


| Basic Information | |
|---|---|
| Family ID | F050571 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 145 |
| Average Sequence Length | 41 residues |
| Representative Sequence | THMYEMRPKELFAINEFYPLVGLCLMGAILGAWTKKAA |
| Number of Associated Samples | 122 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.07 % |
| % of genes near scaffold ends (potentially truncated) | 94.48 % |
| % of genes from short scaffolds (< 2000 bps) | 86.21 % |
| Associated GOLD sequencing projects | 116 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.276 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.690 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.207 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.966 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.45% β-sheet: 0.00% Coil/Unstructured: 54.55% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF00719 | Pyrophosphatase | 32.41 |
| PF08530 | PepX_C | 11.03 |
| PF08570 | DUF1761 | 8.28 |
| PF00837 | T4_deiodinase | 4.14 |
| PF13189 | Cytidylate_kin2 | 4.14 |
| PF04384 | Fe-S_assembly | 4.14 |
| PF02754 | CCG | 3.45 |
| PF03485 | Arg_tRNA_synt_N | 2.07 |
| PF12867 | DinB_2 | 2.07 |
| PF00111 | Fer2 | 1.38 |
| PF12838 | Fer4_7 | 1.38 |
| PF00483 | NTP_transferase | 1.38 |
| PF07486 | Hydrolase_2 | 0.69 |
| PF07238 | PilZ | 0.69 |
| PF04337 | DUF480 | 0.69 |
| PF00012 | HSP70 | 0.69 |
| PF00266 | Aminotran_5 | 0.69 |
| PF02129 | Peptidase_S15 | 0.69 |
| PF03471 | CorC_HlyC | 0.69 |
| PF01521 | Fe-S_biosyn | 0.69 |
| PF13649 | Methyltransf_25 | 0.69 |
| PF00069 | Pkinase | 0.69 |
| PF02913 | FAD-oxidase_C | 0.69 |
| PF01179 | Cu_amine_oxid | 0.69 |
| PF00903 | Glyoxalase | 0.69 |
| PF02633 | Creatininase | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG0221 | Inorganic pyrophosphatase | Energy production and conversion [C] | 32.41 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 11.03 |
| COG2975 | Fe-S-cluster formation regulator IscX/YfhJ | Posttranslational modification, protein turnover, chaperones [O] | 4.14 |
| COG0247 | Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcF | Energy production and conversion [C] | 3.45 |
| COG2048 | Heterodisulfide reductase, subunit B | Energy production and conversion [C] | 3.45 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.76 |
| COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 2.07 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.69 |
| COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 0.69 |
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 0.69 |
| COG1402 | Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis) | Coenzyme transport and metabolism [H] | 0.69 |
| COG3132 | Uncharacterized conserved protein YceH, UPF0502 family | Function unknown [S] | 0.69 |
| COG3733 | Cu2+-containing amine oxidase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.69 |
| COG3773 | Cell wall hydrolase CwlJ, involved in spore germination | Cell cycle control, cell division, chromosome partitioning [D] | 0.69 |
| COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.97 % |
| Unclassified | root | N/A | 31.03 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000731|JGI12381J11899_1016638 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300001166|JGI12694J13545_1003494 | All Organisms → cellular organisms → Bacteria | 1989 | Open in IMG/M |
| 3300004092|Ga0062389_101554065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 844 | Open in IMG/M |
| 3300004092|Ga0062389_103796609 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300004635|Ga0062388_100670800 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300005167|Ga0066672_10790481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 598 | Open in IMG/M |
| 3300005451|Ga0066681_10329471 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300005534|Ga0070735_10406799 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300005558|Ga0066698_10658786 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300005610|Ga0070763_10494605 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300006050|Ga0075028_100633526 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300006052|Ga0075029_101099344 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300006059|Ga0075017_100374265 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300006102|Ga0075015_100928333 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300006174|Ga0075014_100561023 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300006175|Ga0070712_100711077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 857 | Open in IMG/M |
| 3300006354|Ga0075021_10219957 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
| 3300009088|Ga0099830_10046620 | All Organisms → cellular organisms → Bacteria | 3037 | Open in IMG/M |
| 3300009137|Ga0066709_100234303 | All Organisms → cellular organisms → Bacteria | 2443 | Open in IMG/M |
| 3300009523|Ga0116221_1321447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300009824|Ga0116219_10565637 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300009839|Ga0116223_10223349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1144 | Open in IMG/M |
| 3300010358|Ga0126370_12311186 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300010358|Ga0126370_12519336 | Not Available | 513 | Open in IMG/M |
| 3300010359|Ga0126376_12886528 | Not Available | 530 | Open in IMG/M |
| 3300010379|Ga0136449_102966867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300011269|Ga0137392_10070961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2680 | Open in IMG/M |
| 3300011270|Ga0137391_10634722 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 893 | Open in IMG/M |
| 3300011271|Ga0137393_10101018 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2355 | Open in IMG/M |
| 3300012096|Ga0137389_11542456 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300012189|Ga0137388_10474698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1161 | Open in IMG/M |
| 3300012203|Ga0137399_10597359 | Not Available | 928 | Open in IMG/M |
| 3300012361|Ga0137360_11278298 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300012362|Ga0137361_11132907 | Not Available | 704 | Open in IMG/M |
| 3300012917|Ga0137395_10028287 | All Organisms → cellular organisms → Bacteria | 3353 | Open in IMG/M |
| 3300012917|Ga0137395_10264237 | Not Available | 1212 | Open in IMG/M |
| 3300012923|Ga0137359_10837063 | Not Available | 796 | Open in IMG/M |
| 3300012925|Ga0137419_11850618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300012944|Ga0137410_10149584 | All Organisms → cellular organisms → Bacteria | 1777 | Open in IMG/M |
| 3300012944|Ga0137410_11538934 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Leptospirillum → Leptospirillum sp. Group I → Leptospirillum ferrooxidans | 581 | Open in IMG/M |
| 3300014165|Ga0181523_10418223 | Not Available | 745 | Open in IMG/M |
| 3300014200|Ga0181526_10377149 | Not Available | 901 | Open in IMG/M |
| 3300015051|Ga0137414_1205671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4768 | Open in IMG/M |
| 3300015053|Ga0137405_1352899 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2060 | Open in IMG/M |
| 3300015053|Ga0137405_1429139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1978 | Open in IMG/M |
| 3300015371|Ga0132258_12659408 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300016294|Ga0182041_11796010 | Not Available | 568 | Open in IMG/M |
| 3300016319|Ga0182033_10577343 | Not Available | 974 | Open in IMG/M |
| 3300016319|Ga0182033_11655412 | Not Available | 579 | Open in IMG/M |
| 3300016341|Ga0182035_11287074 | Not Available | 654 | Open in IMG/M |
| 3300016404|Ga0182037_10473737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1045 | Open in IMG/M |
| 3300016404|Ga0182037_11852325 | Not Available | 540 | Open in IMG/M |
| 3300016445|Ga0182038_11318945 | Not Available | 645 | Open in IMG/M |
| 3300017823|Ga0187818_10147333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1024 | Open in IMG/M |
| 3300017926|Ga0187807_1243879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300017930|Ga0187825_10270425 | Not Available | 627 | Open in IMG/M |
| 3300017955|Ga0187817_10083603 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1997 | Open in IMG/M |
| 3300017955|Ga0187817_10219772 | Not Available | 1211 | Open in IMG/M |
| 3300017955|Ga0187817_10678332 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300017975|Ga0187782_10150409 | All Organisms → cellular organisms → Bacteria | 1731 | Open in IMG/M |
| 3300017975|Ga0187782_10388329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1060 | Open in IMG/M |
| 3300017999|Ga0187767_10131580 | Not Available | 730 | Open in IMG/M |
| 3300018012|Ga0187810_10159297 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 908 | Open in IMG/M |
| 3300018022|Ga0187864_10034096 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2985 | Open in IMG/M |
| 3300018022|Ga0187864_10163806 | Not Available | 1086 | Open in IMG/M |
| 3300018057|Ga0187858_10010440 | All Organisms → cellular organisms → Bacteria | 7786 | Open in IMG/M |
| 3300018058|Ga0187766_11393225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300018086|Ga0187769_11481863 | Not Available | 513 | Open in IMG/M |
| 3300018088|Ga0187771_11718543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300020199|Ga0179592_10219171 | Not Available | 859 | Open in IMG/M |
| 3300020580|Ga0210403_10079856 | All Organisms → cellular organisms → Bacteria | 2635 | Open in IMG/M |
| 3300020580|Ga0210403_10280855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1365 | Open in IMG/M |
| 3300020582|Ga0210395_10054452 | All Organisms → cellular organisms → Bacteria | 2931 | Open in IMG/M |
| 3300021168|Ga0210406_10276169 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1372 | Open in IMG/M |
| 3300021168|Ga0210406_10558587 | Not Available | 898 | Open in IMG/M |
| 3300021168|Ga0210406_10901178 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Leptospirillum → Leptospirillum sp. Group I → Leptospirillum ferrooxidans | 665 | Open in IMG/M |
| 3300021170|Ga0210400_10887489 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300021170|Ga0210400_11594888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300021178|Ga0210408_11474936 | Not Available | 510 | Open in IMG/M |
| 3300021406|Ga0210386_10106297 | All Organisms → cellular organisms → Bacteria | 2308 | Open in IMG/M |
| 3300021420|Ga0210394_10982683 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300021420|Ga0210394_11270678 | All Organisms → cellular organisms → Eukaryota | 630 | Open in IMG/M |
| 3300021432|Ga0210384_11240212 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300021432|Ga0210384_11449818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300021474|Ga0210390_11258568 | Not Available | 595 | Open in IMG/M |
| 3300021478|Ga0210402_10879922 | Not Available | 822 | Open in IMG/M |
| 3300021560|Ga0126371_10716457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1148 | Open in IMG/M |
| 3300021560|Ga0126371_11168162 | Not Available | 907 | Open in IMG/M |
| 3300022532|Ga0242655_10332404 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300024310|Ga0247681_1061214 | Not Available | 586 | Open in IMG/M |
| 3300026359|Ga0257163_1067402 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300026879|Ga0207763_1005688 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1367 | Open in IMG/M |
| 3300027039|Ga0207855_1062578 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Leptospirillum | 502 | Open in IMG/M |
| 3300027297|Ga0208241_1053458 | Not Available | 641 | Open in IMG/M |
| 3300027537|Ga0209419_1071706 | Not Available | 682 | Open in IMG/M |
| 3300027583|Ga0209527_1095601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
| 3300027591|Ga0209733_1132825 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300027635|Ga0209625_1012711 | All Organisms → cellular organisms → Bacteria | 1839 | Open in IMG/M |
| 3300027660|Ga0209736_1022048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1946 | Open in IMG/M |
| 3300027701|Ga0209447_10078518 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 906 | Open in IMG/M |
| 3300027748|Ga0209689_1144600 | Not Available | 1156 | Open in IMG/M |
| 3300027853|Ga0209274_10007809 | All Organisms → cellular organisms → Bacteria | 4839 | Open in IMG/M |
| 3300027862|Ga0209701_10236875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1073 | Open in IMG/M |
| 3300027889|Ga0209380_10777310 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300027895|Ga0209624_10019861 | Not Available | 4253 | Open in IMG/M |
| 3300027908|Ga0209006_10431453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1106 | Open in IMG/M |
| 3300027911|Ga0209698_10142082 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1975 | Open in IMG/M |
| 3300027915|Ga0209069_10588053 | Not Available | 639 | Open in IMG/M |
| 3300030053|Ga0302177_10124586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1472 | Open in IMG/M |
| 3300030520|Ga0311372_11895553 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
| 3300030737|Ga0302310_10437674 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
| 3300031090|Ga0265760_10052484 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
| 3300031128|Ga0170823_13309213 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Leptospirillum → Leptospirillum sp. Group I → Leptospirillum ferrooxidans | 717 | Open in IMG/M |
| 3300031525|Ga0302326_10025984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 11855 | Open in IMG/M |
| 3300031543|Ga0318516_10614120 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300031564|Ga0318573_10565286 | Not Available | 612 | Open in IMG/M |
| 3300031715|Ga0307476_11210511 | Not Available | 553 | Open in IMG/M |
| 3300031718|Ga0307474_11566950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300031720|Ga0307469_10016986 | All Organisms → cellular organisms → Bacteria | 3823 | Open in IMG/M |
| 3300031720|Ga0307469_11552995 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 635 | Open in IMG/M |
| 3300031744|Ga0306918_11574986 | Not Available | 501 | Open in IMG/M |
| 3300031771|Ga0318546_10837776 | Not Available | 647 | Open in IMG/M |
| 3300031777|Ga0318543_10025272 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2262 | Open in IMG/M |
| 3300031796|Ga0318576_10134092 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1149 | Open in IMG/M |
| 3300031823|Ga0307478_10408539 | Not Available | 1125 | Open in IMG/M |
| 3300031823|Ga0307478_11212264 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300031845|Ga0318511_10248622 | Not Available | 798 | Open in IMG/M |
| 3300031893|Ga0318536_10186544 | Not Available | 1056 | Open in IMG/M |
| 3300031910|Ga0306923_11890916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300031962|Ga0307479_10047365 | All Organisms → cellular organisms → Bacteria | 4132 | Open in IMG/M |
| 3300031962|Ga0307479_11759580 | Not Available | 572 | Open in IMG/M |
| 3300032001|Ga0306922_12048574 | Not Available | 556 | Open in IMG/M |
| 3300032009|Ga0318563_10517262 | Not Available | 645 | Open in IMG/M |
| 3300032059|Ga0318533_10992500 | Not Available | 616 | Open in IMG/M |
| 3300032091|Ga0318577_10076709 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1539 | Open in IMG/M |
| 3300032261|Ga0306920_100203946 | All Organisms → cellular organisms → Bacteria | 2951 | Open in IMG/M |
| 3300032261|Ga0306920_102226740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 761 | Open in IMG/M |
| 3300032828|Ga0335080_12285914 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300032954|Ga0335083_11237154 | Not Available | 577 | Open in IMG/M |
| 3300032955|Ga0335076_10054002 | All Organisms → cellular organisms → Bacteria | 3980 | Open in IMG/M |
| 3300033158|Ga0335077_10991013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 839 | Open in IMG/M |
| 3300033158|Ga0335077_11388729 | Not Available | 677 | Open in IMG/M |
| 3300033289|Ga0310914_10417481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1214 | Open in IMG/M |
| 3300033405|Ga0326727_10639382 | Not Available | 872 | Open in IMG/M |
| 3300033982|Ga0371487_0092529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1610 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.69% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.28% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.21% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.52% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.52% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.83% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.45% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.76% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.76% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.76% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.07% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.07% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.07% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.38% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.69% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.69% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.69% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.69% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000731 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 | Environmental | Open in IMG/M |
| 3300001166 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024310 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22 | Environmental | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300026879 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 50 (SPAdes) | Environmental | Open in IMG/M |
| 3300027039 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033982 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12381J11899_10166381 | 3300000731 | Tropical Forest Soil | VTFTTYMYEMRPWQLFAINQFYPLFGFVLMGAILGAWTKKAA* |
| JGI12694J13545_10034943 | 3300001166 | Forest Soil | ITLTTAMYEGRPLALFAINNFYPLVGLCLMGAILGAWTKKAA* |
| Ga0062389_1015540653 | 3300004092 | Bog Forest Soil | GIVGPIVYTTYMYEMRPAQLFAINEFYPLVGLCLMGAILGGWTKKSA* |
| Ga0062389_1037966091 | 3300004092 | Bog Forest Soil | TTYMYEMRPPTLFAINEFYPLAGLVLMGAILGAWTKKAA* |
| Ga0062388_1006708003 | 3300004635 | Bog Forest Soil | TYTTYMYEMRPNGLFLINEVYPLAGLVLMGAILGAWSKKTV* |
| Ga0066672_107904812 | 3300005167 | Soil | TTYMYELRPWQLFAINQFYPLAGLCVMGAILGAWTKKAA* |
| Ga0066681_103294711 | 3300005451 | Soil | GPITYTTYMYELRPWQLFAINQFYPLAGLCVMGAILGAWTKKAA* |
| Ga0070735_104067992 | 3300005534 | Surface Soil | NMYELRPPELFAINYLYTLAGLVVMGAILGAWHRKAA* |
| Ga0066698_106587862 | 3300005558 | Soil | MYELRPWQLFAINQFYPLAGLCVMGAILGAWTKKAA* |
| Ga0070763_104946051 | 3300005610 | Soil | YMYEMRPMQLFAINEFYSLVGLCLMGLILGAWTKKAA* |
| Ga0075028_1006335262 | 3300006050 | Watersheds | YTTYMYEMRPKELFAINQFYPLAGLVLMGAIIGAWTKKSA* |
| Ga0075029_1010993442 | 3300006052 | Watersheds | YMYEMRPRTLFAINQFYPLAGMVLMGAIIGAWSKKSA* |
| Ga0075017_1003742651 | 3300006059 | Watersheds | FTTYMYEMRPWQLFAINQFYPLFGFVLMGAIIGAWTKKAT* |
| Ga0075015_1009283332 | 3300006102 | Watersheds | YMYEMRPKELFAINEFYPLAGMVLMGAIIGAWTKKAA* |
| Ga0075014_1005610231 | 3300006174 | Watersheds | VGPIVATTYMYEMRPKELFAINEFYPLVGLCLMGVILGAWTKAK* |
| Ga0070712_1007110771 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | YMYEMRSMKLFAINEFYALVGLCLMGAILGAWKRKPA* |
| Ga0075021_102199571 | 3300006354 | Watersheds | TYTTHMYEMRPMELFAINEFYPLVGLCLMGAILGVWTKKSA* |
| Ga0099830_100466204 | 3300009088 | Vadose Zone Soil | GFLGPVTYTTYMYEMRPRELFAINEFYPLVGLCLMGAILGAWTKKSA* |
| Ga0066709_1002343031 | 3300009137 | Grasslands Soil | YMYELRPWQLFAINQFYPLAGLCVMGAILGAWTKKAA* |
| Ga0116221_13214473 | 3300009523 | Peatlands Soil | EMRPRALYAINEFYPLAGLILMGAILGGWTKRAA* |
| Ga0116219_105656372 | 3300009824 | Peatlands Soil | GIVGPIVLSTQVYELWSGELFAINEFYPLVGMCLMGVILGGWTKAK* |
| Ga0116223_102233494 | 3300009839 | Peatlands Soil | FEMRPKALYAINEFYPLAGLILMGAILGAWTKKTA* |
| Ga0126370_123111861 | 3300010358 | Tropical Forest Soil | YTTNMYEMRPTNLFLINEGYVLVGFLVMGAILGAWTKKSA* |
| Ga0126370_125193362 | 3300010358 | Tropical Forest Soil | YEMRPWQLFAINNFYPLVGLALMGAILGAWTKKAA* |
| Ga0126376_128865281 | 3300010359 | Tropical Forest Soil | PITYTTYMYEMRPFALFAINQFYPLVGLALMGAIVGAWRKKTA* |
| Ga0136449_1029668672 | 3300010379 | Peatlands Soil | VGPIVYTTYMYEMRPKSLFAINEFYPLVGLCMMGAILGAWKKKAA* |
| Ga0137392_100709614 | 3300011269 | Vadose Zone Soil | GPIVFTTYMYEMRSKELFAINEFYPLVGLCLMGIILGAWTKKAA* |
| Ga0137391_106347223 | 3300011270 | Vadose Zone Soil | GIVAPITYTTHMYEMRPKELFAINEFYPLVGLCLMGAILGVWTKKTA* |
| Ga0137393_101010181 | 3300011271 | Vadose Zone Soil | TSMYEMRPLNLFLINEGYVLVGLFLMGAILGAWTKKSA* |
| Ga0137389_115424561 | 3300012096 | Vadose Zone Soil | ITFTTYMYEMRSKALFAINEFYSLVWLCLMGEILGAWTKAK* |
| Ga0137388_104746981 | 3300012189 | Vadose Zone Soil | IVFTTYMYEMRSKELFAINEFYPLVGLCLMGIIFGAWTKKAA* |
| Ga0137399_105973591 | 3300012203 | Vadose Zone Soil | PITYTTYMYEMRPKELFAINEFFPLAGLVLMGAIIGAWTKKSA* |
| Ga0137360_112782981 | 3300012361 | Vadose Zone Soil | MYEMRPRELFAINEFFPLVGLCLMGAILGAWTKKSA* |
| Ga0137361_111329072 | 3300012362 | Vadose Zone Soil | GFVGPITYSTYMYEMRPWQLFAINEFYPLVGLCLMGAILGAWTKKAA* |
| Ga0137395_100282871 | 3300012917 | Vadose Zone Soil | VAPITYTTHMYEMRPKELFAINEFYPLVGLCLMGAILGVWTKKTA* |
| Ga0137395_102642374 | 3300012917 | Vadose Zone Soil | VAPITYTTHMYEMRPKELFAINEFYPLVGLCLMGAILGVWTKKPA* |
| Ga0137359_108370631 | 3300012923 | Vadose Zone Soil | IGFVGPITYTTYMYELRPWQLFAINQFYPLVGLCVMGAILGAWTKRAA* |
| Ga0137419_118506181 | 3300012925 | Vadose Zone Soil | TTYMYEMRPRELFAINEFFPLVGLCLMGAILGAWTKKSA* |
| Ga0137410_101495843 | 3300012944 | Vadose Zone Soil | MRYELKPFNLFLINEGYSPIGLLLMGAILDAWTKKPAK* |
| Ga0137410_115389341 | 3300012944 | Vadose Zone Soil | GPITYTTYMYEMRPKELFAINQFYPLAGLVLMGTIIGAWTKKSA* |
| Ga0181523_104182232 | 3300014165 | Bog | NYMFEMRPKTLFAINEFYPLAGLVLMGAILGAWTKKIA* |
| Ga0181526_103771491 | 3300014200 | Bog | EMRPKTLFAINEFYPLAGLVLMGAILGAWTKKIA* |
| Ga0137414_12056714 | 3300015051 | Vadose Zone Soil | MRPLNLFLINEGYVLVGLFLMGAILGALDQKIPA* |
| Ga0137405_13528992 | 3300015053 | Vadose Zone Soil | YEMRPTNLFFINEGYVLVGMLLMGAILGAWTTKSA* |
| Ga0137405_14291391 | 3300015053 | Vadose Zone Soil | ELRPWQLFAINQFYPLAGLCVMGAILGAWTKKAA* |
| Ga0132258_126594081 | 3300015371 | Arabidopsis Rhizosphere | MYEMRPWQLFAINNFYPLLGLALMGAILGAWTKKAV* |
| Ga0182041_117960101 | 3300016294 | Soil | YTTYMFEMRPKELFAINQFYPLFGMVLMGAIIGAWTKKSA |
| Ga0182033_105773433 | 3300016319 | Soil | MYEMRSKELFAINQFFPLAGFVLMGGILGAWKKKGA |
| Ga0182033_116554121 | 3300016319 | Soil | YMYEMRPKELFAINQFYPLAGFVLMGVILGAWKKNA |
| Ga0182035_112870741 | 3300016341 | Soil | TFTTYMYEMRPWQLFAINQFYPLFGFVLMGAIIGAWTKKA |
| Ga0182037_104737371 | 3300016404 | Soil | PVTFTTYMYEMRPKELFAINQFYPLAGFVLMGVILGAWKKNA |
| Ga0182037_118523252 | 3300016404 | Soil | VGPITYTTYLYEMRPWQLFAINQFYPLVGLALMGAILGAWTRKAA |
| Ga0182038_113189452 | 3300016445 | Soil | YEMRPWQLFAINQFYPLVGLCLMGAILGAWTQKAA |
| Ga0187818_101473333 | 3300017823 | Freshwater Sediment | ITYTTYMYEMRPKGLFAIDQFYPLVGLFVMGTILGAWKKKAA |
| Ga0187807_12438791 | 3300017926 | Freshwater Sediment | IVGPITYTTYMYEMRPKGLFAIDQFYPLVGLFVMGTILGAWKKKAA |
| Ga0187825_102704252 | 3300017930 | Freshwater Sediment | VGPVTYTTNMYEMRSVQLFAINEFYALVGFCLMGAILGAWTKKAA |
| Ga0187817_100836034 | 3300017955 | Freshwater Sediment | YMFEMRPKALFAINEFYPLVGMLLMGAILGAWTKKAA |
| Ga0187817_102197724 | 3300017955 | Freshwater Sediment | PITFMTYMFEMRPKTLFAINEFYPLAGLVLMGLIIGSWTKKIA |
| Ga0187817_106783322 | 3300017955 | Freshwater Sediment | IVYTTYMYEMRPKSLFAINEFYPLVGLCLMGAILGAWKKKAA |
| Ga0187782_101504091 | 3300017975 | Tropical Peatland | GPIVYTTYMYEMRPKALFAINEFYPLAGLCLMGAILGAWKKKAA |
| Ga0187782_103883293 | 3300017975 | Tropical Peatland | IGFVGPIALMNYMFEMRPKTLFAINEFYPLAGLFLMGAIIGAWSKKAA |
| Ga0187767_101315801 | 3300017999 | Tropical Peatland | VGPVTFTTYMYEMRPWQLFAINQFYPLFGFALMGAILGAWTKKSA |
| Ga0187810_101592972 | 3300018012 | Freshwater Sediment | GPITFMTYMFEMRPKELFAINGFYPLAGLVLMGVILGGWSKKIA |
| Ga0187864_100340961 | 3300018022 | Peatland | MRSIGIIAPITYTTHMYEMRPKELFAINELYPLVGLCLMGAILGAWTKKTA |
| Ga0187864_101638064 | 3300018022 | Peatland | GSFETRVTYATHMYEMRPKELFASNEFYPLVGLCLMGAILGAWAKKTA |
| Ga0187858_100104407 | 3300018057 | Peatland | FTTYMYEMRPKGLFAINEFYPLVGLCLMGAILGAWKKKAA |
| Ga0187766_113932252 | 3300018058 | Tropical Peatland | MTYMFEMRPKALFAINEFYPLAGLILMGAILGGWTKKAA |
| Ga0187769_114818632 | 3300018086 | Tropical Peatland | FIGPISFMNYMFEMRPKTLFAINEFYPLAGLVLMGAILGAWTKKTA |
| Ga0187771_117185432 | 3300018088 | Tropical Peatland | GFVGPLACMNYLFEMRPKALFAINEFYPLAGLMLMGAILGAWTKKAA |
| Ga0179592_102191711 | 3300020199 | Vadose Zone Soil | ISFIGPITYTTYMYEMRPKELFAINQFYPLAGLVLMGAIVGAWTKKST |
| Ga0210403_100798565 | 3300020580 | Soil | YMYEMRPKELFAINEFYPLAGLILMGAIIGAWTKKSA |
| Ga0210403_102808551 | 3300020580 | Soil | YEMRPWQLFAINEFYPLVGLCLMGAILGAWTKKAA |
| Ga0210395_100544524 | 3300020582 | Soil | GFVGPIAFTNYMCEMRPMQLFAINEFYSLVGLCLMGLILGAWMKKAA |
| Ga0210406_102761693 | 3300021168 | Soil | IGPITYTTYMYEMRPKELFAINQFYPLAGMVLMGAILGAWTRKSA |
| Ga0210406_105585872 | 3300021168 | Soil | VGPITFTTYMYEMRPRTLFAINQFYPLAGLVLMGAIIGAWSKKSA |
| Ga0210406_109011781 | 3300021168 | Soil | ITFTTYMYEMRPKELFAINQFYPLAGLVLMGAIIGAWTKKSA |
| Ga0210400_108874892 | 3300021170 | Soil | PVTYTTHMYEMRPKELFAINEFYSLAGLCLMGAILGAWTKKAA |
| Ga0210400_115948883 | 3300021170 | Soil | MYEMRPKELFAINEFYPLVGLILMGAILGAWTKASA |
| Ga0210408_114749362 | 3300021178 | Soil | ITFTTYMYEMRPPTLFAINEFYPLAGLVLMGAILGAWTKKAA |
| Ga0210386_101062973 | 3300021406 | Soil | MCEMRPMQLFAINEFYSLVGLCLMGLILGAWTKKAA |
| Ga0210394_109826831 | 3300021420 | Soil | PITYTTYMYEMRAKELFAINEFYPLVGLCLMGAILGAWKKKTA |
| Ga0210394_112706781 | 3300021420 | Soil | MYEMRPHLLFAINEFYPLAGLVLMGAILGAWTKKAA |
| Ga0210384_112402122 | 3300021432 | Soil | PITYTTYMYEMRPKELFAINQFYPLAGMVLMGAILGAWTRKSA |
| Ga0210384_114498181 | 3300021432 | Soil | TYTTYMYEMRPHGLFALNEFYPLMGLCLMGAILGAWTKKTA |
| Ga0210390_112585682 | 3300021474 | Soil | AYTNYMFEMRPMQLFAINEFYSLAGLFLMGLILGAWTKKAA |
| Ga0210402_108799221 | 3300021478 | Soil | MYEMRPIQLFAINEFYPLVGFCLMGAILGAWTKKAA |
| Ga0126371_107164571 | 3300021560 | Tropical Forest Soil | ITFMTYMFEMRPRTLFAINEFYPLAGLVLMGAILGGWTKKAA |
| Ga0126371_111681623 | 3300021560 | Tropical Forest Soil | YMYEMRPKELYAINQFFPLAGFVLMGAILGGWKKKKSA |
| Ga0242655_103324042 | 3300022532 | Soil | GIVGPIVYTTYMYEMRPMHLFAINELYPLVGLCLMGGILGAWTKKAA |
| Ga0247681_10612142 | 3300024310 | Soil | TTYMYEMRPWQLFAINNFYPLVGLALMGAILGAWTKKAA |
| Ga0257163_10674021 | 3300026359 | Soil | TTYMYEMRPRELFAINEFFPLVGLCLMGAILGAWTKKSA |
| Ga0207763_10056884 | 3300026879 | Tropical Forest Soil | TYMYEMRPWQLFAINQFYPLFGFVLMGAILGAWTKKAA |
| Ga0207855_10625781 | 3300027039 | Tropical Forest Soil | VTFTTYMYEMRPWQLFAINQFYPLFGFVLMGAIIGVWVKKAS |
| Ga0208241_10534582 | 3300027297 | Forest Soil | SYMYEMRPMQLFAINEFYSLVGLCLMGLILGAWMKKAA |
| Ga0209419_10717061 | 3300027537 | Forest Soil | VGPAAYTTYMFEMRPKQLFAINEFYVLVGLCLMGAILGAWTRKTVA |
| Ga0209527_10956011 | 3300027583 | Forest Soil | YTTYMYEMRPKQLFAINEFYSLVGLCLMGAILGAWTRKTPA |
| Ga0209733_11328253 | 3300027591 | Forest Soil | YMYEMRPKELFAINEFYPLAGLCLMGAILGAWTKKTA |
| Ga0209625_10127112 | 3300027635 | Forest Soil | VGPITYSTYMYEMRPWQLFAINEFYPLVGLCLMGAILGAWTKKAA |
| Ga0209736_10220483 | 3300027660 | Forest Soil | YEMRAKELFAINEFYPLAGLCLMGAILGAWKKKPA |
| Ga0209447_100785182 | 3300027701 | Bog Forest Soil | MYEMRPKALFAINEFYSLVGLCLMGAILGAWKKKIA |
| Ga0209689_11446002 | 3300027748 | Soil | GPITYTTYMYELRPWQLFAINQFYPLAGLCVMGAILGAWTKKAA |
| Ga0209274_100078095 | 3300027853 | Soil | TNYMFEMRPMQLFAINEFYSLAGLFLMGLILGAWTKKAA |
| Ga0209701_102368753 | 3300027862 | Vadose Zone Soil | MYEMRPKELFAINEFYSLVGLCLMGAILGAWTKKTA |
| Ga0209380_107773101 | 3300027889 | Soil | VGVLLWVGIVGPITFTTYMYEMRPHLLFAINEFYPLAGLVLMGSILGAWTKKTA |
| Ga0209624_100198616 | 3300027895 | Forest Soil | IVGPITLTTAMYEGRPLALFAINNFYPLVGLCLMGAILGAWTKKAA |
| Ga0209006_104314532 | 3300027908 | Forest Soil | NNCLGRISYMYEMRPKQLFAINEFYPLVGLCLMGAILGAWTRKPAA |
| Ga0209698_101420821 | 3300027911 | Watersheds | TYMYEMRPKELFAINEFYPLVGLCLMGLILGAWTKSK |
| Ga0209069_105880531 | 3300027915 | Watersheds | YEMRPKELFAINEFYPLVGLCLMGAILGAWTKKST |
| Ga0302177_101245864 | 3300030053 | Palsa | PITYTTNMYETRPVALYAINNFYPLVGLCLMGAILGAWTKKAA |
| Ga0311372_118955532 | 3300030520 | Palsa | TYMYEMRSMQLFAINEFYPLVGLCMMGAILGVWRSRSTAAS |
| Ga0302310_104376741 | 3300030737 | Palsa | IGIVGPITYTTNMYETRPVALYAINNFYPLVGLCLMGAILGAWTKKAA |
| Ga0265760_100524842 | 3300031090 | Soil | PVTFTTYMYEMRPMQLFAINEFYPLVGFCLMGAILGAWSRKAA |
| Ga0170823_133092131 | 3300031128 | Forest Soil | TYTTYMYEMRPKELFAINQFYPLAGLVLMGTIIGAWTKKSA |
| Ga0302326_1002598415 | 3300031525 | Palsa | YEGRPKMLFAINNFYPLAGLWLMGLLLGAWKKKSA |
| Ga0318516_106141202 | 3300031543 | Soil | GFVGPVTFTTYMYEMRPKELYAINQFFPLAGFVLMGAILGGWKKKSA |
| Ga0318573_105652862 | 3300031564 | Soil | VTFTTYMYEMRPKELYAINQFFPLAGFVLMGAILGGWKKKRA |
| Ga0307476_112105112 | 3300031715 | Hardwood Forest Soil | TYSTYMYEMRSRQLFAINEFYPLVGLCMMGAILGAWTKKAA |
| Ga0307474_115669501 | 3300031718 | Hardwood Forest Soil | EMRPNQLFAINEFYPLVGLCLMGAILGAWTRKTAA |
| Ga0307469_100169865 | 3300031720 | Hardwood Forest Soil | YEMRPQALFAINGFYPLVGFCLMGTILGAWTKKAA |
| Ga0307469_115529951 | 3300031720 | Hardwood Forest Soil | THMYEMRPKELFAINEFYPLVGLCLMGAILGAWTKKAA |
| Ga0306918_115749861 | 3300031744 | Soil | MYEARPKELFAINEFYPLAGLVLMGAIIGAWSKKSA |
| Ga0318546_108377762 | 3300031771 | Soil | QVTFTTYMYEMRPKELFAINQFYPLAGFVLMGVILGAWKKNA |
| Ga0318543_100252725 | 3300031777 | Soil | MYEMRPKELYAINQFFPLAGFVLMGAILGGWKKKRA |
| Ga0318576_101340921 | 3300031796 | Soil | FTTYMYEMRPKELYAINQFFPLAGFVLMGAILGGWKKKRA |
| Ga0307478_104085393 | 3300031823 | Hardwood Forest Soil | TFTTYMYEMRPKELFAINEFYPLAGLVLMGAIIGAWTKKSA |
| Ga0307478_112122642 | 3300031823 | Hardwood Forest Soil | GPVTYTNYMFEMRPIQLFAINEFYSLVGLFLMGLILGAWTKKAV |
| Ga0318511_102486222 | 3300031845 | Soil | GPVTFTTYMYEMRPKELFAINQFYPLAGFVLMGVILGAWKKNA |
| Ga0318536_101865441 | 3300031893 | Soil | GPVTFTTYMYEMRPKELYAINQFFPLAGFVLMGAILGGWKKKRA |
| Ga0306923_118909162 | 3300031910 | Soil | PITFTTYMYEMRPRTLFAINQFYPLAGLVLMGAIIGAWSKKSA |
| Ga0307479_100473651 | 3300031962 | Hardwood Forest Soil | GPITYTTYMYEMRPKELFAINQFYPLAGLVLMGTIIGAWTKKSA |
| Ga0307479_117595802 | 3300031962 | Hardwood Forest Soil | LVLIGFVGPITYSTYMYEMRPKELFAINEFYPLVGLCLMGTILGAWKKKAA |
| Ga0306922_120485742 | 3300032001 | Soil | MYEMRPWRLFAINQFYPLVGLALMGAILGAWTKKA |
| Ga0318563_105172622 | 3300032009 | Soil | TYMYEMRPKELYAINQFFPLAGFVLMGAILGGWKKKSA |
| Ga0318533_109925002 | 3300032059 | Soil | TYMYEMRPKELFAINQFYPLAGFVLMGMILGAWNKKA |
| Ga0318577_100767091 | 3300032091 | Soil | MYEMRPKELYAINQFFPLAGFVLMGAILGGWKKKSA |
| Ga0306920_1002039466 | 3300032261 | Soil | VTFTTYMYEMRPKELFAINQFYPLAGFVLMGVILGAWKKNA |
| Ga0306920_1022267401 | 3300032261 | Soil | TYMYEMRPRTLFAINQFYPLAGLVLMGAIIGAWSKKSA |
| Ga0335080_122859141 | 3300032828 | Soil | TLTTAIYEGRPMELFAINEFYPLVGLCVMGMILGAWKKKAA |
| Ga0335083_112371541 | 3300032954 | Soil | VGPIALMTYMFEMRPKALFAINEFYPLFGLVLMGAILGAWTKKAA |
| Ga0335076_100540021 | 3300032955 | Soil | YMFEMRSMQLFAINEFYPLVGLCLMGIILGAWQKKTA |
| Ga0335077_109910131 | 3300033158 | Soil | GIVGPITLTTAMYEGRPMKLFAINEFYPLVGLFVMGTILGAWKKKAA |
| Ga0335077_113887291 | 3300033158 | Soil | MYELRPPQLFAINQFYPLVGLCIMGAILGGWTKKAAPSA |
| Ga0310914_104174811 | 3300033289 | Soil | TYMYEMRPKELFAINQFYPLAGFVLMGVILGAWKKNA |
| Ga0326727_106393821 | 3300033405 | Peat Soil | ISFMNYMFEMRPKELFAINEFYPLAGLVLMGAILGAWTKKIV |
| Ga0371487_0092529_7_126 | 3300033982 | Peat Soil | MTYMFEMRPRALYAINEFYPLAGLILMGAILGAWKKKAA |
| ⦗Top⦘ |