


| Basic Information | |
|---|---|
| Family ID | F050502 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 145 |
| Average Sequence Length | 38 residues |
| Representative Sequence | VPYIPMGEYWQSTAYRKDLLDVLPGCFAVFYGVRRA |
| Number of Associated Samples | 114 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 7.59 % |
| % of genes near scaffold ends (potentially truncated) | 91.72 % |
| % of genes from short scaffolds (< 2000 bps) | 92.41 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.103 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (44.138 % of family members) |
| Environment Ontology (ENVO) | Unclassified (54.483 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.207 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.69% β-sheet: 0.00% Coil/Unstructured: 70.31% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF00496 | SBP_bac_5 | 16.55 |
| PF07883 | Cupin_2 | 4.83 |
| PF04392 | ABC_sub_bind | 2.76 |
| PF03352 | Adenine_glyco | 2.76 |
| PF13649 | Methyltransf_25 | 2.07 |
| PF04993 | TfoX_N | 1.38 |
| PF01436 | NHL | 1.38 |
| PF13432 | TPR_16 | 1.38 |
| PF00293 | NUDIX | 1.38 |
| PF02518 | HATPase_c | 1.38 |
| PF03976 | PPK2 | 0.69 |
| PF00149 | Metallophos | 0.69 |
| PF13561 | adh_short_C2 | 0.69 |
| PF06627 | DUF1153 | 0.69 |
| PF11860 | Muramidase | 0.69 |
| PF01209 | Ubie_methyltran | 0.69 |
| PF03060 | NMO | 0.69 |
| PF00889 | EF_TS | 0.69 |
| PF03729 | DUF308 | 0.69 |
| PF13565 | HTH_32 | 0.69 |
| PF13302 | Acetyltransf_3 | 0.69 |
| PF04229 | GrpB | 0.69 |
| PF08388 | GIIM | 0.69 |
| PF00012 | HSP70 | 0.69 |
| PF02826 | 2-Hacid_dh_C | 0.69 |
| PF07080 | DUF1348 | 0.69 |
| PF12848 | ABC_tran_Xtn | 0.69 |
| PF02668 | TauD | 0.69 |
| PF00589 | Phage_integrase | 0.69 |
| PF00485 | PRK | 0.69 |
| PF13384 | HTH_23 | 0.69 |
| PF07746 | LigA | 0.69 |
| PF04909 | Amidohydro_2 | 0.69 |
| PF09297 | zf-NADH-PPase | 0.69 |
| PF16861 | Carbam_trans_C | 0.69 |
| PF01204 | Trehalase | 0.69 |
| PF07690 | MFS_1 | 0.69 |
| PF01070 | FMN_dh | 0.69 |
| PF14224 | DUF4331 | 0.69 |
| PF00326 | Peptidase_S9 | 0.69 |
| PF00476 | DNA_pol_A | 0.69 |
| PF00941 | FAD_binding_5 | 0.69 |
| PF00536 | SAM_1 | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG2818 | 3-methyladenine DNA glycosylase Tag | Replication, recombination and repair [L] | 2.76 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.76 |
| COG3070 | Transcriptional regulator of competence genes, TfoX/Sxy family | Transcription [K] | 1.38 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.69 |
| COG0264 | Translation elongation factor EF-Ts | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| COG0272 | NAD-dependent DNA ligase | Replication, recombination and repair [L] | 0.69 |
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 0.69 |
| COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.69 |
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 0.69 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.69 |
| COG1626 | Neutral trehalase | Carbohydrate transport and metabolism [G] | 0.69 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.69 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.69 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.69 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.69 |
| COG2320 | GrpB domain, predicted nucleotidyltransferase, UPF0157 family | General function prediction only [R] | 0.69 |
| COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 0.69 |
| COG2816 | NADH pyrophosphatase NudC, Nudix superfamily | Nucleotide transport and metabolism [F] | 0.69 |
| COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 0.69 |
| COG3558 | Uncharacterized conserved protein, nuclear transport factor 2 (NTF2) superfamily | Function unknown [S] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.10 % |
| Unclassified | root | N/A | 6.90 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000789|JGI1027J11758_13086464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium AT-5844 | 659 | Open in IMG/M |
| 3300000955|JGI1027J12803_109342458 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
| 3300004082|Ga0062384_100542188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 778 | Open in IMG/M |
| 3300005471|Ga0070698_101981495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 536 | Open in IMG/M |
| 3300005471|Ga0070698_102006574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium AT-5844 | 532 | Open in IMG/M |
| 3300005548|Ga0070665_101749430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 629 | Open in IMG/M |
| 3300005554|Ga0066661_10518578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 718 | Open in IMG/M |
| 3300005568|Ga0066703_10623877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 626 | Open in IMG/M |
| 3300005569|Ga0066705_10944127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 512 | Open in IMG/M |
| 3300005576|Ga0066708_10592245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 711 | Open in IMG/M |
| 3300005610|Ga0070763_10077863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1634 | Open in IMG/M |
| 3300005614|Ga0068856_100684722 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1046 | Open in IMG/M |
| 3300005618|Ga0068864_101525534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 671 | Open in IMG/M |
| 3300006041|Ga0075023_100565388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium AT-5844 | 523 | Open in IMG/M |
| 3300006176|Ga0070765_100391375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1296 | Open in IMG/M |
| 3300006796|Ga0066665_11698341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 500 | Open in IMG/M |
| 3300006854|Ga0075425_101821937 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300007822|Ga0104325_100996 | Not Available | 1014 | Open in IMG/M |
| 3300009143|Ga0099792_10028087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2581 | Open in IMG/M |
| 3300010047|Ga0126382_10431438 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1038 | Open in IMG/M |
| 3300010048|Ga0126373_10466387 | All Organisms → cellular organisms → Bacteria | 1300 | Open in IMG/M |
| 3300010048|Ga0126373_10636364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1121 | Open in IMG/M |
| 3300010048|Ga0126373_11960350 | Not Available | 648 | Open in IMG/M |
| 3300010048|Ga0126373_11960734 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 648 | Open in IMG/M |
| 3300010048|Ga0126373_11994568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 643 | Open in IMG/M |
| 3300010321|Ga0134067_10236043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 684 | Open in IMG/M |
| 3300010323|Ga0134086_10275240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 647 | Open in IMG/M |
| 3300010359|Ga0126376_11925620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 631 | Open in IMG/M |
| 3300010361|Ga0126378_10046812 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4005 | Open in IMG/M |
| 3300010366|Ga0126379_11811337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 714 | Open in IMG/M |
| 3300010376|Ga0126381_102090333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 815 | Open in IMG/M |
| 3300010376|Ga0126381_103867103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 584 | Open in IMG/M |
| 3300010398|Ga0126383_11785701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 703 | Open in IMG/M |
| 3300010398|Ga0126383_11881177 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300011270|Ga0137391_10488630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1043 | Open in IMG/M |
| 3300012202|Ga0137363_10837044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 781 | Open in IMG/M |
| 3300012205|Ga0137362_10773913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 823 | Open in IMG/M |
| 3300012350|Ga0137372_11165106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 523 | Open in IMG/M |
| 3300012930|Ga0137407_11949006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium AT-5844 | 560 | Open in IMG/M |
| 3300012948|Ga0126375_11587041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 563 | Open in IMG/M |
| 3300012958|Ga0164299_11624945 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300015374|Ga0132255_101014191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1245 | Open in IMG/M |
| 3300016270|Ga0182036_11280247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 611 | Open in IMG/M |
| 3300016270|Ga0182036_11762317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 524 | Open in IMG/M |
| 3300016319|Ga0182033_10178140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1670 | Open in IMG/M |
| 3300016341|Ga0182035_11158511 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300016357|Ga0182032_11125713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 674 | Open in IMG/M |
| 3300016387|Ga0182040_10639987 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300016404|Ga0182037_10435488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1087 | Open in IMG/M |
| 3300016445|Ga0182038_10849888 | Not Available | 802 | Open in IMG/M |
| 3300016445|Ga0182038_11758746 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 559 | Open in IMG/M |
| 3300018085|Ga0187772_11234264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium RIFOXYA12_FULL_46_15 | 551 | Open in IMG/M |
| 3300018468|Ga0066662_11951581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 614 | Open in IMG/M |
| 3300018468|Ga0066662_12579664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 537 | Open in IMG/M |
| 3300018482|Ga0066669_10655418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 923 | Open in IMG/M |
| 3300020580|Ga0210403_10666895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 835 | Open in IMG/M |
| 3300021178|Ga0210408_10123028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 2046 | Open in IMG/M |
| 3300021178|Ga0210408_10723261 | Not Available | 783 | Open in IMG/M |
| 3300021403|Ga0210397_10146338 | All Organisms → cellular organisms → Bacteria | 1647 | Open in IMG/M |
| 3300021407|Ga0210383_11043431 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300021445|Ga0182009_10196180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 981 | Open in IMG/M |
| 3300021478|Ga0210402_11371494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 634 | Open in IMG/M |
| 3300022531|Ga0242660_1068005 | Not Available | 815 | Open in IMG/M |
| 3300025929|Ga0207664_10519369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1067 | Open in IMG/M |
| 3300025939|Ga0207665_10640638 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300026095|Ga0207676_10183860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1833 | Open in IMG/M |
| 3300026305|Ga0209688_1037591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 923 | Open in IMG/M |
| 3300027383|Ga0209213_1098543 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300027610|Ga0209528_1151809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300027635|Ga0209625_1001391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5690 | Open in IMG/M |
| 3300027651|Ga0209217_1072254 | Not Available | 1011 | Open in IMG/M |
| 3300027986|Ga0209168_10383141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 685 | Open in IMG/M |
| 3300031543|Ga0318516_10290540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 945 | Open in IMG/M |
| 3300031544|Ga0318534_10574855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 641 | Open in IMG/M |
| 3300031545|Ga0318541_10004030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 5993 | Open in IMG/M |
| 3300031545|Ga0318541_10189250 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
| 3300031545|Ga0318541_10727458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 554 | Open in IMG/M |
| 3300031549|Ga0318571_10075247 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300031561|Ga0318528_10327503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 822 | Open in IMG/M |
| 3300031572|Ga0318515_10383147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium AT-5844 | 753 | Open in IMG/M |
| 3300031572|Ga0318515_10512087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 640 | Open in IMG/M |
| 3300031572|Ga0318515_10561600 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300031573|Ga0310915_10222054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1325 | Open in IMG/M |
| 3300031573|Ga0310915_10330677 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1079 | Open in IMG/M |
| 3300031573|Ga0310915_10965728 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300031640|Ga0318555_10234289 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300031679|Ga0318561_10700431 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300031681|Ga0318572_10932151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 516 | Open in IMG/M |
| 3300031713|Ga0318496_10812890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 515 | Open in IMG/M |
| 3300031719|Ga0306917_10567445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 892 | Open in IMG/M |
| 3300031723|Ga0318493_10306411 | Not Available | 858 | Open in IMG/M |
| 3300031736|Ga0318501_10308501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 845 | Open in IMG/M |
| 3300031751|Ga0318494_10615980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 635 | Open in IMG/M |
| 3300031765|Ga0318554_10254434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1000 | Open in IMG/M |
| 3300031768|Ga0318509_10684632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 570 | Open in IMG/M |
| 3300031770|Ga0318521_10388511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 831 | Open in IMG/M |
| 3300031777|Ga0318543_10360444 | Not Available | 651 | Open in IMG/M |
| 3300031780|Ga0318508_1077657 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300031793|Ga0318548_10532170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 573 | Open in IMG/M |
| 3300031795|Ga0318557_10595411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 507 | Open in IMG/M |
| 3300031797|Ga0318550_10219343 | Not Available | 922 | Open in IMG/M |
| 3300031797|Ga0318550_10526584 | Not Available | 569 | Open in IMG/M |
| 3300031798|Ga0318523_10015551 | All Organisms → cellular organisms → Bacteria | 3207 | Open in IMG/M |
| 3300031819|Ga0318568_10384804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 874 | Open in IMG/M |
| 3300031833|Ga0310917_10923982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 587 | Open in IMG/M |
| 3300031845|Ga0318511_10610407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 509 | Open in IMG/M |
| 3300031859|Ga0318527_10388912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 594 | Open in IMG/M |
| 3300031879|Ga0306919_10919297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 670 | Open in IMG/M |
| 3300031880|Ga0318544_10015275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2499 | Open in IMG/M |
| 3300031890|Ga0306925_10224071 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2028 | Open in IMG/M |
| 3300031890|Ga0306925_10671200 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300031893|Ga0318536_10168482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1114 | Open in IMG/M |
| 3300031893|Ga0318536_10508306 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300031893|Ga0318536_10637503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 532 | Open in IMG/M |
| 3300031894|Ga0318522_10011100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2720 | Open in IMG/M |
| 3300031896|Ga0318551_10805751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium AT-5844 | 546 | Open in IMG/M |
| 3300031897|Ga0318520_10989548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 531 | Open in IMG/M |
| 3300031910|Ga0306923_10844869 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300031910|Ga0306923_11324053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 763 | Open in IMG/M |
| 3300031910|Ga0306923_11736595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 643 | Open in IMG/M |
| 3300031912|Ga0306921_10133534 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2898 | Open in IMG/M |
| 3300031912|Ga0306921_11462713 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300031912|Ga0306921_11942561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 628 | Open in IMG/M |
| 3300031942|Ga0310916_10354495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1246 | Open in IMG/M |
| 3300031945|Ga0310913_10534608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 832 | Open in IMG/M |
| 3300031954|Ga0306926_10792461 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300031954|Ga0306926_11291815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 852 | Open in IMG/M |
| 3300031959|Ga0318530_10060856 | All Organisms → cellular organisms → Bacteria | 1443 | Open in IMG/M |
| 3300031959|Ga0318530_10307251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 656 | Open in IMG/M |
| 3300031962|Ga0307479_11886376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 548 | Open in IMG/M |
| 3300032039|Ga0318559_10166097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1007 | Open in IMG/M |
| 3300032041|Ga0318549_10580192 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300032043|Ga0318556_10104829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1435 | Open in IMG/M |
| 3300032051|Ga0318532_10177279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 757 | Open in IMG/M |
| 3300032051|Ga0318532_10247517 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 633 | Open in IMG/M |
| 3300032051|Ga0318532_10288820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 582 | Open in IMG/M |
| 3300032052|Ga0318506_10100873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1233 | Open in IMG/M |
| 3300032055|Ga0318575_10631373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300032068|Ga0318553_10075050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1699 | Open in IMG/M |
| 3300032068|Ga0318553_10222805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 984 | Open in IMG/M |
| 3300032205|Ga0307472_100619916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 958 | Open in IMG/M |
| 3300032261|Ga0306920_100408482 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2019 | Open in IMG/M |
| 3300032421|Ga0310812_10514460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 538 | Open in IMG/M |
| 3300033289|Ga0310914_10987768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 742 | Open in IMG/M |
| 3300033289|Ga0310914_11235595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 649 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 44.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.17% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.52% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.14% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.07% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.07% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.07% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.38% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.38% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.38% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.69% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.69% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.69% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.69% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.69% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.69% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007822 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-8-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J11758_130864641 | 3300000789 | Soil | FIPLGEYWQASAYRKDLTDVIPGCFTTFYGVRRA* |
| JGI1027J12803_1093424585 | 3300000955 | Soil | FIPLGEYWQASAYRKDLTDIIPGCFTTFYAVRRS* |
| Ga0062384_1005421883 | 3300004082 | Bog Forest Soil | KQLWEDVPFIPMGEYWQATAYRKDLTDVPPGCFAVFYGVRRT* |
| Ga0070698_1019814952 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | QKRLWEDVPFIPLGEYWQASAYRKDLTDIIPGCFTTFYGVRRA* |
| Ga0070698_1020065741 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LWQDVPYIPMGEYWQATAYRKDLLDVQPGCFAVFYGVRRA* |
| Ga0070665_1017494302 | 3300005548 | Switchgrass Rhizosphere | PFIPMGEYWQTTAYRKDITGAIPGCFTVFYNVKRA* |
| Ga0066661_105185782 | 3300005554 | Soil | CIELQKRLWEDVPFIPLGEYWQASAYRKDLTDVIPGCFTTFYGVRRT* |
| Ga0066703_106238773 | 3300005568 | Soil | PFIPMGEYWQATAYRKDLTDVLPGCFAVFYGVRRA* |
| Ga0066705_109441272 | 3300005569 | Soil | PFIPMGEYWQASADRKDITDVIPCCFTTFYGARCPGH* |
| Ga0066708_105922451 | 3300005576 | Soil | PFIPMGEYWQASAYRKDLTNVLPGCFAVFYAVRRA* |
| Ga0070763_100778632 | 3300005610 | Soil | VPFIPMGEYWQASAYRKDLTDVLPGCFAVFYGVRRA* |
| Ga0068856_1006847222 | 3300005614 | Corn Rhizosphere | LWEDVPFIPLGEYWQASAYRKDLIDVIPGCFTTLYGVRRA* |
| Ga0068864_1015255341 | 3300005618 | Switchgrass Rhizosphere | QKRLWEDVPFIPLGEYWQASAYRKDVTDVIPGCFATFYGVRRA* |
| Ga0075023_1005653882 | 3300006041 | Watersheds | VPYIPMGEYWQSTAYRKDLLDVLPGCFAVFWGIRRA* |
| Ga0070765_1003913752 | 3300006176 | Soil | RLWEDVPFIPLGEYWQASAYRKDLTDVIPGCFTTFYGVRRA* |
| Ga0066665_116983411 | 3300006796 | Soil | PFIPMGEYWQTTAYRKGLTGIIPGCFTMFYNVKRA* |
| Ga0075425_1018219373 | 3300006854 | Populus Rhizosphere | FIPMGEYWQATAYSKHLTDVLPGCFAVFYGVRRA* |
| Ga0104325_1009961 | 3300007822 | Soil | PFIPMGEYWQTTAYRKGLTGIIPGCFTVFWGVRRA* |
| Ga0099792_100280874 | 3300009143 | Vadose Zone Soil | PFIPMGEYWQTTAYRKELSGIIPGCFTVFWGVKRA* |
| Ga0126382_104314383 | 3300010047 | Tropical Forest Soil | MQVWQDVPFIPMGEYWQCTAFRKELTGIIPGCFAVFYNINRA* |
| Ga0126373_104663872 | 3300010048 | Tropical Forest Soil | VPFIPTGEYWQATAYRKNLTDILPGSFAVFHGVRRA* |
| Ga0126373_106363642 | 3300010048 | Tropical Forest Soil | LQKQLWEDVPFIPMGEYWQASAYRKRLTDILPSRFATFYRARPA* |
| Ga0126373_119603501 | 3300010048 | Tropical Forest Soil | YIPMGEDSQSTDYREDLLDVLPGCFSEFWGIRRA* |
| Ga0126373_119607341 | 3300010048 | Tropical Forest Soil | DVPYIPMGEYSQATAYRKDLLDVLPGCFAVFYGVRRA* |
| Ga0126373_119945682 | 3300010048 | Tropical Forest Soil | PYIPMGEYWQSTAYRKDLLDVVPGCFAVFWRVRRA* |
| Ga0134067_102360431 | 3300010321 | Grasslands Soil | QLWEDVTFIPLGEYWQATAYRKDLTDVLPGCFTVFYGVRRA* |
| Ga0134086_102752401 | 3300010323 | Grasslands Soil | VPFIPMGEYWQATAYRKHLTDVLPGCFAVFYGVRRA* |
| Ga0126376_119256202 | 3300010359 | Tropical Forest Soil | PFIPLGEYWQATAYRKRLTDIVPGCFATFYGVRPA* |
| Ga0126378_100468121 | 3300010361 | Tropical Forest Soil | QLWTDVPFIPMGEYWQATAYRKDLTDVLPGCFATSYGVRRA* |
| Ga0126379_118113371 | 3300010366 | Tropical Forest Soil | DVPYIPMGEYWQSSAYRKDLLDVLPGCFAVFYGVRRG* |
| Ga0126381_1020903331 | 3300010376 | Tropical Forest Soil | DLQKQLWEDVPFIPMGEYWQASAYRKRLTDILHGCFATFYGVRPA* |
| Ga0126381_1038671032 | 3300010376 | Tropical Forest Soil | MQRQVWEDVPFIPMGEYWQTTAYRKDLVDVLPGCFVTFYGVRRT* |
| Ga0126383_117857012 | 3300010398 | Tropical Forest Soil | PYIPMGEYWQCTAYRKDLVDVLAGCFTVFWGIRRA* |
| Ga0126383_118811773 | 3300010398 | Tropical Forest Soil | VPFIPTGEYWQATAYRKNLTDILPGSFAVFHGVRRA |
| Ga0137391_104886302 | 3300011270 | Vadose Zone Soil | VPYIPMGEYWQSTAYRKDLLDVLPGCFAVFYGVRRA* |
| Ga0137363_108370442 | 3300012202 | Vadose Zone Soil | DLPFIPMGEYWQTTAYRKELSGIIPGCFTVFWGVKRA* |
| Ga0137362_107739131 | 3300012205 | Vadose Zone Soil | MQLWQDVPYIPMGEYWQATAYRKDLLDVTPGCFAVFYGVHR |
| Ga0137372_111651062 | 3300012350 | Vadose Zone Soil | YIPMGEYWQSTAYRKDLLDVLPGCFAVFYGVRRA* |
| Ga0137407_119490061 | 3300012930 | Vadose Zone Soil | DVPFIPMGEYWQTTAYRKDLTGILPGCFTVFYGVRRA* |
| Ga0126375_115870412 | 3300012948 | Tropical Forest Soil | PFIPIGEYWQTTAYRKDLTGINPGCFTVFWGVRRA* |
| Ga0164299_116249451 | 3300012958 | Soil | MQVWQDLPFIPMGEYWQTTAYRKELSGIIPGCFTVFWGVQRA* |
| Ga0132255_1010141912 | 3300015374 | Arabidopsis Rhizosphere | CADLQKRLWEDVPFIPMGEYWQASAYRKHLTDIVPGCFTTFYGVRRS* |
| Ga0182036_112802471 | 3300016270 | Soil | PFIPMGEYWQATAHRKDLTDVLSGCFATFYGVRRA |
| Ga0182036_117623172 | 3300016270 | Soil | VPFIPTGEYWRATAYRKNLTDILPGCFAVSHGVRRA |
| Ga0182033_101781402 | 3300016319 | Soil | VPYIPMGEYWQSTAYRKDLLDVQPGCFAVVWGIRRA |
| Ga0182035_111585112 | 3300016341 | Soil | VHPMGEYWQVTAYHKDLLDVQRGCFAVFYGVRRGERHPC |
| Ga0182032_111257131 | 3300016357 | Soil | PYIPMGEYWQSTAYRRDLLDVLPGCFAVFWGIRRA |
| Ga0182040_106399872 | 3300016387 | Soil | PYIPMGEYWQSSAYRKDLIDVFPGCFSVFWGIRRA |
| Ga0182037_104354882 | 3300016404 | Soil | QDVPYIPMGEYWQSSAYRKDLINVFPGCFSVFWGIRRA |
| Ga0182038_108498882 | 3300016445 | Soil | MQVWQDVRFILMDEYWQTTGKRLSGIIPGCFMVFY |
| Ga0182038_117587461 | 3300016445 | Soil | PYIPMGEYWQSTAYRKDLLDVLPGCFAVFYGVRRA |
| Ga0187772_112342642 | 3300018085 | Tropical Peatland | VPFIPMGEYWQASAYRKRLTDILPGCFATFYGVRPA |
| Ga0066662_119515811 | 3300018468 | Grasslands Soil | MQTRRRDLRQDLPFVPMGAYRQTTAYRNDLKGVIPGCFTVFYGVERA |
| Ga0066662_125796641 | 3300018468 | Grasslands Soil | RLWEDVPFIPLGEYWQASAYRKDLTDIVPGCFTTFYGVRRA |
| Ga0066669_106554182 | 3300018482 | Grasslands Soil | WEDVPFIPLGEYWQASAYRKDLTDIIPGCFTTFYGVRRA |
| Ga0210403_106668952 | 3300020580 | Soil | PYIPMGEYWQSTAYRKDLLDVMPGCFAVFYGVRRS |
| Ga0210408_101230281 | 3300021178 | Soil | VPFIPMGEYWQATAYRKDLTDVLPGCFAMFYGVRRT |
| Ga0210408_107232611 | 3300021178 | Soil | DVPYIPMGEYWQSTAYRKDIVDVLPGCFAVFYGIHRCHRYLH |
| Ga0210397_101463381 | 3300021403 | Soil | ICEELQKQLWQDVPFIPLGEYWQASAYRKRLVDIIPGCFATSYGVRPA |
| Ga0210383_110434312 | 3300021407 | Soil | TADPELQKQLWQDVPFIPLGEYWQASAYRKRLVDIIPGCFATFYGVRPA |
| Ga0182009_101961801 | 3300021445 | Soil | VPFIPLGEYWQASAYRKDVTDVIPGCFATFYGVRRA |
| Ga0210402_113714941 | 3300021478 | Soil | MQLWQDVPYIPMGEYWQSTAFRKDIVGVQPGCFSVFDGVRRA |
| Ga0242660_10680052 | 3300022531 | Soil | QDVPFIPMGEYWQTTGYRKGLTGIIPGCFTVFYNVKRA |
| Ga0207664_105193693 | 3300025929 | Agricultural Soil | WEDVPFIPLGEYWQASAYRKDVTDVIPGCFATFYGVRRA |
| Ga0207665_106406382 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MQLWQDVPYIPMGEYWQSTAYRKDLLDVQPGCFAVFWGLPSR |
| Ga0207676_101838601 | 3300026095 | Switchgrass Rhizosphere | QKRLWEDVPFIPLGEYWQASAYRKDVTDVIPGCFATFYGVRRA |
| Ga0209688_10375913 | 3300026305 | Soil | LQKQLWHDVPFIPLGEYWQASAYRKHLVDIIPGCFATFYGVRPA |
| Ga0209213_10985432 | 3300027383 | Forest Soil | MQKRLWEDVPFIPLGEYWQASAYRKDLTDVIPGCFTTFYGVRRA |
| Ga0209528_11518091 | 3300027610 | Forest Soil | QDLPFIPMGEYWQTTAYRKELTGILPGCFTVFWGVQRA |
| Ga0209625_10013915 | 3300027635 | Forest Soil | PFIPMGEYWQTTAYRKGLTGIIPGCFTVFYNVKRA |
| Ga0209217_10722542 | 3300027651 | Forest Soil | VPYIPMGEYWQSTAYRKDLLDVLPGCFAVFYGVRRA |
| Ga0209168_103831412 | 3300027986 | Surface Soil | QTRLWEDVPFIPLGEYWQASAYRKDLIDIIPGCFATFYGVRRA |
| Ga0318516_102905401 | 3300031543 | Soil | QDVPYIPMGEYWQSTAYRKDLLDVLPGCFAVFWGIHRA |
| Ga0318534_105748552 | 3300031544 | Soil | QLWQDVPYIPMGEYWQATAYRKDLLDVQPGCFKVFYGVRRA |
| Ga0318541_100040305 | 3300031545 | Soil | VAGVPYIPMGEYWQSTAYRKDLLDVLSGCFAVFWGIRRA |
| Ga0318541_101892503 | 3300031545 | Soil | LWQDVPYIRMGEYWQSTAYRKDLLDVLPGCFAVFYGVRRA |
| Ga0318541_107274582 | 3300031545 | Soil | YIPMGEYWQSTAYRKDLLGVIPGCFAVFWGIRPAS |
| Ga0318571_100752471 | 3300031549 | Soil | PYIPMGEYWQSTAYRKDLLDVLPGCFAVFWGIHRA |
| Ga0318528_103275031 | 3300031561 | Soil | VPYIPMGEYWQSTAYRKDLLDVLPGCFAVFYGVRRG |
| Ga0318515_103831471 | 3300031572 | Soil | WQDVPFIPMGEYWQSTAYRKGLTGIIPDCFTVFYNVKRA |
| Ga0318515_105120871 | 3300031572 | Soil | WKDVPYIPMGEYWQSTAYRKDLLDVLPGCFAVFYRVRRG |
| Ga0318515_105616001 | 3300031572 | Soil | VPYIPMGEYWQSSAYRKDLINVFPGCFSVFWGIRRA |
| Ga0310915_102220541 | 3300031573 | Soil | DVPYIPMGEYWQSTAYRKDMLDVQPGCFAVFWGIRRAP |
| Ga0310915_103306773 | 3300031573 | Soil | VPYIPMGEYWQSTAYRKDLLDVLPGCLAVFWGIRRA |
| Ga0310915_109657282 | 3300031573 | Soil | QLWEDVPYIRMGEYWQSTAYRKDLLDVLPGCFAVFWGIRRA |
| Ga0318555_102342892 | 3300031640 | Soil | DVPYIPMGEYWQSTAYRKDLLDVRPGCFAVFWGIRRA |
| Ga0318561_107004311 | 3300031679 | Soil | PYIPMGEYWQSTAYRKDLLDVLPGCFPVFWGIRRA |
| Ga0318572_109321512 | 3300031681 | Soil | PYIPMGEYYQSSAYRKDLLDVLPGCFAVFWGIRRA |
| Ga0318496_108128901 | 3300031713 | Soil | VPYIPMGEYWQSTAYRKDLLDVLPGCFAVFWGIRPAS |
| Ga0306917_105674451 | 3300031719 | Soil | WEDVPFIPMGEYWQATAYRRRLTDIVPDCFATFYGVRPA |
| Ga0318493_103064111 | 3300031723 | Soil | PYIPMGEYWQSTAYRKDLLDVLPGCFAVFWGIRRA |
| Ga0318501_103085011 | 3300031736 | Soil | VPFIPMGEYWQTTAYRKGLTGIIPGCFTVFYNVKRA |
| Ga0318494_106159801 | 3300031751 | Soil | VELQMQLWQELPYIPMGEYWQFTAYRKDLLDVLPGCFAV |
| Ga0318554_102544341 | 3300031765 | Soil | PYIPMGEYWQSTAYRKDLLDVQPGCFAVFYGVRRV |
| Ga0318509_106846322 | 3300031768 | Soil | PYIPMGEYWQSTAYRNDLLDVLPGCLAVFWGIRRG |
| Ga0318521_103885112 | 3300031770 | Soil | QLWRDVPYIPMGEYWQSTAYRKDLLDVLPGCFAVFYGVRRA |
| Ga0318543_103604441 | 3300031777 | Soil | QDVPYIPMGEYWQSTAYRKDLLDVVPGCFATFYGVRRA |
| Ga0318508_10776572 | 3300031780 | Soil | DVPYIPMGEYWQSTAYRKDLLDVLPGCFSVFWGIRHA |
| Ga0318548_105321702 | 3300031793 | Soil | DVPYIPMGEYWQSTAYRKGLLDVLPGCFPVFWGIRRV |
| Ga0318557_105954111 | 3300031795 | Soil | DVPYIPMGEYWQSTAYRKDLLEVLPGCFAVFWGIRRA |
| Ga0318550_102193432 | 3300031797 | Soil | PYIPMGEYWQSTAYRKDLLDVLPGCFAVFYGVHRA |
| Ga0318550_105265842 | 3300031797 | Soil | PFIPMGEYWQATAYRRRLTDIVPGCFATFYGVRAA |
| Ga0318523_100155516 | 3300031798 | Soil | VPYIPMGEYWQSTAYRKDLIDVLPGCFATFYGVRRA |
| Ga0318568_103848041 | 3300031819 | Soil | WKDVPYIPMGEYWQSTAYRKDLLDVLPGCFAVFYGVRRG |
| Ga0310917_109239822 | 3300031833 | Soil | VPFIPMGEYWQATAHRKDLTDVLSGCFATFYGVRRA |
| Ga0318511_106104071 | 3300031845 | Soil | QDVPYIPMGEYWQSIAYRKDLLDVLPGCFAVFWGIRRA |
| Ga0318527_103889121 | 3300031859 | Soil | PFIPMGESWQATAYRKGLTGIIPGCFTVFYNVKRA |
| Ga0306919_109192972 | 3300031879 | Soil | QDVPYIPMGEYWQSIAYRKDLLDVLPGCFAVFWGIRRE |
| Ga0318544_100152754 | 3300031880 | Soil | VPFIPMGESWQATAYRKGLSGIIPGCFTVFYNVKRA |
| Ga0306925_102240713 | 3300031890 | Soil | PYIPMGEYWQSTAYRKDLLDVLPGCFSVFWGIRRA |
| Ga0306925_106712001 | 3300031890 | Soil | VPFIPMGESWQATAYRKGLTGIIPGCFTVFYNVKRA |
| Ga0318536_101684822 | 3300031893 | Soil | DVPYIPMGEYWQATAYRKDLLDVLPGCFAVFYGVRRA |
| Ga0318536_105083061 | 3300031893 | Soil | VPYVPMGEYWQSTAFRKDLLDVLPGCFPVFWGIRRA |
| Ga0318536_106375032 | 3300031893 | Soil | VPYIPMGEYWQATAYRKDLLDVQPGCFAAFYGVRKA |
| Ga0318522_100111001 | 3300031894 | Soil | VPYIPMGEYWQATAYRKDLLDVLPGCFAVFYGVRRA |
| Ga0318551_108057511 | 3300031896 | Soil | VWQDVPFIPMGEYWQSTAYRKGLTGIIPDCFTVFYNVKRA |
| Ga0318520_109895483 | 3300031897 | Soil | SGNVPFIPMGEYRQATAYRKHLTDIVPGCFATFYGVRMA |
| Ga0306923_108448693 | 3300031910 | Soil | LWQDVPYIPTGEYRQSTAYRKDLLDVLPGCFATFYGVRRT |
| Ga0306923_113240531 | 3300031910 | Soil | DVPYIPLGEYWQSTAYRKDLLDVLPGYFAVFYGVRRG |
| Ga0306923_117365951 | 3300031910 | Soil | DVPYIPMGEYWQSTAYRKDLLDVLPGCFAVFWGIRRA |
| Ga0306921_101335343 | 3300031912 | Soil | MGEYWQVTAYHKDLLDVQRGCFAVFYGVRRGERHPC |
| Ga0306921_114627132 | 3300031912 | Soil | LWQDVRYIPMGEFWQSTAYRKDLLDVLPGCFAVFWGIRRA |
| Ga0306921_119425612 | 3300031912 | Soil | QDVPYIPMGEYWQATAYRKDLLDVQPGCFAVFYGVRKA |
| Ga0310916_103544952 | 3300031942 | Soil | QDVPYIPMGEYWQSTAYRKDMLDVQPGCFAVFWGIRRAP |
| Ga0310913_105346081 | 3300031945 | Soil | VPYIPMGEYWQSTAYRKDLLDVLPGCFAVFWGIRRA |
| Ga0306926_107924611 | 3300031954 | Soil | QDVPFIPMGEYWQSTAYRKELTGIVPGCFAVFYNVSRA |
| Ga0306926_112918151 | 3300031954 | Soil | VPLIPMGEYWQATAYRKDLVDVLPGCFAVFYGVRRV |
| Ga0318530_100608563 | 3300031959 | Soil | PYIPMGEYWQSTAYRKDLIDVLPGCFATFYGVRRA |
| Ga0318530_103072512 | 3300031959 | Soil | MQLWQELPYIPMGEYWQFTAYRKDLLDVLPGCFAV |
| Ga0307479_118863762 | 3300031962 | Hardwood Forest Soil | VPFIPMGEYWQATAYRKDLTDVLPGCFAVFYGVRRV |
| Ga0318559_101660972 | 3300032039 | Soil | QDVPYIPMGEYWQSTAYRKDLLEVLPGCFAVFWGIRRA |
| Ga0318549_105801921 | 3300032041 | Soil | DVPFIPMGESWQATAYRKGLTGIIPGCFTVFYNVKRA |
| Ga0318556_101048291 | 3300032043 | Soil | VPYIPMGEYWQSTAYRRDLLDVLPGCFAVFWGIRRA |
| Ga0318532_101772792 | 3300032051 | Soil | PYIPMGEYWQSTAYRKDLVDVLPGCFAVFWGIRRA |
| Ga0318532_102475172 | 3300032051 | Soil | QLWQDLPYIPMGEYWQSTAYRKDLLDVQPGCFAVFYGVRRA |
| Ga0318532_102888202 | 3300032051 | Soil | LWQDLPYIPMGEYWQSTAYRKDLLDVQPGCFAVFYGVRRV |
| Ga0318506_101008733 | 3300032052 | Soil | LWQDVPCIPMGEYWQSTAYRKDLLDVLPGCFAVFWGIRRA |
| Ga0318575_106313731 | 3300032055 | Soil | PFIPMGESWQATAYRKGLSGIIPGCFTVFYNVKRA |
| Ga0318553_100750502 | 3300032068 | Soil | PYIPMGEYWQSTAYRKDLLDVLPGCFAVFWGIRRV |
| Ga0318553_102228051 | 3300032068 | Soil | DVPFIPMGESWQATAYRKGLSGIIPGCFTVFYNVKRA |
| Ga0307472_1006199162 | 3300032205 | Hardwood Forest Soil | WQDVPFIPIGEYWQTTAYRKGLTGIIPGCFTVFYNVKRA |
| Ga0306920_1004084821 | 3300032261 | Soil | VPFIPMGEYRQATAYRKHLTDIVPGCFATFYGVRMA |
| Ga0310812_105144601 | 3300032421 | Soil | WQDLPFIPMGEYWQTTAYRKELSGIIPGCFTVFWGVQRA |
| Ga0310914_109877681 | 3300033289 | Soil | MRVWQDVPYIPMAEYWQSTAYRKDVLDVMPACFAVFY |
| Ga0310914_112355952 | 3300033289 | Soil | MQLWQDVPYIPMGEYSQATAYRKDLLDVLPGCFAVFYG |
| ⦗Top⦘ |