231_10114531 | Not Available | 1125 | Open in IMG/M |
| 3300028806|Ga0302221_10278125 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300029701|Ga0222748_1012371 | Not Available | 1132 | Open in IMG/M |
| 3300029701|Ga0222748_1085287 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300029883|Ga0311327_10782681 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 558 | Open in IMG/M |
| 3300029883|Ga0311327_10916649 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
| 3300029907|Ga0311329_10924496 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 546 | Open in IMG/M |
| 3300029910|Ga0311369_10898880 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300029913|Ga0311362_11322606 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300029922|Ga0311363_10671649 | Not Available | 992 | Open in IMG/M |
| 3300029953|Ga0311343_10286067 | Not Available | 1613 | Open in IMG/M |
| 3300029999|Ga0311339_10067773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4628 | Open in IMG/M |
| 3300030399|Ga0311353_10233528 | Not Available | 1712 | Open in IMG/M |
| 3300030507|Ga0302192_10025667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 3299 | Open in IMG/M |
| 3300030586|Ga0265393_1219338 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
| 3300030617|Ga0311356_10392343 | Not Available | 1372 | Open in IMG/M |
| 3300030617|Ga0311356_11348407 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300030738|Ga0265462_11621574 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300030739|Ga0302311_10971436 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300030741|Ga0265459_10199909 | Not Available | 1311 | Open in IMG/M |
| 3300030741|Ga0265459_12149181 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300030743|Ga0265461_11325586 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300030743|Ga0265461_12535453 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 605 | Open in IMG/M |
| 3300030841|Ga0075384_11245428 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300030863|Ga0265766_1013271 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300030885|Ga0265743_106993 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300030906|Ga0302314_11670982 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300030940|Ga0265740_1035607 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300030968|Ga0075376_11504468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 950 | Open in IMG/M |
| 3300031057|Ga0170834_100734829 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300031057|Ga0170834_108757775 | Not Available | 1072 | Open in IMG/M |
| 3300031057|Ga0170834_110198951 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300031128|Ga0170823_11741277 | Not Available | 1036 | Open in IMG/M |
| 3300031231|Ga0170824_121518901 | Not Available | 1119 | Open in IMG/M |
| 3300031231|Ga0170824_123240660 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300031236|Ga0302324_102089029 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300031236|Ga0302324_103180493 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300031469|Ga0170819_11168506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 955 | Open in IMG/M |
| 3300031474|Ga0170818_101841209 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300031474|Ga0170818_105024166 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300031525|Ga0302326_10170859 | All Organisms → cellular organisms → Bacteria | 3695 | Open in IMG/M |
| 3300031595|Ga0265313_10380272 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 556 | Open in IMG/M |
| 3300031708|Ga0310686_118674307 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300031715|Ga0307476_10278123 | Not Available | 1226 | Open in IMG/M |
| 3300031720|Ga0307469_10835557 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300031788|Ga0302319_10612347 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1130 | Open in IMG/M |
| 3300032515|Ga0348332_12159638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1296 | Open in IMG/M |
| 3300032515|Ga0348332_13502307 | Not Available | 1110 | Open in IMG/M |
| 3300032515|Ga0348332_14224595 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300032756|Ga0315742_10850571 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300032896|Ga0335075_10376908 | Not Available | 1525 | Open in IMG/M |
| 3300034282|Ga0370492_0340834 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 24.14% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.03% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 8.28% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 6.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.21% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 5.52% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.45% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 2.76% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 2.76% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.07% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 2.07% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.38% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.38% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.38% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.38% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.69% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.69% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.69% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.69% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.69% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.69% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.69% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.69% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.69% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.69% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.69% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.69% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908007 | Soil microbial communities from sample at FACE Site Metagenome WIR_ElevOz2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004101 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF228 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005644 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_053 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009500 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009709 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009787 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fa - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015068 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8C, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300015082 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11c, vegetated hydrological feature) | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300015206 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8B, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022711 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022715 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022720 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
| 3300024249 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17 | Environmental | Open in IMG/M |
| 3300025474 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028765 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030507 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300030586 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE041SO (Eukaryote Community Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
| 3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300030841 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030885 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300030940 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030968 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Host-Associated | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032756 | Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined Assembly | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FWIRElOz_05560410 | 2124908007 | Soil | FSFAPVAETARRALGPSVLRTVLASAPLLGKEQVLARLDELHARYVATIDWP |
| JGIcombinedJ26739_1014468611 | 3300002245 | Forest Soil | ENARRALTPDVLHKAIAAAPILGKDVVLAQLDALHSRYVAAIDWP* |
| Ga0058896_14310411 | 3300004101 | Forest Soil | RGLSPQVLQAAIAAAPLLGKELVLAHLDRLHARYVATVDLP* |
| Ga0062386_1001050864 | 3300004152 | Bog Forest Soil | PIAETARRALTPQVLAKALGAAALMGKDLVLGNLDELHARYVATVDLP* |
| Ga0058899_122347491 | 3300004631 | Forest Soil | ARRALGPSVLGAALASVSLMGKEQVLDRLDELHARYVAAIDWP* |
| Ga0062388_1010553941 | 3300004635 | Bog Forest Soil | PIAEKARQRLSPQILRNAIADAPLLGKDVVLGSLEQLHARYVATIDLP* |
| Ga0062388_1027025631 | 3300004635 | Bog Forest Soil | PIAETARRALSPKVLGAAIAAAPLLGKEEVLAHLDELHARYVATVDLP* |
| Ga0075036_14560681 | 3300005644 | Permafrost Soil | WHVSFAPIAEQARRNLSPALLHAAIAGAPLLGKDAVLARLDELHARYVTTIDLP* |
| Ga0066788_100820951 | 3300005944 | Soil | APIAENARRALNPAVLRAVIAAAPLLGKELILERLDELHQRYIAQVDLP* |
| Ga0066789_101064182 | 3300005994 | Soil | SVLHAAIAGAPLLGKEVVLARLDELHARYVATVDFP* |
| Ga0066790_102822761 | 3300005995 | Soil | RRALTPELLRGALEQAPLLGKEHVLQRLDELHARYVASIDWP* |
| Ga0070716_1012647192 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LSPAVLHAALTAAPLLGKEHVLARLEELHARFVAAIDWP* |
| Ga0075014_1008863911 | 3300006174 | Watersheds | ARRNLSPKVLHAAISAAPLLGKELVLAHLDELHERYVATIDLP* |
| Ga0070765_1008679042 | 3300006176 | Soil | SFAPIAETARRLLSPQVLRTALAGAPLLGKEVVLGSLDELHARYVATIDLP* |
| Ga0099794_100312584 | 3300007265 | Vadose Zone Soil | LHKAIATAPLFGKEQVLARLDELHARYVAAIDWP* |
| Ga0099794_108044362 | 3300007265 | Vadose Zone Soil | SFAPVAENARRSLTPAVLHKAIAAAPLLGKEQVLGRLDELHARYVAAIDWP* |
| Ga0099795_1000011015 | 3300007788 | Vadose Zone Soil | ENARRSLTPAVLHKAIAAAPLLGKEQVLGRLDELHARYVAAIDWP* |
| Ga0105240_100544696 | 3300009093 | Corn Rhizosphere | AEGARRSLSAAVLHRAIAAAPLLGKEQVLARLEELHARYVAAIDWP* |
| Ga0116229_115077062 | 3300009500 | Host-Associated | RQLTPAVLKAALESAPMLGKELVLARLDELHARYVAAIDLP* |
| Ga0116220_101496012 | 3300009525 | Peatlands Soil | VAESARRALNASVLRAAIATAPLMGKEHVMARLDELHAHYLSAIDWP* |
| Ga0116102_10376073 | 3300009632 | Peatland | VSEFARRQLTVAVLREAIAAAPLLGKEDVLRDLAEHHARYVATIDWP* |
| Ga0116227_101222853 | 3300009709 | Host-Associated | RQLTPAVLKAALESAPMLGKELVLERLDELHARYVAAIDLP* |
| Ga0116227_110588082 | 3300009709 | Host-Associated | DILRAAIEAAPLLGKELVLARLEELHQRFVARIDQP* |
| Ga0116226_107236971 | 3300009787 | Host-Associated | EIARRKLSPGVLADALAGAPLEGKVEVMERLDELHARYVAAIDWP* |
| Ga0126344_12580362 | 3300010866 | Boreal Forest Soil | VLRSAIAGAPLLGKEIVLARLDELHARYVAAIDWP* |
| Ga0150983_103545861 | 3300011120 | Forest Soil | RRLSPDVLRTAIAAAPLLGKDMVLAHLDELHARYVATIDLP* |
| Ga0150983_109749271 | 3300011120 | Forest Soil | RHFSFAPIAENARRSLSLGVLREAIGPSPLQGKDQVFARLDELHARYVAAIDWP* |
| Ga0150983_118714651 | 3300011120 | Forest Soil | VLREAIGASALLGKDQVLARLDELHACYVAAIDWP* |
| Ga0150983_132370351 | 3300011120 | Forest Soil | ETARRALGPSVLGAALASVSLMGKEQVLDRLDELHARYVAAIDWP* |
| Ga0137392_101225111 | 3300011269 | Vadose Zone Soil | LTPAVLHKAIAAAPLLGKEQVLGRLDELHARYVAAIDWP* |
| Ga0137391_105840732 | 3300011270 | Vadose Zone Soil | APVAENARRSLTPAVLHKAISVAPLLGKEQVLERLDELHAHYVAAIDWP* |
| Ga0137393_102163223 | 3300011271 | Vadose Zone Soil | ENARRALTPGVLHKAIAAAPLLGKEQVLARLDELHARYVANIDWP* |
| Ga0137393_104935412 | 3300011271 | Vadose Zone Soil | FSFAPLAENARRRLTPAVLRKAIAAAPLLGKELVLERLDELHARYVAAIDWP* |
| Ga0137390_116764981 | 3300012363 | Vadose Zone Soil | PAVLHKAISAAPLLGKEQVLERLDDLHARYVAAIDWP* |
| Ga0137358_107522991 | 3300012582 | Vadose Zone Soil | LTPAVLHKAIAAAPLLGKEQVLERLDELHARYVAAIDWP* |
| Ga0137359_110898021 | 3300012923 | Vadose Zone Soil | SLTPAVLHKAIAAAPLLGKEQVLGRLDELHARYVAAIDWP* |
| Ga0137413_116348831 | 3300012924 | Vadose Zone Soil | VLQAALAAAPLLGKEPVLGRLEELHSRYVAAIDWP* |
| Ga0137419_102921912 | 3300012925 | Vadose Zone Soil | LTPAVLHKAIAAAPLLGKEQVLERLGELHGRYVAAIDWP* |
| Ga0181523_103969472 | 3300014165 | Bog | PVSEFARRQLTVAVLREAIAAAPLLGKEDVLRDLAEHHARYVATIDWP* |
| Ga0181528_106980571 | 3300014167 | Bog | VLQRAIAAAPLLGKDEVLGQLDALHARYVANIDWP* |
| Ga0182014_104972852 | 3300014491 | Bog | WHFSFAPVAESARRALNASVLRAALAAAPLMGKEHVMARLDELHARYVSAIDWP* |
| Ga0182024_116953322 | 3300014501 | Permafrost | ARRRLSPQVLRNAIAGAPLLGKEIVLEHLDELHARFVATIDLP* |
| Ga0181522_105499512 | 3300014657 | Bog | APVAETARRDLTPAVLQRAIAAAPLLGKDEVLGQLDALHARYVANIDWP* |
| Ga0167645_1012584 | 3300015068 | Glacier Forefield Soil | KARRGLSPAVLHAAIAGAPLLGKEAVLARLDELHARYVARIDLP* |
| Ga0167662_10018012 | 3300015082 | Glacier Forefield Soil | VLHGAITAAPLLGKEEVLARLDELHARYVEAIDWP* |
| Ga0167668_10049581 | 3300015193 | Glacier Forefield Soil | AETARRALSPSVLKDALASVHLKGKEHVLARLDELHGRYVAAIDWP* |
| Ga0167668_10364532 | 3300015193 | Glacier Forefield Soil | SFAPVAETARRALSPAVLHKAIAAAPLLGKEEVLARLDELHARYVAAIDWP* |
| Ga0167644_10757651 | 3300015206 | Glacier Forefield Soil | SFAPIAETARRRLSPQVLRTALDGAPLLGKEVVLDSLDELHARYVATIDLP* |
| Ga0187860_10651761 | 3300018014 | Peatland | NASVLRAALAAAPLMGKEHVMARLDELHAHYVSAIDWP |
| Ga0187772_109547182 | 3300018085 | Tropical Peatland | HFSFAPVAENARRFLSPGMLRDALSEAPLLGREHVLERLDELHARYVASIDWP |
| Ga0193727_10751161 | 3300019886 | Soil | APIAEKARRSLGPAVLRAAIAGAPLLGKEAVLARLDELHARYVATIDLP |
| Ga0179592_100001001 | 3300020199 | Vadose Zone Soil | SLSPAVLRAAIDGAALLGKEAVLARLDELHARYVARIDLP |
| Ga0179592_102500251 | 3300020199 | Vadose Zone Soil | RQLTPGVLHKAVAAAPLLGKALVLARLEELHARYVAAIDWP |
| Ga0210407_102599021 | 3300020579 | Soil | RRALGPSVLRDALASADLKGKEHVLNRLDELHARYVAAIDWP |
| Ga0210407_107475892 | 3300020579 | Soil | PSVLRSAIAGAPLLGKEIVLARLDELHARYVAAIDWP |
| Ga0210407_112755502 | 3300020579 | Soil | LTPAVLHKAIAAAPLLGKTEVLDRLEEMHARYVAAIDWP |
| Ga0210403_109783062 | 3300020580 | Soil | PPAVLHKAIAAAPLLGKDHVLARLDELHARYVAAIDWP |
| Ga0210403_110396592 | 3300020580 | Soil | APIAELARRALSPTVLRTAIAAAPLLGKELVLEHLDELHARYVATIDLP |
| Ga0179596_101028882 | 3300021086 | Vadose Zone Soil | FSFAPVAETARRALSPSVLQAALNAAPLEGKDHVMSRLDELHARYVAAIDWP |
| Ga0210406_107914273 | 3300021168 | Soil | RRDLSPAVLRAALADAPLSGKEAVLARLDELHARYVARIDLP |
| Ga0210393_110257301 | 3300021401 | Soil | NLSPSVLRSAIAGAPLLGKEIVLARLDELHARYVAAIDWP |
| Ga0210393_112146801 | 3300021401 | Soil | SFAPIAENARRRLTPGVLHRVIAAAPLLGKDVVLARLDELHARYVAAIDWP |
| Ga0210387_107050981 | 3300021405 | Soil | RSLSPAVLRKAIAAAPLLGKDEVLERLDDLHARYVAAIDWP |
| Ga0210387_108816491 | 3300021405 | Soil | SFAPVAENARRALTPAVLRKAIDTAPILGKQELLAQLDTLHERYVAAIDWP |
| Ga0210392_101087331 | 3300021475 | Soil | SFAPIAEKARQNLSPSVLRSAIAGAPLLGKEIVLARLDELHARYVAAIDWP |
| Ga0210410_109613251 | 3300021479 | Soil | QVLRAAIAAAPLLGKELVLAHLDELHARYVATIDLP |
| Ga0242648_10467751 | 3300022506 | Soil | VGVLHEAIAAAPLLGKAQVLERIEALHARYVAKIDWP |
| Ga0242658_11067711 | 3300022530 | Soil | EGARRQLTAGVLHEAIAAAPLLGKAQVLERLEVLHAHYVAKIDWP |
| Ga0242655_102631352 | 3300022532 | Soil | AVLHKAIAAAPLLGKEQVLERIDELHARYVAAIDWP |
| Ga0242662_100421972 | 3300022533 | Soil | FSFAPVAESARRNLSAAVLREAVATAPLLGKNEVLARLDELHARYVVKIDWP |
| Ga0242674_10286101 | 3300022711 | Soil | TVLRTAIAAAPLLGKELVLEHLDELHARYVATIDLP |
| Ga0242678_10464912 | 3300022715 | Soil | LSPSVLRTAIVAAPLLGKELVLEHLDELHARYVATIDLP |
| Ga0242672_10167471 | 3300022720 | Soil | PKVLQAAIATAPLLGKEHVLEHLDALHARYVAAIDLP |
| Ga0242666_10270861 | 3300022721 | Soil | RALSPSVLRTAIVAAPLLGKELVLEHLDELHARYVATIDLP |
| Ga0242654_101002552 | 3300022726 | Soil | HFSFAPIAEQARRRLSPDVLRAAITAAPLLGKDVVLCHLDELHGRYVATIDLP |
| Ga0242654_101466221 | 3300022726 | Soil | AVLRAAIAGAPLLGKEAVLERLDELHARYVARIDLP |
| Ga0242654_102153271 | 3300022726 | Soil | APIAENARRRLTAGVLHQAIAAAPLLGKDAVLARLDELHARYVAAIDWP |
| Ga0242654_103588561 | 3300022726 | Soil | RCLTPAVLYKAIAAAPLLGKEEVFARLDELHARYVGAIDWP |
| Ga0224557_12972221 | 3300023101 | Soil | HYSFAPVAENARRALTPAVLRAAIAAAPLLGKEQVLERVDELHDRYVAAIDWP |
| Ga0247676_10660362 | 3300024249 | Soil | AVLHAALTAAPLLGKEHVLARLEELHARFVAAIDWP |
| Ga0208479_10341652 | 3300025474 | Arctic Peat Soil | SEFARRQLTLAVLREALATAPLLGQDEVLANLAQHHARYVATIDWP |
| Ga0209584_100659002 | 3300025878 | Arctic Peat Soil | LSPDVLQRAIAEAPLLGKEEVLARLDELHARYVAAIDWP |
| Ga0207695_105457561 | 3300025913 | Corn Rhizosphere | SFAPIAEGARRSLSTAVLHRAIAAAPLLGKEQVLARLEELHARYVAAIDWP |
| Ga0209863_100725151 | 3300026281 | Prmafrost Soil | AVLRKALTAAPILGKEHVLRRLEELHARYVAAIDWP |
| Ga0209890_100768792 | 3300026291 | Soil | SVLHAAIAGAPLLGKEVVLARLDELHARYVATVDFP |
| Ga0179587_100005341 | 3300026557 | Vadose Zone Soil | GSLSPAVLRAAIDGAALLGKEAVLARLDELHARYVARIDLP |
| Ga0209626_10305681 | 3300027684 | Forest Soil | GVLHKAVAAAPLLGKALVLARLDELHARYVAAIDWP |
| Ga0209038_100479752 | 3300027737 | Bog Forest Soil | ARRALSPKVLRAAIAAAPLLGKELVLAHLDELHARYVATIDLP |
| Ga0209139_103577891 | 3300027795 | Bog Forest Soil | FSFAPVAENARRSLSPAVLYQAIAAAPLFGKAEVLAGLDALHARYVDSIDWP |
| Ga0209040_103236251 | 3300027824 | Bog Forest Soil | VLQKAIAATPLLGKAEVLERLDELHARYVAAVDWP |
| Ga0209624_104813332 | 3300027895 | Forest Soil | CSFAPIAEKARRNLSAKVLRASIESAPLLGKDAVLARLDELHARYVETIDLP |
| Ga0209583_106627781 | 3300027910 | Watersheds | FSFAPVAETARRALGPSVLRAALASASLMGKEHVLARLDELHARYVTAIDWP |
| Ga0302198_101784322 | 3300028765 | Bog | AVLYKVIDAAPLLGKEQVLSRLDALHARYVASIDWP |
| Ga0302231_101145312 | 3300028775 | Palsa | PIAEKARQRLSPEVLRNAIAGAPLLGKEVVLGSLDELHARYVATIDLP |
| Ga0302221_102781252 | 3300028806 | Palsa | EVLRNAIAGAPLLGKEVVLGSLDELHARYVATIDLP |
| Ga0222748_10123711 | 3300029701 | Soil | ETARRALGPSVLGTALASVSLMGKEQVLARLDELHARYVAAIDWP |
| Ga0222748_10852872 | 3300029701 | Soil | RALSPTVLRTAIAAAPLLGKELVLEHLDELHARYVATIDLP |
| Ga0311327_107826812 | 3300029883 | Bog | APIAVQAHRELTPVLLETVLRAAPLQGKEYVLARLDDLHARYVAAIDWP |
| Ga0311327_109166492 | 3300029883 | Bog | FSFAPVAENARRDLCPAVLYKVIDAAPLLGKEQVLSRLDALHARYVASIDWP |
| Ga0311329_109244962 | 3300029907 | Bog | FAPVAESARRDLTPEVLRTALDCAPLLGKEHVLAQLDELHARFVASIDWP |
| Ga0311369_108988801 | 3300029910 | Palsa | VLRAAISAAPLLGKEMVLARLDELHERYIATIDLP |
| Ga0311362_113226062 | 3300029913 | Bog | RALNVAVLRGALEQAPLLGKDSVMERIDELHARFVAAIDWP |
| Ga0311363_106716492 | 3300029922 | Fen | LKPAVLRETLEGATLSGKEQVLERLDELHARYVAAIDWP |
| Ga0311343_102860673 | 3300029953 | Bog | PVAESARRDLTPEVLRTALDCAPLLGKEHVLAQLDELHARFVASIDWP |
| Ga0311339_100677735 | 3300029999 | Palsa | ENARRDLTPEVLRSALASAALLGKQQVLAQLDELHARFVTSIDWP |
| Ga0311353_102335283 | 3300030399 | Palsa | WHFSFAPIAEKARQRLSPEVLRNAIAGAPLLGKEVVLGSLDELHARYVATIDLP |
| Ga0302192_100256671 | 3300030507 | Bog | PSLLEAALADAPLLGKEFVMGRLDELHARYVAAIDWP |
| Ga0265393_12193381 | 3300030586 | Soil | KVLRTAIAAAPLLGKELVLAHLDELHARYVATIDLP |
| Ga0311356_103923431 | 3300030617 | Palsa | LALSPQVLRAAISAAPLLGKEMVLARLDELHERYIATIDLP |
| Ga0311356_113484071 | 3300030617 | Palsa | APTAEKARLALSVPVLREAISAAPLLGKELVLARLDELHERYVASIDLP |
| Ga0265462_116215742 | 3300030738 | Soil | LYNFFLYFLSFFARRHLSPAVLRAAIADAPLLGKEAVLARLDELHARYVATIDLP |
| Ga0302311_109714362 | 3300030739 | Palsa | ENARRALSTAVLHKAIAAAPLLGKDQVLARLAELHSRYVASIDWP |
| Ga0265459_101999091 | 3300030741 | Soil | WHYSFAPVAEKARGDLTPEVLRTALASAALLGKEQVLAQLDELHARFVASIDWP |
| Ga0265459_121491812 | 3300030741 | Soil | IAEKARQRLSPQVLRTAIAGAPLLGKEVVLENLDELHARYVAAIDLP |
| Ga0265461_113255861 | 3300030743 | Soil | RALTPAVLHKVIAAAPLLGKIEVLARLEELHARYVAAIDWP |
| Ga0265461_125354532 | 3300030743 | Soil | LVLSVLCFMSFLPIAELARRALSPKVLRTAIAAAPLLGKELVLAHLDELHARYVATIDLP |
| Ga0075384_112454281 | 3300030841 | Soil | PARRDLRPEVLHAAVSAAPLLGKEVVMEHIDELHARYVATVDLP |
| Ga0265766_10132712 | 3300030863 | Soil | FSFAPIAERARRRLSSQVLRDAIAAAPLLGKDEVLESLDELHARYVATIDLPC |
| Ga0265743_1069932 | 3300030885 | Soil | EKARRNLNPAVLRAAIAGAPLLGKEAVLARLDELHARYVATIDLP |
| Ga0302314_116709822 | 3300030906 | Palsa | ARRRLSAQVLRNAIEAAPLLGKDEVLESLDELHARYVAAIDLP |
| Ga0265740_10356072 | 3300030940 | Soil | QAAPESADMRNAIAAAPLLGKEVVLGSLDQLHARYVATIDLP |
| Ga0075376_115044682 | 3300030968 | Soil | PSVLQAVLASAPLMGKELVLARLDELHARYVAAIDWP |
| Ga0170834_1007348291 | 3300031057 | Forest Soil | VAETARRRLSPQVLRNALVDAPLLGKEVVLDRLEELHARYVATIDLP |
| Ga0170834_1087577752 | 3300031057 | Forest Soil | LCCPSVLRNALASAELKGKEHVLNRLDELHARYVAAIDWP |
| Ga0170834_1101989511 | 3300031057 | Forest Soil | AENARRALRPAVLRKALEESPLLGKDEVLARLDALHARYVAAIDWP |
| Ga0170823_117412772 | 3300031128 | Forest Soil | HFSFAPVAESARRSLSPAVLHEAIAAAPLLGKDEVLKRLDELHARYVAAIDWP |
| Ga0170824_1215189011 | 3300031231 | Forest Soil | HFSFAPVAESARRSLSPAVLHEAIAAAPLLGKDEVLERLESLHARYVAAIDWP |
| Ga0170824_1232406602 | 3300031231 | Forest Soil | VLKEALASAPLMGKEHVLARLDELHARYVAAIDWP |
| Ga0302324_1020890291 | 3300031236 | Palsa | LKPAVLRKAIAAAPLLGKEQVLARLDELHARYVGSIDWP |
| Ga0302324_1031804932 | 3300031236 | Palsa | LSTAVLHKAIAAAPLLGKDQVLARLAELHSRYVASIDWP |
| Ga0170819_111685061 | 3300031469 | Forest Soil | DPSVLQAVLASAPLMGKELVLARLDELHARYVAAIDWP |
| Ga0170818_1018412091 | 3300031474 | Forest Soil | ENARRTLSPAVLHAALTAAPLLGKEHVLPRLEELHARFVAAIDWP |
| Ga0170818_1050241662 | 3300031474 | Forest Soil | LTVLQAAIMAAPLLGKEIVLARIAELHARYVAAIDLP |
| Ga0302326_101708591 | 3300031525 | Palsa | PVAEKARGDLTPEVLRTALASAALLGKEQVLARLDELHARFVASIDWP |
| Ga0265313_103802721 | 3300031595 | Rhizosphere | AEFARLELTPAVLRTAIDSAPMLGRNEVIARLEELHARYVAAIDWP |
| Ga0310686_1186743071 | 3300031708 | Soil | RSLSAGVLHAALASAPLLGRVQVLARIDELHARYVASIDWP |
| Ga0307476_102781232 | 3300031715 | Hardwood Forest Soil | ALSPAVLHKAIAAAPLLGKDAVLARLDGLHARYVAAIDWP |
| Ga0307469_108355571 | 3300031720 | Hardwood Forest Soil | ENARRSLSPAVLHGALAAAPLLGKEHVLPRLEELHARFVAAIDWP |
| Ga0302319_106123471 | 3300031788 | Bog | RDLCPAELYKVIDAAPLLGKEQVLSRLDALHARYVASIDWP |
| Ga0348332_121596381 | 3300032515 | Plant Litter | AEKARQRLTPQVLRSAIAGAPLLGKDVVLEHLEELHARYVAAIDLP |
| Ga0348332_135023071 | 3300032515 | Plant Litter | AVLYKALEAAPLLGKEQVLAQLDALHGRYVASIDWP |
| Ga0348332_142245952 | 3300032515 | Plant Litter | SPQILRNAIAAAPLLGKEVVLGSLDQLHARYVATIDLP |
| Ga0315742_108505712 | 3300032756 | Forest Soil | EKARRHLSPAVLRSAIAAAPLLGKEIVLARLDELHARYVAAIDWP |
| Ga0335075_103769082 | 3300032896 | Soil | FAPVAEPARRRLTPAVLRDTLAAAPVAGKPAILSRIEDLHARYVASIDWP |
| Ga0370492_0340834_1_120 | 3300034282 | Untreated Peat Soil | LSPAVLNKAIAAAPLLGKEEVLARLDELHARYVANIDWP |
| ⦗Top⦘ |