


| Basic Information | |
|---|---|
| Family ID | F050493 |
| Family Type | Metagenome |
| Number of Sequences | 145 |
| Average Sequence Length | 39 residues |
| Representative Sequence | VLSDDYFDPKRVPDDAIKKLKSVLTVVDGKVVHNTMN |
| Number of Associated Samples | 129 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.38 % |
| % of genes near scaffold ends (potentially truncated) | 97.93 % |
| % of genes from short scaffolds (< 2000 bps) | 88.97 % |
| Associated GOLD sequencing projects | 119 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.690 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (10.345 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.828 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (54.483 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 6.15% β-sheet: 12.31% Coil/Unstructured: 81.54% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF12833 | HTH_18 | 5.52 |
| PF00392 | GntR | 2.76 |
| PF01011 | PQQ | 2.76 |
| PF05099 | TerB | 2.76 |
| PF00069 | Pkinase | 2.76 |
| PF07519 | Tannase | 2.76 |
| PF00107 | ADH_zinc_N | 2.07 |
| PF07859 | Abhydrolase_3 | 2.07 |
| PF07969 | Amidohydro_3 | 2.07 |
| PF00857 | Isochorismatase | 2.07 |
| PF00072 | Response_reg | 1.38 |
| PF13474 | SnoaL_3 | 1.38 |
| PF10605 | 3HBOH | 1.38 |
| PF01494 | FAD_binding_3 | 1.38 |
| PF12811 | BaxI_1 | 1.38 |
| PF00005 | ABC_tran | 1.38 |
| PF12543 | DUF3738 | 1.38 |
| PF14534 | DUF4440 | 1.38 |
| PF12704 | MacB_PCD | 1.38 |
| PF03401 | TctC | 0.69 |
| PF10098 | DUF2336 | 0.69 |
| PF00106 | adh_short | 0.69 |
| PF08238 | Sel1 | 0.69 |
| PF00496 | SBP_bac_5 | 0.69 |
| PF13847 | Methyltransf_31 | 0.69 |
| PF12680 | SnoaL_2 | 0.69 |
| PF11578 | DUF3237 | 0.69 |
| PF13472 | Lipase_GDSL_2 | 0.69 |
| PF17115 | Toast_rack_N | 0.69 |
| PF00486 | Trans_reg_C | 0.69 |
| PF13620 | CarboxypepD_reg | 0.69 |
| PF08818 | DUF1801 | 0.69 |
| PF13594 | Obsolete Pfam Family | 0.69 |
| PF13360 | PQQ_2 | 0.69 |
| PF00378 | ECH_1 | 0.69 |
| PF01590 | GAF | 0.69 |
| PF01061 | ABC2_membrane | 0.69 |
| PF01612 | DNA_pol_A_exo1 | 0.69 |
| PF01757 | Acyl_transf_3 | 0.69 |
| PF13649 | Methyltransf_25 | 0.69 |
| PF02738 | MoCoBD_1 | 0.69 |
| PF00753 | Lactamase_B | 0.69 |
| PF02518 | HATPase_c | 0.69 |
| PF02687 | FtsX | 0.69 |
| PF07690 | MFS_1 | 0.69 |
| PF13618 | Gluconate_2-dh3 | 0.69 |
| PF07366 | SnoaL | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 11.03 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 2.76 |
| COG3793 | Tellurite resistance protein TerB | Inorganic ion transport and metabolism [P] | 2.76 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 2.07 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 2.07 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.07 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.38 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 1.38 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 1.38 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.69 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.69 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.69 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.69 % |
| Unclassified | root | N/A | 19.31 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000033|ICChiseqgaiiDRAFT_c0838411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2526 | Open in IMG/M |
| 3300000550|F24TB_10581973 | Not Available | 1060 | Open in IMG/M |
| 3300000891|JGI10214J12806_12997603 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300004092|Ga0062389_101174793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 953 | Open in IMG/M |
| 3300004463|Ga0063356_102745681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 758 | Open in IMG/M |
| 3300004463|Ga0063356_105685706 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300005328|Ga0070676_11367452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Cedecea → Cedecea neteri | 542 | Open in IMG/M |
| 3300005334|Ga0068869_101856117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 539 | Open in IMG/M |
| 3300005335|Ga0070666_10393740 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 995 | Open in IMG/M |
| 3300005343|Ga0070687_100426030 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300005353|Ga0070669_100889683 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300005355|Ga0070671_101981227 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300005365|Ga0070688_101594768 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 533 | Open in IMG/M |
| 3300005367|Ga0070667_100061818 | All Organisms → cellular organisms → Bacteria | 3171 | Open in IMG/M |
| 3300005444|Ga0070694_100400598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1074 | Open in IMG/M |
| 3300005456|Ga0070678_101401356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
| 3300005548|Ga0070665_100156029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2284 | Open in IMG/M |
| 3300005548|Ga0070665_101160346 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 783 | Open in IMG/M |
| 3300005548|Ga0070665_101663184 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 646 | Open in IMG/M |
| 3300005617|Ga0068859_100736531 | Not Available | 1075 | Open in IMG/M |
| 3300005617|Ga0068859_101400757 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300005617|Ga0068859_101762183 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300005617|Ga0068859_103110807 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005618|Ga0068864_101661213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300005618|Ga0068864_101953313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 593 | Open in IMG/M |
| 3300005719|Ga0068861_101874182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300005764|Ga0066903_103315453 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300005841|Ga0068863_102022509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 586 | Open in IMG/M |
| 3300005843|Ga0068860_101858402 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300006028|Ga0070717_10603363 | Not Available | 996 | Open in IMG/M |
| 3300006031|Ga0066651_10297183 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300006049|Ga0075417_10289152 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300006176|Ga0070765_101227026 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300006358|Ga0068871_102170328 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300006638|Ga0075522_10087118 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1715 | Open in IMG/M |
| 3300006847|Ga0075431_101217462 | Not Available | 715 | Open in IMG/M |
| 3300006871|Ga0075434_102077555 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300006914|Ga0075436_101220994 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300006954|Ga0079219_11026694 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 688 | Open in IMG/M |
| 3300007004|Ga0079218_11439907 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 740 | Open in IMG/M |
| 3300009090|Ga0099827_10814532 | Not Available | 808 | Open in IMG/M |
| 3300009098|Ga0105245_10249214 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1725 | Open in IMG/M |
| 3300009098|Ga0105245_11011085 | Not Available | 876 | Open in IMG/M |
| 3300009100|Ga0075418_10686613 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300009147|Ga0114129_10705359 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
| 3300009157|Ga0105092_10330115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 863 | Open in IMG/M |
| 3300009174|Ga0105241_10037075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3672 | Open in IMG/M |
| 3300009176|Ga0105242_10846717 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300009177|Ga0105248_11895247 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300009839|Ga0116223_10129124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1581 | Open in IMG/M |
| 3300010359|Ga0126376_10996262 | Not Available | 838 | Open in IMG/M |
| 3300010366|Ga0126379_13141175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 553 | Open in IMG/M |
| 3300010366|Ga0126379_13321001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 539 | Open in IMG/M |
| 3300010376|Ga0126381_101514734 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300010376|Ga0126381_104701421 | Not Available | 526 | Open in IMG/M |
| 3300010398|Ga0126383_11077567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 893 | Open in IMG/M |
| 3300011398|Ga0137348_1048280 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300012022|Ga0120191_10132747 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300012210|Ga0137378_11731731 | Not Available | 530 | Open in IMG/M |
| 3300012359|Ga0137385_11171145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
| 3300012362|Ga0137361_11223242 | Not Available | 674 | Open in IMG/M |
| 3300012469|Ga0150984_110235297 | Not Available | 756 | Open in IMG/M |
| 3300012897|Ga0157285_10099532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 798 | Open in IMG/M |
| 3300012911|Ga0157301_10111647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 819 | Open in IMG/M |
| 3300012929|Ga0137404_10874033 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300013308|Ga0157375_13630893 | Not Available | 513 | Open in IMG/M |
| 3300014325|Ga0163163_10721249 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300014745|Ga0157377_11359909 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300014969|Ga0157376_11831972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300015242|Ga0137412_10076936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2714 | Open in IMG/M |
| 3300015371|Ga0132258_11276038 | All Organisms → cellular organisms → Bacteria | 1856 | Open in IMG/M |
| 3300015372|Ga0132256_102379471 | Not Available | 632 | Open in IMG/M |
| 3300015374|Ga0132255_100129326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 3487 | Open in IMG/M |
| 3300015374|Ga0132255_104969040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 563 | Open in IMG/M |
| 3300015374|Ga0132255_105188711 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300016270|Ga0182036_10471949 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 990 | Open in IMG/M |
| 3300017948|Ga0187847_10670298 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300018086|Ga0187769_10601075 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 831 | Open in IMG/M |
| 3300018482|Ga0066669_12159829 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300019377|Ga0190264_11470106 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300021170|Ga0210400_10246034 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
| 3300021401|Ga0210393_11309978 | Not Available | 581 | Open in IMG/M |
| 3300021407|Ga0210383_11491540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29 | 560 | Open in IMG/M |
| 3300021420|Ga0210394_11313547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15 | 618 | Open in IMG/M |
| 3300021559|Ga0210409_10804431 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300022899|Ga0247795_1045521 | Not Available | 732 | Open in IMG/M |
| 3300025898|Ga0207692_11056227 | Not Available | 537 | Open in IMG/M |
| 3300025903|Ga0207680_11259710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 526 | Open in IMG/M |
| 3300025907|Ga0207645_10445513 | Not Available | 874 | Open in IMG/M |
| 3300025911|Ga0207654_10018350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3670 | Open in IMG/M |
| 3300025911|Ga0207654_11435220 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300025916|Ga0207663_10248563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1308 | Open in IMG/M |
| 3300025920|Ga0207649_10615004 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300025926|Ga0207659_10461511 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1071 | Open in IMG/M |
| 3300025926|Ga0207659_11417055 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300025933|Ga0207706_10378068 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
| 3300025934|Ga0207686_10054361 | All Organisms → cellular organisms → Bacteria | 2508 | Open in IMG/M |
| 3300025935|Ga0207709_10389983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1062 | Open in IMG/M |
| 3300025939|Ga0207665_10245030 | Not Available | 1322 | Open in IMG/M |
| 3300025942|Ga0207689_10013188 | All Organisms → cellular organisms → Bacteria | 7053 | Open in IMG/M |
| 3300025949|Ga0207667_10082915 | All Organisms → cellular organisms → Bacteria | 3320 | Open in IMG/M |
| 3300025960|Ga0207651_11274582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300025961|Ga0207712_11493292 | Not Available | 605 | Open in IMG/M |
| 3300026035|Ga0207703_10385387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1297 | Open in IMG/M |
| 3300026078|Ga0207702_10135079 | All Organisms → cellular organisms → Bacteria | 2224 | Open in IMG/M |
| 3300026095|Ga0207676_10711291 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 974 | Open in IMG/M |
| 3300026095|Ga0207676_11380511 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300026118|Ga0207675_101763419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300026319|Ga0209647_1005194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 9593 | Open in IMG/M |
| 3300026326|Ga0209801_1135175 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300027879|Ga0209169_10342379 | Not Available | 786 | Open in IMG/M |
| 3300027909|Ga0209382_10106458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3281 | Open in IMG/M |
| 3300028380|Ga0268265_12254441 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 551 | Open in IMG/M |
| 3300028381|Ga0268264_11869395 | Not Available | 610 | Open in IMG/M |
| 3300028812|Ga0247825_10677522 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300028819|Ga0307296_10235431 | Not Available | 996 | Open in IMG/M |
| 3300028828|Ga0307312_10520884 | Not Available | 785 | Open in IMG/M |
| 3300031231|Ga0170824_101149029 | Not Available | 526 | Open in IMG/M |
| 3300031446|Ga0170820_17542372 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300031524|Ga0302320_11285248 | Not Available | 740 | Open in IMG/M |
| 3300031538|Ga0310888_10633251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300031561|Ga0318528_10264222 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300031716|Ga0310813_11843728 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 568 | Open in IMG/M |
| 3300031768|Ga0318509_10194810 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300031847|Ga0310907_10239781 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300031896|Ga0318551_10025421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2810 | Open in IMG/M |
| 3300031902|Ga0302322_103765565 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300031903|Ga0307407_10649657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18 | 790 | Open in IMG/M |
| 3300031940|Ga0310901_10601496 | Not Available | 503 | Open in IMG/M |
| 3300031942|Ga0310916_11233977 | Not Available | 617 | Open in IMG/M |
| 3300031944|Ga0310884_10981507 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300031954|Ga0306926_12927872 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300032000|Ga0310903_10620823 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300032003|Ga0310897_10681439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300032010|Ga0318569_10303302 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300032013|Ga0310906_10249947 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
| 3300032025|Ga0318507_10340358 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300032144|Ga0315910_10282508 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300032157|Ga0315912_10020605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 5402 | Open in IMG/M |
| 3300032160|Ga0311301_12396619 | Not Available | 596 | Open in IMG/M |
| 3300032180|Ga0307471_100529137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1331 | Open in IMG/M |
| 3300032828|Ga0335080_10064032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 4074 | Open in IMG/M |
| 3300033412|Ga0310810_10304438 | All Organisms → cellular organisms → Bacteria | 1710 | Open in IMG/M |
| 3300033412|Ga0310810_10315659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1668 | Open in IMG/M |
| 3300033551|Ga0247830_10486845 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 10.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.21% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 6.21% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.83% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.14% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.76% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.07% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.07% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.38% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.38% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.38% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.38% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.38% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.38% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.38% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.38% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.38% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.69% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.69% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.69% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.69% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.69% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.69% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.69% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.69% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.69% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.69% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.69% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.69% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011398 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT600_2 | Environmental | Open in IMG/M |
| 3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiDRAFT_08384111 | 3300000033 | Soil | SDDYFDPKRVPDDAIGRIKSALTVVDGKVVHDTMPGPTGK* |
| F24TB_105819733 | 3300000550 | Soil | SDDYFDPKRVPDDAIRKLKSAMTVVDGKVVHNTMTP* |
| JGI10214J12806_129976031 | 3300000891 | Soil | TDDYFDPKRVPDEAIKKLKSVLTVVDGKVVHNTMN* |
| Ga0062389_1011747931 | 3300004092 | Bog Forest Soil | VVVLSDDYFDARKVSDEAIKQLKSVLTVVDGKVVYDKLH* |
| Ga0063356_1027456812 | 3300004463 | Arabidopsis Thaliana Rhizosphere | LADLVVLSDDYFDPMRVPDDAIKKIKAVLTVVDGKVVHDTISGPSGK* |
| Ga0063356_1056857061 | 3300004463 | Arabidopsis Thaliana Rhizosphere | DLVVLSDDYFDPKRVPDDAIKKLKSVLTVVDGKVVHNTMN* |
| Ga0070676_113674521 | 3300005328 | Miscanthus Rhizosphere | VVVLSEDYFDAAKVPDEAIKRLKSVLTVVDGRVVHDETKAPR* |
| Ga0068869_1018561172 | 3300005334 | Miscanthus Rhizosphere | ADVVVLSDDYFDPMRVPDDAIKKIKAVLTVVDGKVVHDMISGPSGK* |
| Ga0070666_103937402 | 3300005335 | Switchgrass Rhizosphere | VVVLSEDYFNPMRVPDDKIRSLRSVLTVVDGKVVHDTLAK* |
| Ga0070687_1004260302 | 3300005343 | Switchgrass Rhizosphere | VVVLSDDYFDPMRVPDDAIKKIKAVLTVVDGKVVHDTISGPSGK* |
| Ga0070669_1008896831 | 3300005353 | Switchgrass Rhizosphere | VVVLSDDYFDQKRVPDDAIKTLKSVLTVVDGKIVHNTLPSTP* |
| Ga0070671_1019812272 | 3300005355 | Switchgrass Rhizosphere | DLVVLSDDYFSPTRVPDDKIRSLRSVLTVVDGRVVHDALPRR* |
| Ga0070688_1015947681 | 3300005365 | Switchgrass Rhizosphere | DLVVLSDDYFDPMRVPDDKIRALRSVLTVVDGKVVHDALPRR* |
| Ga0070667_1000618181 | 3300005367 | Switchgrass Rhizosphere | LSDDYFDPMRVPDDAIKKIKAVLTVVDGKVVHDMISGPSGK* |
| Ga0070694_1004005981 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VVLSDDYFDPKRVPDDAIGRIKSALTVVDGKVVHDTMPGPAGK* |
| Ga0070678_1014013561 | 3300005456 | Miscanthus Rhizosphere | LADVVVLSDDYFDPMRVPDDAIKKIKAVLTVVDGKVVHDTISGPSGK* |
| Ga0070665_1001560294 | 3300005548 | Switchgrass Rhizosphere | KFGDVVVLSDDYFNPVKVPDESIRKLHPVLTVVDGKVVYNLLGP* |
| Ga0070665_1011603461 | 3300005548 | Switchgrass Rhizosphere | PMRVPDDAIKKIKAVLTVVDGKVVHDMISGPSGK* |
| Ga0070665_1016631841 | 3300005548 | Switchgrass Rhizosphere | SADFFDSRSVPDDAIRTLKSVLTVVDGRAVYNDLR* |
| Ga0068859_1007365311 | 3300005617 | Switchgrass Rhizosphere | GDIVVLSDDYFDASKVSDEGMKKIKSVLTVVDRKVIYNQLR* |
| Ga0068859_1014007571 | 3300005617 | Switchgrass Rhizosphere | VVVLSDDYFDPKRVPDDAIKRLKSVLTVVDGRIVHNTLPSTP* |
| Ga0068859_1017621831 | 3300005617 | Switchgrass Rhizosphere | VVLSDDYFDPKRVPDDAIKKLRSVLTVVDGKVVHNTMN* |
| Ga0068859_1031108071 | 3300005617 | Switchgrass Rhizosphere | VLSDDYFDPAKVPDDAIRRLRSVLTVVGGKVVHDEMK* |
| Ga0068864_1016612131 | 3300005618 | Switchgrass Rhizosphere | FDPMRVPDDAIRKIKSVLTVVDGKVVHDTISGPSGK* |
| Ga0068864_1019533131 | 3300005618 | Switchgrass Rhizosphere | LSGDYFDSAKVPDDAIRRLKSVLTVVDGRVTYNDLH* |
| Ga0068861_1018741822 | 3300005719 | Switchgrass Rhizosphere | DPKRVPDDAIGRIKSALTVVDGKVVHDTMPGPAGK* |
| Ga0066903_1033154531 | 3300005764 | Tropical Forest Soil | ADYFDPAKVPDEGIKKLKSVLTVVDGKVIHDETK* |
| Ga0068863_1020225092 | 3300005841 | Switchgrass Rhizosphere | IVVLSDDYFDSAKVSDEGIKKIKSVLTVVDGKIVYNQLR* |
| Ga0068860_1018584022 | 3300005843 | Switchgrass Rhizosphere | VLSDDYLDPAKVPDEAIKKLKSVLTVVDGKVVHDQLR* |
| Ga0070717_106033631 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LSDDYFDEYRVPDVRKIHSVLTVVDGKVVHNLMGR* |
| Ga0066651_102971832 | 3300006031 | Soil | VLSDDYFDSAKVSDEGLKKLRSVLTVVDGKVVHDGTR* |
| Ga0075417_102891522 | 3300006049 | Populus Rhizosphere | VLSDDYFDPKRVPDDAIKKLKSVLTVVDGKVVHNTMN* |
| Ga0070765_1012270262 | 3300006176 | Soil | LVVLSDDYLDPKKVPDEGIKRLKSVLTVVDGKVVYNQMK* |
| Ga0068871_1021703282 | 3300006358 | Miscanthus Rhizosphere | VVVLSDDYFDPAKVPDEAIKRLKSVLTVVDGRVVHDETRAAR* |
| Ga0075522_100871181 | 3300006638 | Arctic Peat Soil | LNSDYFSATKVPDEAIKKLKSVMTVVDGRIVHNELK* |
| Ga0075431_1012174622 | 3300006847 | Populus Rhizosphere | VVLSDDYFDPKRVPDDAIRKLKSAMTVVDGKVVHNTMTP* |
| Ga0075434_1020775551 | 3300006871 | Populus Rhizosphere | LSEDYFDPAKVSDEGIKKIKSVYTVVDGKAVYDRLH* |
| Ga0075436_1012209942 | 3300006914 | Populus Rhizosphere | AVLSDDYLDPTKVPDEAIKKLKSALTVVDGKVVHDELR* |
| Ga0079219_110266942 | 3300006954 | Agricultural Soil | DLVVLSDDYFDPMRVPDDKIRSLRSVLTVVDGKVVHDALSRR* |
| Ga0079218_114399071 | 3300007004 | Agricultural Soil | GDLVVLSENYFDPMRVPDDKIRSLRSVLTVVDGKVVYDTLTKK* |
| Ga0099827_108145321 | 3300009090 | Vadose Zone Soil | LSEDFFDPQKVADQEIKKLKSVLTVVDGKVVYDAMR* |
| Ga0105245_102492144 | 3300009098 | Miscanthus Rhizosphere | LSADYFDAARVSDEGIKKLKSVLTVVDGKVVHDETK* |
| Ga0105245_110110851 | 3300009098 | Miscanthus Rhizosphere | VPVYGDLVVLSGDYFDPSKVPDDAIRWLKSVLTVVDG |
| Ga0075418_106866131 | 3300009100 | Populus Rhizosphere | DLVALSDDYFDAAKVPDEAIKKLKSVLTVVDGKVVYEDLK* |
| Ga0114129_107053591 | 3300009147 | Populus Rhizosphere | SDDYFDPMRVPDDAIRKIKSVLTVVDGKVVHNTMN* |
| Ga0105092_103301152 | 3300009157 | Freshwater Sediment | LSDDYFDPMRVPDDAIRRIKSVLTVVDGKVVHNTMP* |
| Ga0105241_100370751 | 3300009174 | Corn Rhizosphere | DVAVLSEDYLDPAKVSEEGIKQLRSVLTVVDGKVVHEDAR* |
| Ga0105242_108467171 | 3300009176 | Miscanthus Rhizosphere | SGDYFDAAKVPDEAIKKLKSVLTVVDGKVVYEDLK* |
| Ga0105248_118952471 | 3300009177 | Switchgrass Rhizosphere | VAVLSDDYLDPAKVSDEGIKKLKSVLTVVDGKVVHEETR* |
| Ga0116223_101291241 | 3300009839 | Peatlands Soil | SGDYTDPKKVPDEAIKGLKSVLTVVDGRVVYDGMK* |
| Ga0126376_109962623 | 3300010359 | Tropical Forest Soil | DDYFDPARVPDDKIRSLRSVLTVVDGKVVHDTLSAR* |
| Ga0126379_131411752 | 3300010366 | Tropical Forest Soil | AVLSDDYFDPKLVPDERIKTIRSVLTIVDGKVVHDSLKTSR* |
| Ga0126379_133210011 | 3300010366 | Tropical Forest Soil | VGKFGDVVVLSDDYFNEVRVPDVRKLYSVLTVVNGKVVHNLLSR* |
| Ga0126381_1015147342 | 3300010376 | Tropical Forest Soil | GKLGDIVVLSDDYFNPVRVPDEAIRKLHPVLTIIDGKVAYSSLH* |
| Ga0126381_1047014212 | 3300010376 | Tropical Forest Soil | SADYFDAAKVSDEGIKKLTSVLTVVDGKVVHDETK* |
| Ga0126383_110775671 | 3300010398 | Tropical Forest Soil | VLSAGYFDTTKVSDEGIRKLTSVLTVVDGKIVHNELK* |
| Ga0137348_10482802 | 3300011398 | Soil | VLSDDYFSPTRVPDDKIRSLRSVLTVVDGKVVHDAMAKR* |
| Ga0120191_101327471 | 3300012022 | Terrestrial | DDYFDPKRVPDDAIRKLRSVLTVVDGKIVHNTMSR* |
| Ga0137378_117317311 | 3300012210 | Vadose Zone Soil | KYGDMVVLNEDFLDPEKVPDEGIKGLKSLLTVVDGKVVHDQMH* |
| Ga0137385_111711451 | 3300012359 | Vadose Zone Soil | DLVVLSDDFFDPRKVSDEAIKKLKSVLTVVDGKVVHNEMTQGR* |
| Ga0137361_112232422 | 3300012362 | Vadose Zone Soil | VLSDDYFDAYRVPDVRKIHSVLTVVDGKVVHNLLSR* |
| Ga0150984_1102352971 | 3300012469 | Avena Fatua Rhizosphere | SDDYFDPAKVSDEGIKKIKSVYTVVDGKAVYDRLH* |
| Ga0157285_100995322 | 3300012897 | Soil | DLVVLSDDYFDPMRVPDDAIKKIKAVLTVVDGKVVHDTISGPSGK* |
| Ga0157301_101116471 | 3300012911 | Soil | LVVLSDDYFDPKRVPDDAIKKLKSVLTVVDGKVVHNTMGP* |
| Ga0137404_108740332 | 3300012929 | Vadose Zone Soil | ADYFDPAKVPDEAIKKLKSVLTVVDGKVVYEDLR* |
| Ga0157375_136308931 | 3300013308 | Miscanthus Rhizosphere | DDYFNAVRVPDESIRKLHPVLTIVNGKVVYSSLGQ* |
| Ga0163163_107212491 | 3300014325 | Switchgrass Rhizosphere | VALSDDYFDPAKVPDEAIKKLKSALTVVDGKVVYDDLK* |
| Ga0157377_113599092 | 3300014745 | Miscanthus Rhizosphere | LSDDYFSPMRVPDGKIRSLRSVLTVVDGKVVHDEMPKR* |
| Ga0157376_118319722 | 3300014969 | Miscanthus Rhizosphere | ALSGDYFDAAKVSDEGIKKLKSVLTVVDGRVVHDETK* |
| Ga0137412_100769363 | 3300015242 | Vadose Zone Soil | SDDYFNPVRVPDESIRKLHSVLTVVDGKVVHNLLGE* |
| Ga0132258_112760381 | 3300015371 | Arabidopsis Rhizosphere | SDDYFDPMRVPDDAIKKIKAVLTVVDGKVVHDTISGPSGK* |
| Ga0132256_1023794711 | 3300015372 | Arabidopsis Rhizosphere | NDDYFNPARVPDESIRKLHPVLTIVDGKVVYSTLGQ* |
| Ga0132255_1001293261 | 3300015374 | Arabidopsis Rhizosphere | KLADVVVLSDDYFDPMRVPDDAIKKIKAVLTVVDGKVVHDTISGPSGK* |
| Ga0132255_1049690401 | 3300015374 | Arabidopsis Rhizosphere | KLADVVVLSDDYFDPMRVPDDAIKKIKAVLTVVDGKVVHDMMSGPSGK* |
| Ga0132255_1051887111 | 3300015374 | Arabidopsis Rhizosphere | EDYFDTAKVSDEGIKKLKSVYTVVDGKAVYDRLH* |
| Ga0182036_104719491 | 3300016270 | Soil | VLSADYFDPAKVADADIRKLKSVLTVVGGKVVYNNLK |
| Ga0187847_106702982 | 3300017948 | Peatland | KFGDLVVLSDDYLDPKKVPDEGIKHLKSVLTVVDGKVVYDHMK |
| Ga0187769_106010752 | 3300018086 | Tropical Peatland | LVVLSEDYFDPKKVSDEGIKKLRSVLTIVGGKVVYDQTH |
| Ga0066669_121598292 | 3300018482 | Grasslands Soil | VVLSDDYFDSAKVSDEGLKKLRSVLTVVDGKVVHDGTR |
| Ga0190264_114701061 | 3300019377 | Soil | GDLVVLSDNYFDPMQVPDDKIRSLRSVLTVVDGKVVHDQLPRR |
| Ga0210400_102460341 | 3300021170 | Soil | KLADLAALSDDYLDPAKVPDEAIKKLKSVLTVVDGKVVVDELR |
| Ga0210393_113099781 | 3300021401 | Soil | VLSGDYLDPKKVPDEAIRSLKSVLTVVDGRVVFDGTK |
| Ga0210383_114915401 | 3300021407 | Soil | SDDYLDPKKVSDEGIKRLKSVLTVVDGKVVWNQMK |
| Ga0210394_113135471 | 3300021420 | Soil | DVVVLSDDYFDARKVSDEAIKQLKSVLTVVDGRVVYDNLR |
| Ga0210409_108044312 | 3300021559 | Soil | ERGKLGDVVVLSDDFVDPKKVSDEGIKKLQSVLTVVDGKVIYDRMR |
| Ga0247795_10455211 | 3300022899 | Soil | TNDYFDPKLVPDDMIRSLHSVLTVVDGKVVHNELPQR |
| Ga0207692_110562271 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | DDYFNAVRVPDESIRKLHPVLTIVDGKVVYSLLGR |
| Ga0207680_112597101 | 3300025903 | Switchgrass Rhizosphere | KLADVVVLSDDYFDPMRVPDDAIKKIKAVLTVVDGKVVHDMISGPSGK |
| Ga0207645_104455131 | 3300025907 | Miscanthus Rhizosphere | SDDYFDPMRVPDDAIKKIKAVLTVVDGKVVHDTISGPSGK |
| Ga0207654_100183501 | 3300025911 | Corn Rhizosphere | VAVLSEDYLDPAKVSEEGIKQLRSVLTVVDGKVVHEDAR |
| Ga0207654_114352202 | 3300025911 | Corn Rhizosphere | LSGDYFDAAKVPNEAIRKLKSVLTVVDGKVVYDDLH |
| Ga0207663_102485633 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | AVLSDDYLDPAKVPDEAIKKLKPALTVVDGKVVHDELR |
| Ga0207649_106150041 | 3300025920 | Corn Rhizosphere | DLVALSDDYFDPAKVPDEAIKKLKSVLTVVDGKVVYDDLK |
| Ga0207659_104615113 | 3300025926 | Miscanthus Rhizosphere | LSDDYFNPARVPDDAIRKLTSVLTVVGGRVVYEGSTR |
| Ga0207659_114170552 | 3300025926 | Miscanthus Rhizosphere | DLVVLSDDYFDPKRVPDDAIKKLKSVLTVVDGKVVHNTLN |
| Ga0207706_103780681 | 3300025933 | Corn Rhizosphere | SDDYFDPKRVPDDAIKKLKSVLTVVDGKVVHNTMN |
| Ga0207686_100543613 | 3300025934 | Miscanthus Rhizosphere | GDVVVLSGDYLDAAKVSDEGIKKLKSVMTIVDGKVIFDELR |
| Ga0207709_103899831 | 3300025935 | Miscanthus Rhizosphere | LIALSDDYFDPAKVPDEAIKKLKSVLTVVDGKVVYDDLK |
| Ga0207665_102450302 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | SDDYFDAAKVSDEGIKKLKSVLTVVDGKVVLNELR |
| Ga0207689_1001318810 | 3300025942 | Miscanthus Rhizosphere | SDDYFSPTRVPDDKIRSIRSVLTVVDGRVVHDALPRR |
| Ga0207667_100829151 | 3300025949 | Corn Rhizosphere | VVALSADYFDPAKVPDEAIKKLKSVLTVVDGKVVYEDLK |
| Ga0207651_112745822 | 3300025960 | Switchgrass Rhizosphere | LSDDYFDPMRVPDDAIKKIKAVLTVVDGKVVHDTISGPSGK |
| Ga0207712_114932922 | 3300025961 | Switchgrass Rhizosphere | LVVLSDDYFSPTRVPDDKIRSLRSVLTVVDGRVVHDALPRR |
| Ga0207703_103853871 | 3300026035 | Switchgrass Rhizosphere | GDVVVLSEDYFNPMRVPDDKIRSLRSVLTVVDGKVVHDTLAK |
| Ga0207702_101350791 | 3300026078 | Corn Rhizosphere | VALSDDYFDAAKVPDEAIKKLKSVLTVVDGKVVYEDFK |
| Ga0207676_107112912 | 3300026095 | Switchgrass Rhizosphere | SDDYFDPKQVPDDAIRKIKSVLTVVDGKVVHNTMN |
| Ga0207676_113805112 | 3300026095 | Switchgrass Rhizosphere | VLSGDYFDSAKVPDDAIRRLKSVLTVVDGRVTYNDLH |
| Ga0207675_1017634191 | 3300026118 | Switchgrass Rhizosphere | DPKRVPDDAIGRIKSALTVVDGKVVHDTMPGPAGK |
| Ga0209647_10051949 | 3300026319 | Grasslands Soil | VVVLSDDYFNVLRVPDESIRKLHSVLTVVDGKVVYNLLGR |
| Ga0209801_11351751 | 3300026326 | Soil | DLVVLSDDYFDTTKVSDERLKKLRSVLTVVDGKVVHDTTK |
| Ga0209169_103423792 | 3300027879 | Soil | FDPKKVPDEEIKRLKSVLTVVDGKIVHNTMTDGHTR |
| Ga0209382_101064581 | 3300027909 | Populus Rhizosphere | VVLSADYTDAAKVPDQEIRNLKSVLTVVDGKVVWDTMGR |
| Ga0268265_122544412 | 3300028380 | Switchgrass Rhizosphere | VVLSDDYFDPKQVPDDAIRKIKSVLTVVDGKVVHNTMN |
| Ga0268264_118693952 | 3300028381 | Switchgrass Rhizosphere | LSGDYLDPVKVPDEAIRKLKSVLTVVDGKVVFDETAGAR |
| Ga0247825_106775221 | 3300028812 | Soil | LSDDYFDPKRVPDDVIKKLKSVLTVVDGRVVHNTIN |
| Ga0307296_102354311 | 3300028819 | Soil | DDYFDPKRVPDDAIKRLKSVLTVVDGKIVHNTLPSTP |
| Ga0307312_105208841 | 3300028828 | Soil | VVVLSDDYFDPKRVPDDAIKRLKSVLTVVDGKIVHNTLPSTP |
| Ga0170824_1011490291 | 3300031231 | Forest Soil | DYFDPAKVPDEAIRKLKSVMTVVDGKVVFDGTAGAR |
| Ga0170820_175423722 | 3300031446 | Forest Soil | DLVVLSDDYFDPAKVSDEAIKKLKSVLTVVDGKVIYDNLR |
| Ga0302320_112852482 | 3300031524 | Bog | GKLGDVVVLGADYFDPKQVPDDAIRKVLPVLTIVDGKVIYDATK |
| Ga0310888_106332511 | 3300031538 | Soil | VLSDDYFDPKRVPDDAIKKLKSVLTVVDGKVVHNTMN |
| Ga0318528_102642222 | 3300031561 | Soil | DLVVLNADYFDANKVSDERIKKLKSVLTVIGGRIVYDQMR |
| Ga0310813_118437281 | 3300031716 | Soil | SDDYFDPVKVPDEAIKKLKSVLTVVDGKVVYDDLK |
| Ga0318509_101948101 | 3300031768 | Soil | VVLNADYFDANKVSDERIKKLKSVLTVIGGRIVYDQMR |
| Ga0310907_102397811 | 3300031847 | Soil | DLVVLTDDYFDPKRVPDDMIRSLRSALTVVDGKVVHDELPKR |
| Ga0318551_100254211 | 3300031896 | Soil | LVVLNADYFDANKVSDERIKKLKSVLTVIGGRIVYDQMR |
| Ga0302322_1037655652 | 3300031902 | Fen | KLGDLVVLSDDYFDTAKVPDVAIRRLKSALTVVDGRVVFDALQR |
| Ga0307407_106496571 | 3300031903 | Rhizosphere | VVLSDNYFDPMRVPDDKIRSLRSVLTVVDGKVVHDRVPRR |
| Ga0310901_106014962 | 3300031940 | Soil | ADLVVLTDDYFDPKRVPDDMIRSLRSALTVVDGKVVHDELPKR |
| Ga0310916_112339772 | 3300031942 | Soil | LSDDYFDQLRVPDESLRELHSVLTVVDGKVVHNRLGR |
| Ga0310884_109815071 | 3300031944 | Soil | LVVLSDDYFDPKRVPDDAIKKLKSVLTVVDGKVVHNTLN |
| Ga0306926_129278722 | 3300031954 | Soil | ESRKLGDVAVLSDDFLDPNKVSDEGIKKLRSVLTVVDGKVVYDQMK |
| Ga0310903_106208232 | 3300032000 | Soil | YFDPKRVPDEAIRKITSALTVVDGKVMHDTISGAAK |
| Ga0310897_106814391 | 3300032003 | Soil | DLVVLSDDYFDPKRVPDDAIKKLKSVLTVVDGKVVHNTMN |
| Ga0318569_103033021 | 3300032010 | Soil | LGDLVVLNADYFDANKVSDERIKKLKSVLTVIGGRIVYDQMR |
| Ga0310906_102499471 | 3300032013 | Soil | ADLVVLSDDYFDPKRVPDDAIRKIKSALTIVDGKVVHDAMTP |
| Ga0318507_103403582 | 3300032025 | Soil | GDLVVLNADYFDANKVSDERIKKLKSVLTVIGGRIVYDQMR |
| Ga0315910_102825081 | 3300032144 | Soil | DLVVLSDDYFDPMRVPDDKIRSLRSVLTVVDGKVVYDRLAAR |
| Ga0315912_100206056 | 3300032157 | Soil | DYFDPKRVPDDAIRKLTSALTVVDGKVVYDTMSGK |
| Ga0311301_123966192 | 3300032160 | Peatlands Soil | LGDVVVLSDDFLDSKKVSDEGIKKLQSVLTVVDGKVIYDRMQ |
| Ga0307471_1005291372 | 3300032180 | Hardwood Forest Soil | VLSDDYFDPKRVPDDAIRKLKSVMTVVDGKVVHNTMN |
| Ga0335080_100640326 | 3300032828 | Soil | LGDVVVLSDDFLDPRKVSDEGIKKLHSVLTVVDGKVVYDGLGQ |
| Ga0310810_103044382 | 3300033412 | Soil | VLSDDYFNVLRVPDESIRKLQSVLTIVDGKVVHNLLGR |
| Ga0310810_103156591 | 3300033412 | Soil | DVVVLSDDYFDPMRVPDDAIKKIKAVLTVVDGKVVHDTISGPSGK |
| Ga0247830_104868451 | 3300033551 | Soil | SADYFDAARVRDDAIKTLHSVLTVVDGRVVHDAMR |
| ⦗Top⦘ |