


| Basic Information | |
|---|---|
| Family ID | F050535 |
| Family Type | Metagenome |
| Number of Sequences | 145 |
| Average Sequence Length | 45 residues |
| Representative Sequence | EPDELIPGRRASRARVIAAGLTDDDIDRLIKQAQKEVEPRAG |
| Number of Associated Samples | 126 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 6.21 % |
| % of genes near scaffold ends (potentially truncated) | 89.66 % |
| % of genes from short scaffolds (< 2000 bps) | 91.03 % |
| Associated GOLD sequencing projects | 121 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.310 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.931 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.690 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.724 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.43% β-sheet: 0.00% Coil/Unstructured: 58.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF13470 | PIN_3 | 47.59 |
| PF16078 | 2-oxogl_dehyd_N | 2.76 |
| PF01934 | HepT-like | 2.07 |
| PF00589 | Phage_integrase | 1.38 |
| PF01850 | PIN | 1.38 |
| PF13358 | DDE_3 | 1.38 |
| PF13366 | PDDEXK_3 | 1.38 |
| PF00817 | IMS | 1.38 |
| PF00773 | RNB | 0.69 |
| PF00072 | Response_reg | 0.69 |
| PF02604 | PhdYeFM_antitox | 0.69 |
| PF13091 | PLDc_2 | 0.69 |
| PF04607 | RelA_SpoT | 0.69 |
| PF05016 | ParE_toxin | 0.69 |
| PF00034 | Cytochrom_C | 0.69 |
| PF13776 | DUF4172 | 0.69 |
| PF13602 | ADH_zinc_N_2 | 0.69 |
| PF05015 | HigB-like_toxin | 0.69 |
| PF00152 | tRNA-synt_2 | 0.69 |
| PF13549 | ATP-grasp_5 | 0.69 |
| PF15738 | YafQ_toxin | 0.69 |
| PF01609 | DDE_Tnp_1 | 0.69 |
| PF14384 | BrnA_antitoxin | 0.69 |
| PF01909 | NTP_transf_2 | 0.69 |
| PF07584 | BatA | 0.69 |
| PF00355 | Rieske | 0.69 |
| PF13151 | DUF3990 | 0.69 |
| PF00248 | Aldo_ket_red | 0.69 |
| PF01381 | HTH_3 | 0.69 |
| PF00239 | Resolvase | 0.69 |
| PF07719 | TPR_2 | 0.69 |
| PF13683 | rve_3 | 0.69 |
| PF07311 | Dodecin | 0.69 |
| PF05973 | Gp49 | 0.69 |
| PF00083 | Sugar_tr | 0.69 |
| PF02558 | ApbA | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG2361 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 2.07 |
| COG2445 | Uncharacterized HEPN domain protein YutE, UPF0331/DUF86 family | General function prediction only [R] | 2.07 |
| COG0389 | Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair | Replication, recombination and repair [L] | 1.38 |
| COG0017 | Aspartyl/asparaginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| COG0173 | Aspartyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| COG0557 | Exoribonuclease R | Transcription [K] | 0.69 |
| COG1190 | Lysyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.69 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.69 |
| COG2269 | Elongation factor P--beta-lysine ligase (EF-P beta-lysylation pathway) | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.69 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.69 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.69 |
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 0.69 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.69 |
| COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.69 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.69 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.69 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.69 |
| COG4776 | Exoribonuclease II | Transcription [K] | 0.69 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.69 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.69 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.00 % |
| Unclassified | root | N/A | 20.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2035918004|FACENC_F56XM5W01B20CU | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 509 | Open in IMG/M |
| 2170459023|GZGNO2B01DG2JU | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300000574|JGI1357J11328_10087999 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300001449|JGI20208J14878_1007159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Defluviicoccus → Defluviicoccus vanus | 1565 | Open in IMG/M |
| 3300001449|JGI20208J14878_1009771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1227 | Open in IMG/M |
| 3300001545|JGI12630J15595_10078886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 647 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100574318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1004 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100897422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 768 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100963588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 737 | Open in IMG/M |
| 3300003219|JGI26341J46601_10190144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300004082|Ga0062384_101174200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 557 | Open in IMG/M |
| 3300004092|Ga0062389_103652343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 577 | Open in IMG/M |
| 3300005179|Ga0066684_10071108 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2059 | Open in IMG/M |
| 3300005366|Ga0070659_101294228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 646 | Open in IMG/M |
| 3300005435|Ga0070714_100961745 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 830 | Open in IMG/M |
| 3300005436|Ga0070713_101039459 | Not Available | 791 | Open in IMG/M |
| 3300005458|Ga0070681_11928031 | Not Available | 518 | Open in IMG/M |
| 3300005559|Ga0066700_10732797 | Not Available | 674 | Open in IMG/M |
| 3300005563|Ga0068855_100797386 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300005569|Ga0066705_10102374 | All Organisms → cellular organisms → Bacteria | 1705 | Open in IMG/M |
| 3300005602|Ga0070762_10788372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 642 | Open in IMG/M |
| 3300005614|Ga0068856_102542284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300005764|Ga0066903_100140631 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3432 | Open in IMG/M |
| 3300006104|Ga0007882_10032702 | Not Available | 2265 | Open in IMG/M |
| 3300006175|Ga0070712_101169503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 669 | Open in IMG/M |
| 3300006800|Ga0066660_10595193 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300006893|Ga0073928_10754608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 675 | Open in IMG/M |
| 3300007258|Ga0099793_10115766 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
| 3300007788|Ga0099795_10509178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 562 | Open in IMG/M |
| 3300009012|Ga0066710_104237274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300009088|Ga0099830_11563808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 549 | Open in IMG/M |
| 3300009090|Ga0099827_11237819 | Not Available | 649 | Open in IMG/M |
| 3300009510|Ga0116230_11162993 | Not Available | 558 | Open in IMG/M |
| 3300009551|Ga0105238_11150653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 799 | Open in IMG/M |
| 3300009701|Ga0116228_10633718 | Not Available | 724 | Open in IMG/M |
| 3300010048|Ga0126373_10149952 | All Organisms → cellular organisms → Bacteria | 2215 | Open in IMG/M |
| 3300010048|Ga0126373_11165988 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300010343|Ga0074044_10390184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 912 | Open in IMG/M |
| 3300010343|Ga0074044_11020549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300010360|Ga0126372_13263634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300010361|Ga0126378_12214522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 627 | Open in IMG/M |
| 3300010362|Ga0126377_12300171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 615 | Open in IMG/M |
| 3300010366|Ga0126379_10570078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1214 | Open in IMG/M |
| 3300010376|Ga0126381_101821027 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300010376|Ga0126381_102093034 | Not Available | 815 | Open in IMG/M |
| 3300010391|Ga0136847_10669565 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1152 | Open in IMG/M |
| 3300010396|Ga0134126_12775885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300010398|Ga0126383_12774700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 572 | Open in IMG/M |
| 3300011119|Ga0105246_12173148 | Not Available | 539 | Open in IMG/M |
| 3300012096|Ga0137389_11196022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 651 | Open in IMG/M |
| 3300012189|Ga0137388_11196670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 698 | Open in IMG/M |
| 3300012205|Ga0137362_10681511 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300012208|Ga0137376_10801912 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 810 | Open in IMG/M |
| 3300012209|Ga0137379_11508334 | Not Available | 573 | Open in IMG/M |
| 3300012362|Ga0137361_11971982 | Not Available | 500 | Open in IMG/M |
| 3300012685|Ga0137397_10721665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 740 | Open in IMG/M |
| 3300012923|Ga0137359_10517242 | Not Available | 1052 | Open in IMG/M |
| 3300012925|Ga0137419_10586789 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300012930|Ga0137407_11944180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300012958|Ga0164299_11481759 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosotalea → unclassified Candidatus Nitrosotalea → Candidatus Nitrosotalea sp. FS | 528 | Open in IMG/M |
| 3300012989|Ga0164305_11308028 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300013296|Ga0157374_11126639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 805 | Open in IMG/M |
| 3300014200|Ga0181526_10141671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1541 | Open in IMG/M |
| 3300014499|Ga0182012_10159146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1621 | Open in IMG/M |
| 3300016270|Ga0182036_10425041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1040 | Open in IMG/M |
| 3300016294|Ga0182041_10383956 | Not Available | 1190 | Open in IMG/M |
| 3300016341|Ga0182035_11281767 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300016371|Ga0182034_11021195 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300017975|Ga0187782_11167964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 602 | Open in IMG/M |
| 3300018016|Ga0187880_1386033 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300018030|Ga0187869_10432467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 626 | Open in IMG/M |
| 3300018083|Ga0184628_10377608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 742 | Open in IMG/M |
| 3300018476|Ga0190274_10371781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1371 | Open in IMG/M |
| 3300020199|Ga0179592_10343515 | Not Available | 658 | Open in IMG/M |
| 3300020579|Ga0210407_10517008 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 933 | Open in IMG/M |
| 3300020580|Ga0210403_10700985 | Not Available | 811 | Open in IMG/M |
| 3300020581|Ga0210399_10976750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 683 | Open in IMG/M |
| 3300020583|Ga0210401_10014749 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7564 | Open in IMG/M |
| 3300021178|Ga0210408_10820541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. Root381 | 727 | Open in IMG/M |
| 3300021178|Ga0210408_10822524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 726 | Open in IMG/M |
| 3300021362|Ga0213882_10079476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1317 | Open in IMG/M |
| 3300021384|Ga0213876_10170204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1159 | Open in IMG/M |
| 3300021388|Ga0213875_10664224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300021403|Ga0210397_10071785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila | 2271 | Open in IMG/M |
| 3300021406|Ga0210386_10437756 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300021407|Ga0210383_10708738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 865 | Open in IMG/M |
| 3300021478|Ga0210402_11176966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 694 | Open in IMG/M |
| 3300021479|Ga0210410_10943596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 751 | Open in IMG/M |
| 3300021559|Ga0210409_11188689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 638 | Open in IMG/M |
| 3300021560|Ga0126371_12518909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 623 | Open in IMG/M |
| 3300021560|Ga0126371_13750449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300025162|Ga0209083_1244303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 653 | Open in IMG/M |
| 3300025583|Ga0210085_1001248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Lamprocystis → Lamprocystis purpurea | 10220 | Open in IMG/M |
| 3300025912|Ga0207707_11576431 | Not Available | 518 | Open in IMG/M |
| 3300025917|Ga0207660_10898171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 723 | Open in IMG/M |
| 3300025931|Ga0207644_11622804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300025932|Ga0207690_11092548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 665 | Open in IMG/M |
| 3300027651|Ga0209217_1107693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 793 | Open in IMG/M |
| 3300027745|Ga0209908_10176742 | Not Available | 574 | Open in IMG/M |
| 3300027895|Ga0209624_10201996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 1320 | Open in IMG/M |
| 3300027895|Ga0209624_11120093 | Not Available | 506 | Open in IMG/M |
| 3300027908|Ga0209006_10063376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila | 3302 | Open in IMG/M |
| 3300027908|Ga0209006_10464679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1059 | Open in IMG/M |
| 3300028882|Ga0302154_10591021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300029883|Ga0311327_10282790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1087 | Open in IMG/M |
| 3300029911|Ga0311361_11455790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300029913|Ga0311362_11332351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300029914|Ga0311359_10486824 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 943 | Open in IMG/M |
| 3300029939|Ga0311328_10286512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1226 | Open in IMG/M |
| 3300029945|Ga0311330_10434564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1077 | Open in IMG/M |
| 3300029951|Ga0311371_11800669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 662 | Open in IMG/M |
| 3300029990|Ga0311336_10883800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 772 | Open in IMG/M |
| 3300031520|Ga0272428_1203750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 969 | Open in IMG/M |
| 3300031543|Ga0318516_10705136 | Not Available | 573 | Open in IMG/M |
| 3300031546|Ga0318538_10121104 | Not Available | 1366 | Open in IMG/M |
| 3300031573|Ga0310915_10505750 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium HCH-1 | 858 | Open in IMG/M |
| 3300031671|Ga0307372_10587602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Cohaesibacteraceae → Cohaesibacter | 502 | Open in IMG/M |
| 3300031708|Ga0310686_100670331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4372 | Open in IMG/M |
| 3300031708|Ga0310686_105423035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 563 | Open in IMG/M |
| 3300031708|Ga0310686_118424766 | Not Available | 589 | Open in IMG/M |
| 3300031719|Ga0306917_10156044 | Not Available | 1698 | Open in IMG/M |
| 3300031736|Ga0318501_10426046 | Not Available | 719 | Open in IMG/M |
| 3300031765|Ga0318554_10449127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 731 | Open in IMG/M |
| 3300031771|Ga0318546_10296193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1119 | Open in IMG/M |
| 3300031779|Ga0318566_10628031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300031833|Ga0310917_10161136 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1486 | Open in IMG/M |
| 3300031879|Ga0306919_10040666 | Not Available | 3012 | Open in IMG/M |
| 3300031879|Ga0306919_11417729 | Not Available | 524 | Open in IMG/M |
| 3300031910|Ga0306923_10184380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2384 | Open in IMG/M |
| 3300031946|Ga0310910_10220635 | Not Available | 1475 | Open in IMG/M |
| 3300031946|Ga0310910_10331643 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1200 | Open in IMG/M |
| 3300031946|Ga0310910_10579830 | Not Available | 889 | Open in IMG/M |
| 3300031954|Ga0306926_10094179 | All Organisms → cellular organisms → Bacteria | 3664 | Open in IMG/M |
| 3300031954|Ga0306926_10748369 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
| 3300031954|Ga0306926_12448412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 574 | Open in IMG/M |
| 3300032041|Ga0318549_10360733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 655 | Open in IMG/M |
| 3300032052|Ga0318506_10103451 | Not Available | 1219 | Open in IMG/M |
| 3300032063|Ga0318504_10458197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 610 | Open in IMG/M |
| 3300032180|Ga0307471_101909589 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300032205|Ga0307472_101126306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 745 | Open in IMG/M |
| 3300032805|Ga0335078_11468470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 765 | Open in IMG/M |
| 3300032895|Ga0335074_10060837 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 5153 | Open in IMG/M |
| 3300032895|Ga0335074_11091219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 689 | Open in IMG/M |
| 3300032895|Ga0335074_11540174 | Not Available | 525 | Open in IMG/M |
| 3300033134|Ga0335073_11911686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 548 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.93% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.34% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.59% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.21% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 4.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.14% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.76% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.07% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.07% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.38% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.38% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.38% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.38% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.38% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.38% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 1.38% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.38% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 1.38% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.69% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.69% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.69% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.69% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.69% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.69% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.69% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.69% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.69% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.69% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.69% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.69% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.69% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.69% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.69% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.69% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.69% |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 0.69% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2035918004 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2- | Environmental | Open in IMG/M |
| 2170459023 | Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition) | Environmental | Open in IMG/M |
| 3300000574 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m | Environmental | Open in IMG/M |
| 3300001449 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 shallow | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006104 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009510 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009701 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025162 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025583 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028882 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031520 | Rock endolithic microbial communities from Victoria Land, Antarctica - Finger Mt nord | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031671 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-1 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACENCA_6725480 | 2035918004 | Soil | AFRHLTIPGRREARARVIAAGLTDEDIDRLIEEARKEAQPLLG |
| FA3_03562290 | 2170459023 | Grass Soil | LIPGRVESRALVISAGLTDEDIDRLVKQAQQEVEPLLE |
| JGI1357J11328_100879991 | 3300000574 | Groundwater | EPEQELIPGRRASRALVVAAGLTDADIDRLVKRAQQKTGQSAR* |
| JGI20208J14878_10071593 | 3300001449 | Arctic Peat Soil | RRGIGSDEKVILTIEPEREIIPGRRASRARVVARVVAAGLTDDDIDRLIKQAQRDVEPRLG* |
| JGI20208J14878_10097711 | 3300001449 | Arctic Peat Soil | EPEREVIPGRRASCARVVAAGLSDDDIDRLIKQAQKDVEPSLG* |
| JGI12630J15595_100788861 | 3300001545 | Forest Soil | DELIPGRREARARVVAAGLTDEDIDRLINEARTEAQSLIE* |
| JGIcombinedJ26739_1005743182 | 3300002245 | Forest Soil | LLASRGLDPDDRVTSTIEPDELIPGRRASRARVIAAGLTDDDIDRLIKQAQKEVEPRVG* |
| JGIcombinedJ26739_1008974222 | 3300002245 | Forest Soil | TIQPDELIPGRREARLRVIAAGLTDDDIDRLIDEARTEAQPLIR* |
| JGIcombinedJ26739_1009635881 | 3300002245 | Forest Soil | RVTLTIQPQREVLPGRRQSRAHVVAAGLTDDDIDRLIKQAQREIEPPPG* |
| JGI26341J46601_101901441 | 3300003219 | Bog Forest Soil | IEPNQELIPGRRESRARVVAAGLSDDDIDRLIKRAQHEVEPRLG* |
| Ga0062384_1011742002 | 3300004082 | Bog Forest Soil | TITIEPDELIPGRRACRARVIAAGLTDEDIDRLIDEARTEAQPPLG* |
| Ga0062389_1036523431 | 3300004092 | Bog Forest Soil | RGLDPNDRVTITIEPNELIPGRREARARVISAGLTDDDIDRMIKQAQKEVEPLLE* |
| Ga0066684_100711083 | 3300005179 | Soil | QADELIPGRREARLRVVAAGLTDDDIDRLIKQAQHEVEPRAG* |
| Ga0070659_1012942281 | 3300005366 | Corn Rhizosphere | TVTIQADQLIPGRREARLRVVAAGLSDDDIDRLIDEARTEAQPLIR* |
| Ga0070714_1009617454 | 3300005435 | Agricultural Soil | LRRRGISSDERVIVTLDLDKELIPGRRESRARVVAAGLSDDDIDRLIKDAQHAVEPRLG* |
| Ga0070713_1010394591 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | TITIEPDELIPGRREARARVVAAGLTDEDIDRLIDEVRTEAQPLLE* |
| Ga0070681_119280312 | 3300005458 | Corn Rhizosphere | PQDRVTVTIQADQLIPGRREARLRVVAAGLSDDDIDRLIDEARTEAQPLIR* |
| Ga0066700_107327972 | 3300005559 | Soil | DPDDRVTIMIEPDELIPGRRASRARVIAAGLSDDDIDRLIKQAQKEVEPRAG* |
| Ga0068855_1007973861 | 3300005563 | Corn Rhizosphere | DRELIPGRRESRARVVAAGLSDDDIDRLIKQAQHEVESKLG* |
| Ga0066705_101023741 | 3300005569 | Soil | IQADELIPGRREARLRVVAAGLTDDDIDRLIKQAQHEVEPRAG* |
| Ga0070762_107883721 | 3300005602 | Soil | IGPDDRITITIEPEQELIPGRRQSRAVVIAAGLTDDDIDRLIKQAQQEVEPLLG* |
| Ga0068856_1025422841 | 3300005614 | Corn Rhizosphere | DRITITIEPDELIPGRRASRARVIAAGLTDDDIDRLIKQAQKEVEPRAG* |
| Ga0066903_1001406316 | 3300005764 | Tropical Forest Soil | HDRVTVTIEPDEAIPGRREARPRVIAAGLIDDDIDRLIKQAQKEVEPLLE* |
| Ga0007882_100327021 | 3300006104 | Freshwater | PGRREARARVVAAGLTDDDIDGLIKQDQREVEPSLL* |
| Ga0070712_1011695031 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GLDPQDRVTVTIQADQLIPGRREARLRVVAAGLSDDDIDRLIDEARTEAQPLIR* |
| Ga0066660_105951933 | 3300006800 | Soil | RREARLRVIAAGLTDDDIDRLIDEARTEAQPLIR* |
| Ga0073928_107546081 | 3300006893 | Iron-Sulfur Acid Spring | ELIPGRRESRARVAAAGLTDDDIDRLVKEAQREVEPRRPG* |
| Ga0099793_101157663 | 3300007258 | Vadose Zone Soil | VRGGLDPRDHVTITIELDEAIPGRREARARVMVTGLTDEDIDRLIEEARKEAQPPLG* |
| Ga0099795_105091782 | 3300007788 | Vadose Zone Soil | DELIPGRREARLRVIAAGLTDDDIDRLIKQAQHEVEPSAG* |
| Ga0066710_1042372742 | 3300009012 | Grasslands Soil | IPGRREARARVIAAGLSDEDIDRLIKHAQQEVEPR |
| Ga0099830_115638082 | 3300009088 | Vadose Zone Soil | ADELIPGRREARLRVTAAGLTDDDIDRLIDEARTEAQPLIR* |
| Ga0099827_112378192 | 3300009090 | Vadose Zone Soil | LPPSWRAGTLDPEDRVTITIEPDELIPGRRASRARVIAAGLTDDDIDRLIKQAQKE |
| Ga0116230_111629932 | 3300009510 | Host-Associated | ELSRLGIGPGERVTVMIDQSHELVPGRRDSRARVIAAGLSDDDIDRLIKEARREVEPPIL |
| Ga0105238_111506531 | 3300009551 | Corn Rhizosphere | MIPGRRASRARVVAAGLSDDDIDRLIKQAQREVEPLLPG* |
| Ga0116228_106337182 | 3300009701 | Host-Associated | ERVTLTIEAPQELIPGRRASRARVVAAGLTDSDIDRLVKQAQKEVEPRAE* |
| Ga0126373_101499524 | 3300010048 | Tropical Forest Soil | RSVSAARVVAAGLTDEDIDRPIKQAQKEVEPRAG* |
| Ga0126373_111659881 | 3300010048 | Tropical Forest Soil | TIEPDELIPGRRDARVRVIAAGLSDEDIDRLIDEARAEAQPLLG* |
| Ga0074044_103901842 | 3300010343 | Bog Forest Soil | PEQEWIPGRRESRARVVAACLTDDHVDRLIKQAQREVAPPIRWG* |
| Ga0074044_110205492 | 3300010343 | Bog Forest Soil | VTLTIEPQPELIPGRRESRARVVAAGLTDDDIDRLIKQAQHEVEPPPV* |
| Ga0126372_132636341 | 3300010360 | Tropical Forest Soil | LIPGRRETRARVVAAGLSDDDIDRLIKRAQHEVEPRIG* |
| Ga0126378_122145222 | 3300010361 | Tropical Forest Soil | LDAHDRITVTIDADELIPGRRAARARVVAAGLSDEDIDRLIDEARTEAQPHLG* |
| Ga0126377_123001711 | 3300010362 | Tropical Forest Soil | PGRRASRARVVAAGLTDDDIDRLIKQAQKEVEPRAG* |
| Ga0126379_105700781 | 3300010366 | Tropical Forest Soil | PGRREARARVIAAGLTDDDIDRLIKQAQKEVEPLLG* |
| Ga0126381_1018210271 | 3300010376 | Tropical Forest Soil | DRVTITIEPDELIPGRRASRARVVAAGLTDDDIDRLIKQAQKEVEPRAG* |
| Ga0126381_1020930342 | 3300010376 | Tropical Forest Soil | LALRGLDPHDRVTTTIEPDELIPGRRASRARVIAAGLTDDDIDRLIKQAQEEVEPRAG* |
| Ga0136847_106695651 | 3300010391 | Freshwater Sediment | LIPGRREARARVIAAGLTDDDIDRMIKQAQQEVEPRAG* |
| Ga0134126_127758852 | 3300010396 | Terrestrial Soil | EPDELIPGRRASRARVIAAGLTDDDIDRLIKQAQKEVEPRAG* |
| Ga0126383_127747002 | 3300010398 | Tropical Forest Soil | MSWIPGRREARARVIAAGLTDEDIDRLIKQAQQEVEPRPE* |
| Ga0105246_121731481 | 3300011119 | Miscanthus Rhizosphere | RREARARVVAAGLTDEDIDRLIDEVRTEAQPLLE* |
| Ga0137389_111960222 | 3300012096 | Vadose Zone Soil | RREARLRVTAAGLTDDDIDRLIDEARTEAQPLIR* |
| Ga0137388_111966702 | 3300012189 | Vadose Zone Soil | IPGRREARALVVAAGLTDQDIDRLINEARTEAQPLLG* |
| Ga0137362_106815113 | 3300012205 | Vadose Zone Soil | DDRVTITIEPDELIPGRRASRARVIAAGLTDDDIDRLIKQAQKEVEPRVG* |
| Ga0137376_108019121 | 3300012208 | Vadose Zone Soil | GRREARLRVVAAGLTDDDIDRLIDEARTEAQPLIR* |
| Ga0137379_115083342 | 3300012209 | Vadose Zone Soil | IPGRRESRARVVAAGLTDDDIDRLIKQAQREVEPLLPR* |
| Ga0137361_119719822 | 3300012362 | Vadose Zone Soil | MIEPDEAIPGRRKARARVIAAGLTDEDIDRLIEEARKEAQPLLG* |
| Ga0137397_107216651 | 3300012685 | Vadose Zone Soil | DQELIPGRRQSRALVIIAGLTDDDIDRLIKQAQREVEPLLG* |
| Ga0137359_105172422 | 3300012923 | Vadose Zone Soil | IQPDGLIPGRREARLRVIAAGLTDDDIDRLIKQAQTEAQPLIR* |
| Ga0137419_105867893 | 3300012925 | Vadose Zone Soil | DPQDRVTITIQPDELIPGRREARLRVIAAGLSDEDIDRLIKQAQHEIEPSAG* |
| Ga0137407_119441802 | 3300012930 | Vadose Zone Soil | DRVTITIEPDELIPGRRASRARVIAAGLTDDDIDRLIKQAQKGVEPLLG* |
| Ga0164299_114817591 | 3300012958 | Soil | MITIEPDELVPGRRATRARVIDAGLNDEDIDRLIKQAQQEVEPHAE* |
| Ga0164305_113080281 | 3300012989 | Soil | VTLTIEPELIPGRRESRKLVIAAGLTDDDIDALIKRAQREVEPPLPR* |
| Ga0157374_111266392 | 3300013296 | Miscanthus Rhizosphere | ELARRGLDPQDRVTVTIQADQLIPGRREARLRVVAAGLSDDDIDRLIDEARTEAQPLIR* |
| Ga0181526_101416713 | 3300014200 | Bog | MIAPEQEWIPGRRESRARVVVAGLTDGDIDRLIKQAQREVEPPSE* |
| Ga0182012_101591461 | 3300014499 | Bog | RRGISSDERVTLTIEPERELIPGRRESRTKVVAGGLSDADIDWLVKQAQHEVEPRIA* |
| Ga0182036_104250411 | 3300016270 | Soil | PGRRASRARVIAAGLSDDDIDRLIKQAQKEVEPRAR |
| Ga0182041_103839564 | 3300016294 | Soil | TIMIEPDELIPGRRASRARVIAAGLTDEDIDRLIKQAQKEVEPRTG |
| Ga0182035_112817671 | 3300016341 | Soil | MASECEAIETIEPDQLIPGRRLSRARVMAAGLTDDGIDRLIKQEVEP |
| Ga0182034_110211951 | 3300016371 | Soil | AIETIEPDQLIPGRRLSRARVIAAGLTDDDIDRLIKQEVEPLIR |
| Ga0187782_111679642 | 3300017975 | Tropical Peatland | GDGAIHRGSRRLVIAAGLSDDDIDRLINQARTEVQPRSG |
| Ga0187880_13860331 | 3300018016 | Peatland | GRKESRARVVAAGLTDKDIERLIEEAREEVQPHLG |
| Ga0187869_104324671 | 3300018030 | Peatland | PGRRESRKLVIAAGLTDDDIEALIKRAQKEVEPLLPR |
| Ga0184628_103776081 | 3300018083 | Groundwater Sediment | IPGRRASRARVIAAGLTDDDIDRMIKQAQKEVEPLPG |
| Ga0190274_103717811 | 3300018476 | Soil | MSVTVTIQPNELIPGRREARIRVIAAGLTDDDIDRLIDEARTEAQPLIR |
| Ga0179592_103435153 | 3300020199 | Vadose Zone Soil | EPVSCGLDPDDRVTITIEPDELIPGRRASRARVIAAGLTDDDIDRLIKQAQKEVEPLLG |
| Ga0210407_105170083 | 3300020579 | Soil | DELIPGRREARARVVAAGLTDEDIDRLINEAREEAQSLLG |
| Ga0210403_107009853 | 3300020580 | Soil | RGDDRVPITIHPDELTPAGARHGRRVIAASLTDDDIDRLIKQEQKEVEPLLG |
| Ga0210399_109767501 | 3300020581 | Soil | PDELIPGRRASRARVVAAGLSDDDIDRLIKQAQKEVEPRAG |
| Ga0210401_100147491 | 3300020583 | Soil | RQPDELFPGRRASRARVIAAGLTDDDIDRLIKQAQKEVEPRAG |
| Ga0210408_108205413 | 3300021178 | Soil | DEAIPGRREARARVIAAGLTDDDIDRLIEEARKEAKPLLG |
| Ga0210408_108225242 | 3300021178 | Soil | PEGTRQPDELFPGRRASRARVIAAGLTDDDIDRLIKQAQKEVEPRAG |
| Ga0213882_100794761 | 3300021362 | Exposed Rock | RGIGSDERVVVTIEQGQQLIPGRRESRARIVAAGLSDDDIDRLVKQAQKEVEPRAG |
| Ga0213876_101702041 | 3300021384 | Plant Roots | VLVRRVTVKFEPDELIPGRRETRLRVVAAGLTDEDIDRLIEEARTEAQPLIK |
| Ga0213875_106642242 | 3300021388 | Plant Roots | AELKRRGIGSDEKVTLTIEAEREIIPGRRASRARVVAAGLSDDDIDRLIKQAQKDVEPLL |
| Ga0210397_100717851 | 3300021403 | Soil | LPAEELIPGRRESRARVVVAGFTDDDIDRLIKQAQREVEPHVE |
| Ga0210386_104377561 | 3300021406 | Soil | EELKRQGIGPDERVTLTIEPELFPGRRESRRLVIAAGLTDDDIDRLIEQAREEVAPRLG |
| Ga0210383_107087381 | 3300021407 | Soil | IPGRRESRARVVVAGLTDGDVDRLIKRAQREVEPSIE |
| Ga0210402_111769661 | 3300021478 | Soil | PDELIPGRRASRARVVAAGLTDDDIDRLIKQAQKEVEPRAG |
| Ga0210410_109435963 | 3300021479 | Soil | IEPDELIPGRRASRARVIAAGLSDDDIDRLIKQAQKEVEPRVG |
| Ga0210409_111886891 | 3300021559 | Soil | DEPIPGRRASRARVIAAGLTDDDIDRLIKQAQKEVEPRVG |
| Ga0126371_125189092 | 3300021560 | Tropical Forest Soil | DLHDRVTITIELDERIPGRRATRARVIAAGLTDEDIDRLIKQAQREVEPHAE |
| Ga0126371_137504491 | 3300021560 | Tropical Forest Soil | PGRRESRAHVVAAGLSDDDIDRLIKQAQKEVAPGIR |
| Ga0209083_12443033 | 3300025162 | Freshwater | TVTIDQEPELIPGRREARARVVAAGLTDEDIDGLIKQAQKEVEPGLL |
| Ga0210085_100124810 | 3300025583 | Natural And Restored Wetlands | PGRREARARVIAAGLSDADIDQWIDEARTEAQPLLG |
| Ga0207707_115764312 | 3300025912 | Corn Rhizosphere | PQDRVTVTIQADQLIPGRREARLRVVAAGLSDDDIDRLIDEARTEAQPLIR |
| Ga0207660_108981711 | 3300025917 | Corn Rhizosphere | LKRRGISSDERVTLTIEADRELIPGRRESRARVVAAGLSDDDIDRLIKQAQHEVESKLG |
| Ga0207644_116228041 | 3300025931 | Switchgrass Rhizosphere | LIPGRREARLRVVAAGLSDDDIDRLIDEARTEAQPLIR |
| Ga0207690_110925482 | 3300025932 | Corn Rhizosphere | VTVTIQADQLIPGRREARLRVVAAGLSDDDIDRLIDEARTEAQPLIR |
| Ga0209217_11076932 | 3300027651 | Forest Soil | LLASRGLDPDDRVTSTIEPDELIPGRRASRARVIAAGLTDDDIDRLIKQAQKEVEPRVG |
| Ga0209908_101767422 | 3300027745 | Thawing Permafrost | TIEPEREMIPGWRESRARVVAAGLTDADIDRLIKRAQHEVEHPLG |
| Ga0209624_102019964 | 3300027895 | Forest Soil | ARRGIGSDERVTLTIQPQREVLPGRRQSRAHVVAAGLTDDDIDRLIKQAQREIEPPPG |
| Ga0209624_111200932 | 3300027895 | Forest Soil | EAQGIGADERVTLTILPADELIPGRRESRARVVVAGFTDDDIDRLIKQAQTEVEPHVE |
| Ga0209006_100633762 | 3300027908 | Forest Soil | VTLTILPAEELIPGRRESRARVVVAGFTDDDIDRLIKQAQTEVEPHVE |
| Ga0209006_104646791 | 3300027908 | Forest Soil | GRRASRAKVVAAGLTDDDIDRLIKQAQKEVEPSIEATQFAN |
| Ga0302154_105910212 | 3300028882 | Bog | PKRELIPGRRESRARVVAAGLTDADIDGLIKDAQREVG |
| Ga0311327_102827901 | 3300029883 | Bog | RGISSDERVILTIESEQELIPGRRPSRAQVVAAGLTDDDIDRLVKQAQKDVEPRV |
| Ga0311361_114557901 | 3300029911 | Bog | ELIPGRRESRKLVIAAGLTDDDIDRLIKQAQHEVEPFLPR |
| Ga0311362_113323512 | 3300029913 | Bog | LIPGRRESRKLVIAAGLTDDDIDKLIKRAQHEVEPLLPR |
| Ga0311359_104868243 | 3300029914 | Bog | AILTIAPEQELIPGRRASRALAAAAGLSDDDIDRLIKDAQRDDQP |
| Ga0311328_102865121 | 3300029939 | Bog | RVTLTVEPELIPGRRESRKLVIAAGLTDDDIDRLIKQAQHEVEPFLPR |
| Ga0311330_104345641 | 3300029945 | Bog | DERVILTIESEQELIPGRRPSRAQVVAAGLTDDDIDRLVKQAQKDVEPRV |
| Ga0311371_118006692 | 3300029951 | Palsa | RVIVTIEPELIPGRRESRARVIAAGLSDDDIDRLIKQAQREVEPLLPK |
| Ga0311336_108838001 | 3300029990 | Fen | RRASRKLVIAAGLTDDDIDNLIKRAQQEVEPLLPR |
| Ga0272428_12037502 | 3300031520 | Rock | DERVTLTIEPEQEFIPGRRESRARVVTAGLTDADIDRLIKQAQHEVEPKLG |
| Ga0318516_107051362 | 3300031543 | Soil | IEPDELIPGRRASRARVIAAGLTDEDIDRLIKQAQKEVEPRAG |
| Ga0318538_101211043 | 3300031546 | Soil | MIEPDELIPGRRASRARVIAAGLTDDDIDRLIKQAQKEVEPRTG |
| Ga0310915_105057501 | 3300031573 | Soil | WPMASECEAIETIEPDQLIPGRRLSRARVMAAGLTDDDIDRLIKQEVEPLIR |
| Ga0307372_105876022 | 3300031671 | Soil | PYDRVTVTIEPDELIPGRREARARVIAAGLNDADIDRLIDEARTEAQPLLG |
| Ga0310686_1006703316 | 3300031708 | Soil | LDLLSCLPRLVSEDRVTITIGPDELIPGRRAARARVIAAGLSHDDIDRLIKQAQREIEPRAG |
| Ga0310686_1054230351 | 3300031708 | Soil | TIEAENEIFPGRRASRARVVAAGYSDEDIDRLIKQAQKDVELG |
| Ga0310686_1184247661 | 3300031708 | Soil | MITIEPDELIRGRRASRARVIAAALTDDGIDRLIKRAQKEVAPSAG |
| Ga0306917_101560443 | 3300031719 | Soil | MASECEAIETIEPDQLIPGRRLSRARVMAAGLTDDDIDRLIKQEV |
| Ga0318501_104260461 | 3300031736 | Soil | LIPGRRASRARVIAAGLTDEDIDRLIKQAQKEVEPRAG |
| Ga0318554_104491271 | 3300031765 | Soil | PDDRVTITIEPDELIPGRRASRARVIAAGLSDDDIDRLIKQAQKEVEPRAR |
| Ga0318546_102961931 | 3300031771 | Soil | DELIPGRRASRARVIAAGLTDDDIDRLIKQAQKEVEPPRVG |
| Ga0318566_106280312 | 3300031779 | Soil | AMTRASRARVIAAGLTDDDIDRLIKQAQKEVEPPRVG |
| Ga0310917_101611365 | 3300031833 | Soil | PDELIPGRRASRARVIAAGLSDDDIDRLIKQAQKEVEPRAR |
| Ga0306919_100406665 | 3300031879 | Soil | IMIEPDELIPGRRASRARVIAAGLTDEDIDRLIKQAQKEVEPRAG |
| Ga0306919_114177292 | 3300031879 | Soil | MASECEAIETIEPDQLIPGRRLSRARVMAAGLTDDDIDRLIKQEVEPLIR |
| Ga0306923_101843801 | 3300031910 | Soil | TIEPDELIPGRRASRARVIAAGLTDDDIDRLIKQAQKEVEPPRVG |
| Ga0310910_102206353 | 3300031946 | Soil | MIEPDELIPGRRASRARVIAAGLTDDDIDQAQKEVEPRTG |
| Ga0310910_103316435 | 3300031946 | Soil | LIPGRRASRARVIAAGLSDDDIDRLIKQAQKEVEPRAR |
| Ga0310910_105798303 | 3300031946 | Soil | MIEPDELIPGRRASRARVIAAGLTDDDIDRLIKQAQKEVEPR |
| Ga0306926_100941795 | 3300031954 | Soil | MASECEAIETIEPDQLIPGRRLSRARVIAAGLTDDDIDRLIKQEVEPLIR |
| Ga0306926_107483691 | 3300031954 | Soil | MIGPDELIPGRRASRARVIAAGLSDDDIYRLIKQAQKEVEPRAG |
| Ga0306926_124484122 | 3300031954 | Soil | RVTITIEPDELIPGRRASRARVVAVGLTDDDIDRLIKQAQKEVEPRAG |
| Ga0318549_103607331 | 3300032041 | Soil | DPDDRVTITIEPDELIPGRRASRARVIAAGLTDDDIDRLIKQAQKEVEPPRVG |
| Ga0318506_101034513 | 3300032052 | Soil | MIEPDELIPGRRASRARVIAAGLTDEDIDRLIKQAQKEVEPRAG |
| Ga0318504_104581971 | 3300032063 | Soil | IPGRRASRARVIAAGLSDDDIDRLIKQAQKEVEPRAR |
| Ga0307471_1019095892 | 3300032180 | Hardwood Forest Soil | LDPDDRVTIMIEPDELISGRRASRARVIAAGLSDDDIDRLIKQTQKEVEPRAG |
| Ga0307472_1011263061 | 3300032205 | Hardwood Forest Soil | TIEPDEAIPGRREARARVIAAGLTDEDIDRLIEEARKEAQPLLG |
| Ga0335078_114684701 | 3300032805 | Soil | EPDELIPGRRACRAQVIAAGLTDDDIDRLIEEARTEAQPLLG |
| Ga0335074_100608372 | 3300032895 | Soil | VIVTSEAEQELIPGRRESRTRVVAAGLTDNDIDRLVKQAQKEVEPPRAG |
| Ga0335074_110912191 | 3300032895 | Soil | RRESRTRVVAAGLTDNDIDRLVKQAQKEVEPPRAG |
| Ga0335074_115401741 | 3300032895 | Soil | LIGPGQEWLPGRQESRARVVAAGLSDEDIDRLIKQAQHEVAQ |
| Ga0335073_119116862 | 3300033134 | Soil | PGRREARARVVAAGLTDADIDRLIDEARTEAQPHLG |
| ⦗Top⦘ |