


| Basic Information | |
|---|---|
| Family ID | F050584 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 145 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MESIISNLLSRFEKGSLSRRELVQGLAMLAASGTAASAQEDI |
| Number of Associated Samples | 127 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.31 % |
| % of genes from short scaffolds (< 2000 bps) | 91.72 % |
| Associated GOLD sequencing projects | 124 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.759 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.172 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.586 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.207 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF03401 | TctC | 4.83 |
| PF01925 | TauE | 2.76 |
| PF01425 | Amidase | 2.76 |
| PF02424 | ApbE | 2.07 |
| PF16884 | ADH_N_2 | 2.07 |
| PF00166 | Cpn10 | 2.07 |
| PF10282 | Lactonase | 2.07 |
| PF00106 | adh_short | 1.38 |
| PF04392 | ABC_sub_bind | 1.38 |
| PF14246 | TetR_C_7 | 1.38 |
| PF02633 | Creatininase | 1.38 |
| PF02371 | Transposase_20 | 1.38 |
| PF12833 | HTH_18 | 1.38 |
| PF13683 | rve_3 | 0.69 |
| PF00753 | Lactamase_B | 0.69 |
| PF07883 | Cupin_2 | 0.69 |
| PF09926 | DUF2158 | 0.69 |
| PF01047 | MarR | 0.69 |
| PF13193 | AMP-binding_C | 0.69 |
| PF10518 | TAT_signal | 0.69 |
| PF06262 | Zincin_1 | 0.69 |
| PF13328 | HD_4 | 0.69 |
| PF04307 | YdjM | 0.69 |
| PF13458 | Peripla_BP_6 | 0.69 |
| PF00847 | AP2 | 0.69 |
| PF01979 | Amidohydro_1 | 0.69 |
| PF03797 | Autotransporter | 0.69 |
| PF13489 | Methyltransf_23 | 0.69 |
| PF12680 | SnoaL_2 | 0.69 |
| PF00903 | Glyoxalase | 0.69 |
| PF00696 | AA_kinase | 0.69 |
| PF03824 | NicO | 0.69 |
| PF00118 | Cpn60_TCP1 | 0.69 |
| PF12796 | Ank_2 | 0.69 |
| PF13180 | PDZ_2 | 0.69 |
| PF13570 | PQQ_3 | 0.69 |
| PF13620 | CarboxypepD_reg | 0.69 |
| PF08818 | DUF1801 | 0.69 |
| PF13360 | PQQ_2 | 0.69 |
| PF11799 | IMS_C | 0.69 |
| PF01926 | MMR_HSR1 | 0.69 |
| PF02388 | FemAB | 0.69 |
| PF00330 | Aconitase | 0.69 |
| PF00082 | Peptidase_S8 | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 4.83 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 2.76 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 2.76 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 2.07 |
| COG1477 | FAD:protein FMN transferase ApbE | Posttranslational modification, protein turnover, chaperones [O] | 2.07 |
| COG1402 | Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis) | Coenzyme transport and metabolism [H] | 1.38 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.38 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.38 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.69 |
| COG1988 | Membrane-bound metal-dependent hydrolase YbcI, DUF457 family | General function prediction only [R] | 0.69 |
| COG2348 | Lipid II:glycine glycyltransferase (Peptidoglycan interpeptide bridge formation enzyme) | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
| COG3824 | Predicted Zn-dependent protease, minimal metalloprotease (MMP)-like domain | Posttranslational modification, protein turnover, chaperones [O] | 0.69 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.69 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.69 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.76 % |
| Unclassified | root | N/A | 37.24 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2032320005|FACEOR_FY84VJD01D4DEE | Not Available | 507 | Open in IMG/M |
| 3300004267|Ga0066396_10012412 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1043 | Open in IMG/M |
| 3300004633|Ga0066395_10010742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3381 | Open in IMG/M |
| 3300004779|Ga0062380_10142915 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300005175|Ga0066673_10615912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300005184|Ga0066671_10106949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → unclassified Devosia → Devosia sp. | 1562 | Open in IMG/M |
| 3300005332|Ga0066388_102684388 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 908 | Open in IMG/M |
| 3300005332|Ga0066388_107670466 | Not Available | 541 | Open in IMG/M |
| 3300005436|Ga0070713_100782673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 914 | Open in IMG/M |
| 3300005455|Ga0070663_101916794 | Not Available | 532 | Open in IMG/M |
| 3300005531|Ga0070738_10091586 | All Organisms → cellular organisms → Bacteria | 1656 | Open in IMG/M |
| 3300005552|Ga0066701_10349858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 915 | Open in IMG/M |
| 3300005559|Ga0066700_10576207 | Not Available | 785 | Open in IMG/M |
| 3300005559|Ga0066700_11040397 | Not Available | 537 | Open in IMG/M |
| 3300005610|Ga0070763_10569271 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 654 | Open in IMG/M |
| 3300005764|Ga0066903_104786531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300005764|Ga0066903_107129005 | Not Available | 579 | Open in IMG/M |
| 3300005921|Ga0070766_11239300 | Not Available | 516 | Open in IMG/M |
| 3300005983|Ga0081540_1033336 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2798 | Open in IMG/M |
| 3300006041|Ga0075023_100301080 | Not Available | 660 | Open in IMG/M |
| 3300006052|Ga0075029_100971548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 585 | Open in IMG/M |
| 3300006174|Ga0075014_100043399 | Not Available | 1895 | Open in IMG/M |
| 3300006358|Ga0068871_101178166 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
| 3300007076|Ga0075435_100930876 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 758 | Open in IMG/M |
| 3300009147|Ga0114129_11973486 | Not Available | 706 | Open in IMG/M |
| 3300009524|Ga0116225_1301049 | Not Available | 716 | Open in IMG/M |
| 3300009609|Ga0105347_1287105 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 687 | Open in IMG/M |
| 3300009700|Ga0116217_10878087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300009792|Ga0126374_10793574 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 723 | Open in IMG/M |
| 3300009792|Ga0126374_11186779 | Not Available | 610 | Open in IMG/M |
| 3300010046|Ga0126384_10358923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1217 | Open in IMG/M |
| 3300010047|Ga0126382_10971147 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300010358|Ga0126370_10003675 | All Organisms → cellular organisms → Bacteria | 7469 | Open in IMG/M |
| 3300010358|Ga0126370_11067858 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300010359|Ga0126376_13269552 | Not Available | 501 | Open in IMG/M |
| 3300010360|Ga0126372_10967019 | Not Available | 860 | Open in IMG/M |
| 3300010361|Ga0126378_10326777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1641 | Open in IMG/M |
| 3300010362|Ga0126377_11237835 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
| 3300010362|Ga0126377_11934267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga aerophila | 666 | Open in IMG/M |
| 3300010362|Ga0126377_12291845 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_19FT_COMBO_55_12 | 616 | Open in IMG/M |
| 3300010366|Ga0126379_11945619 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300010376|Ga0126381_101555303 | Not Available | 956 | Open in IMG/M |
| 3300010398|Ga0126383_11221401 | Not Available | 842 | Open in IMG/M |
| 3300010864|Ga0126357_1302885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 503 | Open in IMG/M |
| 3300011269|Ga0137392_11258864 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 598 | Open in IMG/M |
| 3300011403|Ga0137313_1020520 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300011445|Ga0137427_10424230 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300012202|Ga0137363_11479472 | Not Available | 570 | Open in IMG/M |
| 3300012206|Ga0137380_11757503 | Not Available | 504 | Open in IMG/M |
| 3300012208|Ga0137376_11673672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 527 | Open in IMG/M |
| 3300012210|Ga0137378_10068649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 3214 | Open in IMG/M |
| 3300012211|Ga0137377_11276577 | Not Available | 664 | Open in IMG/M |
| 3300012232|Ga0137435_1017425 | All Organisms → cellular organisms → Bacteria | 2037 | Open in IMG/M |
| 3300012349|Ga0137387_10926727 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300012361|Ga0137360_10835021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 793 | Open in IMG/M |
| 3300012361|Ga0137360_11823428 | Not Available | 514 | Open in IMG/M |
| 3300012685|Ga0137397_10176579 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1586 | Open in IMG/M |
| 3300012685|Ga0137397_11081970 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300012685|Ga0137397_11097039 | Not Available | 580 | Open in IMG/M |
| 3300012917|Ga0137395_10616696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 784 | Open in IMG/M |
| 3300012922|Ga0137394_10523701 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1006 | Open in IMG/M |
| 3300012923|Ga0137359_11353292 | Not Available | 600 | Open in IMG/M |
| 3300012924|Ga0137413_10348303 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → Candidatus Methylomirabilis → Candidatus Methylomirabilis limnetica | 1050 | Open in IMG/M |
| 3300012924|Ga0137413_10922811 | Not Available | 679 | Open in IMG/M |
| 3300012924|Ga0137413_11188343 | Not Available | 607 | Open in IMG/M |
| 3300012929|Ga0137404_11879186 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300012930|Ga0137407_11222317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas citri group → Xanthomonas citri | 713 | Open in IMG/M |
| 3300012948|Ga0126375_11679231 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 550 | Open in IMG/M |
| 3300012971|Ga0126369_10008292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7856 | Open in IMG/M |
| 3300012972|Ga0134077_10115000 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1052 | Open in IMG/M |
| 3300012986|Ga0164304_11330346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300013296|Ga0157374_10297047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1597 | Open in IMG/M |
| 3300014501|Ga0182024_10378873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1838 | Open in IMG/M |
| 3300014501|Ga0182024_10702338 | Not Available | 1248 | Open in IMG/M |
| 3300014879|Ga0180062_1075862 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 746 | Open in IMG/M |
| 3300014883|Ga0180086_1116563 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300014969|Ga0157376_13125617 | Not Available | 501 | Open in IMG/M |
| 3300015242|Ga0137412_11037126 | Not Available | 585 | Open in IMG/M |
| 3300015245|Ga0137409_10956415 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 693 | Open in IMG/M |
| 3300015372|Ga0132256_103873368 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300015374|Ga0132255_103091258 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 710 | Open in IMG/M |
| 3300016294|Ga0182041_11237791 | Not Available | 681 | Open in IMG/M |
| 3300016319|Ga0182033_10613708 | Not Available | 946 | Open in IMG/M |
| 3300016357|Ga0182032_10150311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1722 | Open in IMG/M |
| 3300016357|Ga0182032_10361560 | Not Available | 1164 | Open in IMG/M |
| 3300016387|Ga0182040_10467049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1003 | Open in IMG/M |
| 3300017965|Ga0190266_10923883 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300017970|Ga0187783_10055443 | All Organisms → cellular organisms → Bacteria | 2922 | Open in IMG/M |
| 3300017970|Ga0187783_10411007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 983 | Open in IMG/M |
| 3300017975|Ga0187782_10403436 | Not Available | 1039 | Open in IMG/M |
| 3300018000|Ga0184604_10138499 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300018000|Ga0184604_10143139 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 782 | Open in IMG/M |
| 3300018079|Ga0184627_10623097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 539 | Open in IMG/M |
| 3300019377|Ga0190264_10112836 | Not Available | 1308 | Open in IMG/M |
| 3300020018|Ga0193721_1102776 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300020063|Ga0180118_1177716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1858 | Open in IMG/M |
| 3300020581|Ga0210399_10386938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1167 | Open in IMG/M |
| 3300021384|Ga0213876_10029224 | All Organisms → cellular organisms → Bacteria | 2906 | Open in IMG/M |
| 3300021388|Ga0213875_10380163 | Not Available | 672 | Open in IMG/M |
| 3300021406|Ga0210386_10648818 | Not Available | 911 | Open in IMG/M |
| 3300021420|Ga0210394_11642979 | Not Available | 540 | Open in IMG/M |
| 3300021432|Ga0210384_10923178 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300021474|Ga0210390_10528103 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300021478|Ga0210402_10487943 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300021478|Ga0210402_10899597 | Not Available | 812 | Open in IMG/M |
| 3300024325|Ga0247678_1077984 | Not Available | 552 | Open in IMG/M |
| 3300025907|Ga0207645_10667375 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300025916|Ga0207663_11021093 | Not Available | 664 | Open in IMG/M |
| 3300025917|Ga0207660_10695517 | Not Available | 829 | Open in IMG/M |
| 3300025926|Ga0207659_10622891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 921 | Open in IMG/M |
| 3300025929|Ga0207664_11798685 | Not Available | 535 | Open in IMG/M |
| 3300026319|Ga0209647_1334609 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 512 | Open in IMG/M |
| 3300026552|Ga0209577_10825457 | Not Available | 519 | Open in IMG/M |
| 3300027669|Ga0208981_1125710 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300027716|Ga0209682_10003182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4667 | Open in IMG/M |
| 3300027826|Ga0209060_10366181 | Not Available | 656 | Open in IMG/M |
| 3300027873|Ga0209814_10363535 | Not Available | 634 | Open in IMG/M |
| 3300027898|Ga0209067_10813521 | Not Available | 546 | Open in IMG/M |
| 3300027907|Ga0207428_10786706 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300027908|Ga0209006_10620720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 891 | Open in IMG/M |
| 3300031543|Ga0318516_10851265 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Zavarzinella → Zavarzinella formosa | 514 | Open in IMG/M |
| 3300031545|Ga0318541_10248524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 988 | Open in IMG/M |
| 3300031546|Ga0318538_10811321 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Zavarzinella → Zavarzinella formosa | 508 | Open in IMG/M |
| 3300031564|Ga0318573_10793731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 509 | Open in IMG/M |
| 3300031572|Ga0318515_10663012 | Not Available | 553 | Open in IMG/M |
| 3300031744|Ga0306918_10121424 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Zavarzinella → Zavarzinella formosa | 1894 | Open in IMG/M |
| 3300031768|Ga0318509_10171824 | Not Available | 1201 | Open in IMG/M |
| 3300031768|Ga0318509_10508220 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 673 | Open in IMG/M |
| 3300031788|Ga0302319_11078578 | Not Available | 756 | Open in IMG/M |
| 3300031823|Ga0307478_10959556 | Not Available | 715 | Open in IMG/M |
| 3300031833|Ga0310917_10772411 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Zavarzinella → Zavarzinella formosa | 649 | Open in IMG/M |
| 3300031890|Ga0306925_10485237 | Not Available | 1318 | Open in IMG/M |
| 3300031910|Ga0306923_12323768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 534 | Open in IMG/M |
| 3300031912|Ga0306921_11202268 | Not Available | 844 | Open in IMG/M |
| 3300031942|Ga0310916_10093244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2406 | Open in IMG/M |
| 3300031945|Ga0310913_11217082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 524 | Open in IMG/M |
| 3300031947|Ga0310909_10367774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1207 | Open in IMG/M |
| 3300032001|Ga0306922_10363899 | Not Available | 1551 | Open in IMG/M |
| 3300032076|Ga0306924_10390560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1594 | Open in IMG/M |
| 3300032174|Ga0307470_10761978 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 745 | Open in IMG/M |
| 3300032261|Ga0306920_101238075 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300032828|Ga0335080_10208089 | Not Available | 2150 | Open in IMG/M |
| 3300033004|Ga0335084_10879515 | Not Available | 907 | Open in IMG/M |
| 3300033289|Ga0310914_10485684 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.28% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 4.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.45% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.76% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.76% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.07% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.07% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.07% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.38% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.38% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.38% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.38% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.38% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.38% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.38% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.38% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.38% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 1.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.38% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.69% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.69% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.69% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.69% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.69% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.69% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.69% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.69% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.69% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2032320005 | Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010864 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011403 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT166_2 | Environmental | Open in IMG/M |
| 3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012232 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2 | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014879 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_10D | Environmental | Open in IMG/M |
| 3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300020063 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300024325 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19 | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027716 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACEORA_5651570 | 2032320005 | Soil | MESIISNLLTRFEKGSLSRRELVRGLAALAASGTAAA |
| Ga0066396_100124122 | 3300004267 | Tropical Forest Soil | MEAIISNLVSQFEKGALSRRQLVRGLAMLTATGTAARAAQNDIDFKTA |
| Ga0066395_100107424 | 3300004633 | Tropical Forest Soil | MESIISNLLDRFEKGSLSRRELVRGLAMLAAGSTAAAAQED |
| Ga0062380_101429151 | 3300004779 | Wetland Sediment | MEPIISYLVSRFENGSLSRRDLVSGLAMLAASGTATAAAQTEIDFKTADID |
| Ga0066673_106159121 | 3300005175 | Soil | MESIISNLLSQFEKGSLSRRELVSGLAMLAAGGTAAAAQN |
| Ga0066671_101069491 | 3300005184 | Soil | MESMISELLSRFETGALSRRELVGGLAMLAASGTGVGAAQQELDFRN |
| Ga0066388_1026843881 | 3300005332 | Tropical Forest Soil | MESIISSLVTRFEQGSLNRRDLVRGLAMLAASGTTVAAQEDLNFKAATIDHVSLQ |
| Ga0066388_1076704661 | 3300005332 | Tropical Forest Soil | MEKIISDLVRRFEKGALSRRELVSGLALLAASGTAANAQEDVDFKT |
| Ga0070713_1007826731 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MESIISDLVTRFERGSLSRRELVSGLALLAAGTSPASAQQELDFTRAN |
| Ga0070663_1019167942 | 3300005455 | Corn Rhizosphere | MESTISNLVAQFEKGSLSRRDLIAGLTVLAATGTALRAAEADIDFKTADIDHVSMQVA |
| Ga0070738_100915864 | 3300005531 | Surface Soil | MESIISNLLARFEKGSLSRRELVQGLAMLAAGGSAVAQE |
| Ga0066701_103498581 | 3300005552 | Soil | MEAIISNLVIQFEKGALSRRQLVRGLAMLAATGTAA |
| Ga0066700_105762071 | 3300005559 | Soil | MESIISNLLTRFEKGSLSRRELVRGLAILAASGTAAAAQEDID |
| Ga0066700_110403972 | 3300005559 | Soil | MESIISNLVSRFEKGSLSRRDLVQGLAMLAASGAAVSAQESINFKAAD |
| Ga0070763_105692712 | 3300005610 | Soil | MDSIISNLVARFEKGSLSRRELVQGLAMLAASGTAATAQEDINF |
| Ga0066903_1047865312 | 3300005764 | Tropical Forest Soil | METMISNLLSRFEKGALTRRELVQGLAMLAATSGTISTVDAQETG |
| Ga0066903_1071290052 | 3300005764 | Tropical Forest Soil | MESIISSLLTRFENGSLSRRELVRGLALLAASGTAATAQEDIDFKTA |
| Ga0070766_112393001 | 3300005921 | Soil | MESIISDLLARFEKGSLTRRDLARGLAMLAAGATSAAAQEAIDFKSADIDHVS |
| Ga0081540_10333363 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MESIISNLLTRFENGSLSRRELVRGLALLAASGTAAA |
| Ga0075023_1003010802 | 3300006041 | Watersheds | MESIISNLISRFEKGSLSRRDLVSGLALLAAAGGTAAAAPDEIAFND |
| Ga0075029_1009715481 | 3300006052 | Watersheds | MQSIISNLVSQFEKGSLSRRELVSGLAMLAASGTAAAAQEEIEFK |
| Ga0075014_1000433991 | 3300006174 | Watersheds | MESIISNLLTRFEKGSLSRRDLVQGLALLAAGGTAAAAAEEDIDFKTAD |
| Ga0068871_1011781662 | 3300006358 | Miscanthus Rhizosphere | MEAIIASLLSRFEKGMLTRRGLSQGLTMLAAAGGAAEAQVPAATAP |
| Ga0075435_1009308762 | 3300007076 | Populus Rhizosphere | MESIISSLVARFERGSLSRRDLVRSLAVLAAGATAAGAQEEL |
| Ga0114129_119734861 | 3300009147 | Populus Rhizosphere | MEAIISNLVSQFENGALSRRQLVRGLAMLAATGTAARADQNDID |
| Ga0116225_13010491 | 3300009524 | Peatlands Soil | MESIISELLTRFEKGSLTRRDLARGLAMLAAGATSAAAQEGIDFKSADIDHVS |
| Ga0105347_12871051 | 3300009609 | Soil | MESIISDLVTRFEKGSLSRRDLVQGLALLAASGAGSA |
| Ga0116217_108780872 | 3300009700 | Peatlands Soil | MEAMISSLVSRFEKGGLSRRELVQGLAMLTAASGTASSGLAQDA |
| Ga0126374_107935742 | 3300009792 | Tropical Forest Soil | MESIISNLLTRFENGSLSRRELVRGLALLAAGGTA |
| Ga0126374_111867792 | 3300009792 | Tropical Forest Soil | MEAIISNLVSQFEKGALSRRQLVRGLTMLAASGTAARAAQNDIDFKTADIDHV |
| Ga0126384_103589231 | 3300010046 | Tropical Forest Soil | MEAIISNLVSQFEKGAISRRQLVRGLAMLAATGTAARA |
| Ga0126382_109711472 | 3300010047 | Tropical Forest Soil | MESIISNLLSRFEKGSLSRRELVQGLAMLAASGTAASAQEDI |
| Ga0126370_100036751 | 3300010358 | Tropical Forest Soil | MESIISNLLDRFEKGSLSRRELVRGLAMLAAGSTAAAAQEDIDFNSANI |
| Ga0126370_110678582 | 3300010358 | Tropical Forest Soil | MEASISNLVSRFEKGLLSRRELVRSLALLAAGGTAASA |
| Ga0126376_132695522 | 3300010359 | Tropical Forest Soil | MEAIISNLVSRFEKGLLSRRELVQGLAMLAAGVRAASAQEGLDFS |
| Ga0126372_109670192 | 3300010360 | Tropical Forest Soil | MESIISYLVTRFEKGSLSRRELVSGLAMLAAGTMAAAQE |
| Ga0126378_103267774 | 3300010361 | Tropical Forest Soil | MESIISDLVAHFEKGALSRRELVSGLAMLAASGTGAAAADEVDFKSA |
| Ga0126377_112378352 | 3300010362 | Tropical Forest Soil | MEAVISSLVGRFEKGVLSRRELVQGLLALTATGGAAAA |
| Ga0126377_119342671 | 3300010362 | Tropical Forest Soil | MESIVSDLLTRFENGSLSRRDLVQGLAMLAAGGVATAQAAQAELDFKAA |
| Ga0126377_122918452 | 3300010362 | Tropical Forest Soil | MESIISDLVTLFEKGSLSRRELVSGLAVLAAGGIAVAQEDIDF |
| Ga0126379_119456192 | 3300010366 | Tropical Forest Soil | MEKIISDLVSRFEKGSLSRRELVSGLALLAAGGTTASAQ |
| Ga0126381_1015553031 | 3300010376 | Tropical Forest Soil | MESIISNLLDRFEKGSLSRRELVRGLAMLAAGSTAAAAQEDIDFN |
| Ga0126383_112214012 | 3300010398 | Tropical Forest Soil | MESIISNLLTRFENGSLSRRELVRGLALLAASGTAVAAQEDLDFK |
| Ga0126357_13028851 | 3300010864 | Boreal Forest Soil | METLISDLLARFEKGSLDRRDLVRGLALLAASATGAGAQEEIDFKTA |
| Ga0137392_112588642 | 3300011269 | Vadose Zone Soil | MESIISNLLARFEKGSLSRRELVSGLAMLAAGSTAAAAQ |
| Ga0137313_10205202 | 3300011403 | Soil | MEAIISDLVSRFEKGSLSRRDLVSGLALLAASGTAAA |
| Ga0137427_104242302 | 3300011445 | Soil | MEKIISDLVSPFEKGSLSRRELVSGLAMLVAASGTAAKAAAQDE |
| Ga0137363_114794722 | 3300012202 | Vadose Zone Soil | MESIISDLVSRYEKGSLNRRDLVAGLALLAASGTAGAAPAEIEFKDANIDH |
| Ga0137380_117575031 | 3300012206 | Vadose Zone Soil | METIISNLVSRFEKGSLSRRELVQGLTMLAASGTAASAQQDLNFKT |
| Ga0137376_116736722 | 3300012208 | Vadose Zone Soil | MESMISHLISRYEKGLLNRRDLVAGLALLAASGPAGAAQEEIEFRDA |
| Ga0137378_100686491 | 3300012210 | Vadose Zone Soil | MESIISNLISRFEKGSLSRRDLVSGLALLAASGGTATAAAQDEIEFKAAN |
| Ga0137377_112765771 | 3300012211 | Vadose Zone Soil | MESIISNLLTRFEKGSLSRRELVQGLALLAASGTAATAQEDIDFK |
| Ga0137435_10174251 | 3300012232 | Soil | MESIISNLLSRFEKGSLSRRDLVQGLAMLAASGTAASAQ |
| Ga0137387_109267271 | 3300012349 | Vadose Zone Soil | MESIISNLLSRFEKGSLSRRELVQGLAMLAASGTAASAQEDINFKS |
| Ga0137360_108350212 | 3300012361 | Vadose Zone Soil | MESIISNLLTRFEKGSLSRRELVRGLAMLAASGTAA |
| Ga0137360_118234281 | 3300012361 | Vadose Zone Soil | MESIISNLLARFEKGSLSRRELVQGLAMLAAGSTAAAAQEDIEFGSAN |
| Ga0137397_101765792 | 3300012685 | Vadose Zone Soil | MESIISNLLARFEKGLLSRRELVYGLATLAAGSTAAP |
| Ga0137397_110819701 | 3300012685 | Vadose Zone Soil | MESIISNLLARFEKGSLSRRELVSGLAMLAASGTAASAQDGVD |
| Ga0137397_110970392 | 3300012685 | Vadose Zone Soil | MEPIISDLLTRFEKGTLTRRQLVSGLAMLAASGTAASAQEDINFK |
| Ga0137395_106166962 | 3300012917 | Vadose Zone Soil | MESVISNLISRYEKGSLNRRDLVSGLALLAAAGGTAA |
| Ga0137394_105237012 | 3300012922 | Vadose Zone Soil | MESIISNLLSQFEKGSLSRRELVSGLALLAAGGTAAAAQNEIDFKTA |
| Ga0137359_113532922 | 3300012923 | Vadose Zone Soil | MEAIISNLVIQFEKGALSRRQLVRGLAMLAATGTAAT |
| Ga0137413_103483031 | 3300012924 | Vadose Zone Soil | METIISNLVSHFEKGSLSRRELVQGLTMLAASGTA |
| Ga0137413_109228112 | 3300012924 | Vadose Zone Soil | MEPIISDLLTRFEKGSLSRRELVRGLAMLAASGTAAAAQE |
| Ga0137413_111883431 | 3300012924 | Vadose Zone Soil | MESIISNLLTRFEKGSLSCRELVRGLAMVAASGTA |
| Ga0137404_118791861 | 3300012929 | Vadose Zone Soil | MEPIISDLLTRFEKGTLTRRQLVSGLAMLAASGTGASAQQELD |
| Ga0137407_112223172 | 3300012930 | Vadose Zone Soil | MESIISNLLARFEKGSLSRRELVSGLAMLAASRTA |
| Ga0126375_116792311 | 3300012948 | Tropical Forest Soil | MESIISNLVARFEQGSLSRRDLVRGLALLAASGTAAVAQEDLNFK |
| Ga0126369_1000829210 | 3300012971 | Tropical Forest Soil | MESIISNLLTRFENGSLSRRELVRGLALLAASGTAATAQE |
| Ga0134077_101150002 | 3300012972 | Grasslands Soil | MESIISGLLTRFENGSLSRRELVRGLALLAASGTAA |
| Ga0164304_113303461 | 3300012986 | Soil | MDSIISDLVSRFEKGSLSRRELVQGLTMLAASGTTAAAAAQQEIDFKTAN |
| Ga0157374_102970473 | 3300013296 | Miscanthus Rhizosphere | MEAMISKLLQRFERGVLSRRDLVQGLTMLAAGGTALEAQ |
| Ga0182024_103788733 | 3300014501 | Permafrost | MESIVSNLLARFETGSLSRRDLVQGLALLAASGTAAAAQEQVDFKG |
| Ga0182024_107023383 | 3300014501 | Permafrost | MESLISDLVSRFENGSLNRRALVQGLALLAASGTAAATQEEID |
| Ga0180062_10758621 | 3300014879 | Soil | MESIISDLVTRFEKGSLSRRDLVQGLALLAASGAGSAKAAAQAELDFK |
| Ga0180086_11165632 | 3300014883 | Soil | MEPIISDLVSRFEKGSLSRRDLVSGLALLAASGTAAKA |
| Ga0157376_131256173 | 3300014969 | Miscanthus Rhizosphere | METIISKLLSSYEKGSLSRRDLVSGLAMLAASGPAAAAQDEIEFRDANIDHV |
| Ga0137412_110371262 | 3300015242 | Vadose Zone Soil | MESIISNLISRFEKGSLSRRDLVSGLALLAASGGSAVAAAQE |
| Ga0137409_109564151 | 3300015245 | Vadose Zone Soil | MESIIANLVSQFEKGSLSRRDLVSGLALLAASGTGAAAAAAPDEIDF |
| Ga0132256_1038733682 | 3300015372 | Arabidopsis Rhizosphere | MESIISNLVSRFEKGALSRRELVQGLTMLAASGTAASA |
| Ga0132255_1030912582 | 3300015374 | Arabidopsis Rhizosphere | MESIISSLVARFERGSLSRRDLVRSLAVLAAGATAAGAQEELNFKAANIDHV |
| Ga0182041_112377912 | 3300016294 | Soil | MEAIISSLVSRFEKGSLSRRELVRGLAVLAAGGTAASAQEG |
| Ga0182033_106137081 | 3300016319 | Soil | MESMISDLVTRFEKGSLSRRELVQGLAMLAGGGTGAAAQEA |
| Ga0182032_101503112 | 3300016357 | Soil | MESIISNLVAGFEKGALSRRELVEGLTMLAASATTASAQEDLNFRTATI |
| Ga0182032_103615601 | 3300016357 | Soil | MEAIISNLVTRFERGSLSRRELVQGLAMLAASGTAAAAQEGGLD |
| Ga0182040_104670491 | 3300016387 | Soil | MESIICDLVTRFEKGSLSRRELVQGLAVLAASSTTASAQQDIDFK |
| Ga0190266_109238831 | 3300017965 | Soil | MESMISDLVSRFEKGALSRRDLVQGLAMLAASGTTAAAAQDEIDFKT |
| Ga0187783_100554431 | 3300017970 | Tropical Peatland | MESIISNLLSRFEKGSLSRRELVQGLAMLAASGATVSAQEDINF |
| Ga0187783_104110071 | 3300017970 | Tropical Peatland | MQSIIAHLLSRFDKGALSRRELAQGLALLAASATAAAADDTLDFSGADVDHIS |
| Ga0187782_104034361 | 3300017975 | Tropical Peatland | MEATISDLVSRFEKGALSRRQLVQGLTLIMAGGAATTAQAQDSA |
| Ga0184604_101384992 | 3300018000 | Groundwater Sediment | MESIISNLLSRFEKGSLSRRDLVQGLAMLAASGSAASAQDNINFKAASIKLCMT |
| Ga0184604_101431392 | 3300018000 | Groundwater Sediment | MESIISSLVGRFERGSLSRRDLVRSLAILAAGGTAAGAQEDLNFKAATID |
| Ga0184627_106230971 | 3300018079 | Groundwater Sediment | METIISKLLSGYEKGSLSRRELVSGLAMLAAGGTAAAQDEIEFKDAN |
| Ga0190264_101128362 | 3300019377 | Soil | MEAIISDLVSRFEKGSLSRRDLVQGLAMLAASATAVSAAAQDE |
| Ga0193721_11027762 | 3300020018 | Soil | MESIISNLLSRFEKGSLSRRDLVQGLAMLAASGTAAS |
| Ga0180118_11777161 | 3300020063 | Groundwater Sediment | MESTISDLVSRFEKGSLSRRDLVSGLALLAASGSASAAPQDEIEFSTANI |
| Ga0210399_103869382 | 3300020581 | Soil | MEPIISDLLSRFEKGSLSRRELVRGLTMLAASGTTAAAQEGIDFKAVNI |
| Ga0213876_100292241 | 3300021384 | Plant Roots | MEGIISNLVSRFEKGLLTRRELVQGLTMLAGTGGATSV |
| Ga0213875_103801631 | 3300021388 | Plant Roots | METIISNLLACFEKGSLSRRDLVQGLAMLAAGGTAAAAQEGVDFKTADID |
| Ga0210386_106488182 | 3300021406 | Soil | MEAMISSLVSRFEKGGLSRRELVQGLAMLTAARTAP |
| Ga0210394_116429791 | 3300021420 | Soil | MEAMISNLVSRFETGALSRRELVQGLTMLAAASGAASQ |
| Ga0210384_109231782 | 3300021432 | Soil | METIIAGLISHFEKGSLSRRDLVQALTILAASGTAVGAAAAAQGELDFKAANIDH |
| Ga0210390_105281031 | 3300021474 | Soil | MEPIISNLLTRFENGSLSRRELVQGLAMLAASGTA |
| Ga0210402_104879432 | 3300021478 | Soil | MDSIISDLVARFEKGSLSRRELVQGLAMLAASGTAATAQED |
| Ga0210402_108995971 | 3300021478 | Soil | MDTIISNLVARFENGSLSRRELVQGLAMLAASGTAATAQEDINFKAANI |
| Ga0247678_10779842 | 3300024325 | Soil | MESMISDLVTRFEKGSLSRRELVQGLAMLAASGTAAAAQEAIDFK |
| Ga0207645_106673752 | 3300025907 | Miscanthus Rhizosphere | MELIISKLLSGYEKGSLSRRELISGLALLAAGGTATAAQDEIE |
| Ga0207663_110210932 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MEAIISNLVSRFEKGQLSRRELVRGLAMLAAGGTAASAQEG |
| Ga0207660_106955172 | 3300025917 | Corn Rhizosphere | MEPIVSDLLNRYEKGSLSRRELVQGLAMLAAGGASTAQAAQADLDFKTAT |
| Ga0207659_106228912 | 3300025926 | Miscanthus Rhizosphere | METIISKLLSRYEKGSLSRRELVSGLAMLAAGGTGASAAQNELDFKDANID |
| Ga0207664_117986852 | 3300025929 | Agricultural Soil | VESIISDLVTHFEKGALSRRELVSGLAMLAAGGTAAAAADDV |
| Ga0207691_109205242 | 3300025940 | Miscanthus Rhizosphere | METIISDLLNRFEKGALSRRELVQGLSLLAAGSTAA |
| Ga0209647_13346091 | 3300026319 | Grasslands Soil | MESIISNLLARFEKGSLSRRELVHGLAMLAAGSTA |
| Ga0209577_108254571 | 3300026552 | Soil | MEAIISNLVSQFEKGALSRRQLVRGLAMLAATGTAARAAQNDIDFKTADI |
| Ga0208981_11257102 | 3300027669 | Forest Soil | MESIISNLLSRFEKGSLSRRELVQGLAMLAASGTAASAQEA |
| Ga0209682_100031821 | 3300027716 | Wetland Sediment | MESIISSLVTRFERGSLSRRDLVRGLAMLAASGTAAAAQEDTNFK |
| Ga0209060_103661812 | 3300027826 | Surface Soil | MEAIISNLVSCFESGALSRRQLVQGLAVLAGSATAARAQE |
| Ga0209814_103635351 | 3300027873 | Populus Rhizosphere | MEAIISNLVSQFEKGALSRRQLVRGLAMLAATGTAARAAHNDIDFKTADIDH |
| Ga0209067_108135212 | 3300027898 | Watersheds | MESIISNLLARFEKGSLTRRELAQGLAMLAAGATAATAQEDIDFK |
| Ga0207428_107867061 | 3300027907 | Populus Rhizosphere | MEAIISDLVSRFEKGSLSRRALVQGLAMLAASGTAR |
| Ga0209006_106207201 | 3300027908 | Forest Soil | MESVISNLLTRFEKGSLSRRELVRGLAMLAASGTAATAQE |
| Ga0318516_108512651 | 3300031543 | Soil | MESIISDLVARFEKGTLSRRQLVSGLAMLAASGTAAAAADDVDFTGATID |
| Ga0318541_102485241 | 3300031545 | Soil | MESIISDLLTHFEKGALSRRELVSGLATLPASGTAAAAADDVDFKGATID |
| Ga0318538_108113211 | 3300031546 | Soil | MESIISDLVARFEKGCLSRRQLVSGLAMLAASGTAAAAADDVDFTGATID |
| Ga0318573_107937312 | 3300031564 | Soil | MEAIISNFVTRFEQGSLSRRELVQRLATLAASARAAT |
| Ga0318515_106630121 | 3300031572 | Soil | MESIISDLVTHFEKGALSRRELVSGLAMLAASGIAAAAADDVDFKGATID |
| Ga0306918_101214241 | 3300031744 | Soil | MESIISDLVARFEKGCLSRRQLVSGLAMLAASGTAAAAADDV |
| Ga0318509_101718241 | 3300031768 | Soil | MESIISDLVARFEKGSLSRRELISGLAMLAASGTAAAAADDVDFTGATIDHVSIH |
| Ga0318509_105082201 | 3300031768 | Soil | MEAIVSSLVSRFEKGLLSRRELVYGLTMLAAGGTAASAQEGL |
| Ga0302319_110785781 | 3300031788 | Bog | MEAIISTLLSRFERGSITRRDLVQGLAMLAAAGGAES |
| Ga0307478_109595562 | 3300031823 | Hardwood Forest Soil | MESLISDLVSRFEKGSLNRRDLVQGLALLCAGATAAT |
| Ga0310917_107724111 | 3300031833 | Soil | MESIISDLVARFEKGCLSRRQLVSGLAMLAASGTAAAA |
| Ga0306925_104852371 | 3300031890 | Soil | MESLISDLVSRFETGSLNRRDLVQGLALLAASGTVA |
| Ga0306923_123237681 | 3300031910 | Soil | MESIISNLLTRFEKGSLSRRELVSGLAMLAGSGTVAAAQDDINF |
| Ga0306921_112022681 | 3300031912 | Soil | MESIISNLVARFEKGSLSRRELVQGLAMLAASGTAATAQEDINFKA |
| Ga0310916_100932443 | 3300031942 | Soil | MESMISDLVTRFEKGSLSRRELVQGLAMLAGGGTGAAAQEAI |
| Ga0310913_112170821 | 3300031945 | Soil | MEAIISNLVTRFERGSLSRRELVQGLAMLAASGTAAAAQEGGLDFKSADIDH |
| Ga0310909_103677743 | 3300031947 | Soil | MESIISDLLTHFEKGALSRRELVSGLATLPASGTAAAAADDVDFKG |
| Ga0306922_103638991 | 3300032001 | Soil | MESLISDLVSRFETGSLNRRDLVQGLALLAASGTVAA |
| Ga0306924_103905603 | 3300032076 | Soil | MESIISDLLTRFEKGSLSRRELVQGLAMLAASGTAATA |
| Ga0307470_107619781 | 3300032174 | Hardwood Forest Soil | MESIISSLVARFERGSLNRRDLVRSLAILAAGGTAAAAQEDLNFKAAT |
| Ga0306920_1012380751 | 3300032261 | Soil | MESIISNLLARFEKGSLSRRELVQGLAMLAASGTAATAQEDINFKSANI |
| Ga0335080_102080893 | 3300032828 | Soil | MEAMISNLVSRFESGTLTRRELVQGLTMLAAASGTAAHAQAQDAGIK |
| Ga0335084_108795151 | 3300033004 | Soil | MESIISNLVSQFEKGSLSRRQLVQGLAMLAAGSAAGKATAAEADIDFKTA |
| Ga0310914_104856841 | 3300033289 | Soil | MESIISNLVARFENGSLSRRELVQGLAMLAASGTVVTAQEDINF |
| ⦗Top⦘ |