


| Basic Information | |
|---|---|
| Family ID | F050481 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 145 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MTKQEIVKKIVELKLVKPQTQKIKLQIQKLQQKLNND |
| Number of Associated Samples | 120 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.83 % |
| % of genes near scaffold ends (potentially truncated) | 6.90 % |
| % of genes from short scaffolds (< 2000 bps) | 60.00 % |
| Associated GOLD sequencing projects | 110 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.65 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (48.276 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine (14.483 % of family members) |
| Environment Ontology (ENVO) | Unclassified (64.828 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (93.793 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.62% β-sheet: 0.00% Coil/Unstructured: 55.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.65 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF00303 | Thymidylat_synt | 24.83 |
| PF01050 | MannoseP_isomer | 8.97 |
| PF00438 | S-AdoMet_synt_N | 8.28 |
| PF02772 | S-AdoMet_synt_M | 6.90 |
| PF04024 | PspC | 6.90 |
| PF02773 | S-AdoMet_synt_C | 6.90 |
| PF01467 | CTP_transf_like | 5.52 |
| PF01327 | Pep_deformylase | 2.76 |
| PF01713 | Smr | 2.07 |
| PF00535 | Glycos_transf_2 | 2.07 |
| PF05050 | Methyltransf_21 | 2.07 |
| PF12843 | QSregVF_b | 1.38 |
| PF00271 | Helicase_C | 1.38 |
| PF01755 | Glyco_transf_25 | 1.38 |
| PF13640 | 2OG-FeII_Oxy_3 | 1.38 |
| PF04965 | GPW_gp25 | 0.69 |
| PF04851 | ResIII | 0.69 |
| PF00534 | Glycos_transf_1 | 0.69 |
| PF04055 | Radical_SAM | 0.69 |
| PF02525 | Flavodoxin_2 | 0.69 |
| PF13578 | Methyltransf_24 | 0.69 |
| PF05721 | PhyH | 0.69 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.69 |
| PF00464 | SHMT | 0.69 |
| PF03721 | UDPG_MGDP_dh_N | 0.69 |
| PF00085 | Thioredoxin | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG0207 | Thymidylate synthase | Nucleotide transport and metabolism [F] | 24.83 |
| COG0192 | S-adenosylmethionine synthetase | Coenzyme transport and metabolism [H] | 22.07 |
| COG0242 | Peptide deformylase | Translation, ribosomal structure and biogenesis [J] | 2.76 |
| COG3306 | Glycosyltransferase involved in LPS biosynthesis, GR25 family | Cell wall/membrane/envelope biogenesis [M] | 1.38 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.69 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.69 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.69 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.69 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.69 |
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 51.72 % |
| Unclassified | root | N/A | 48.28 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10116397 | All Organisms → Viruses → Predicted Viral | 1064 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10187493 | Not Available | 709 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10259052 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10068788 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
| 3300000137|LP_F_10_SI03_10DRAFT_c1046155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 594 | Open in IMG/M |
| 3300000168|LPjun09P1210mDRAFT_c1001331 | All Organisms → Viruses → Predicted Viral | 2696 | Open in IMG/M |
| 3300001346|JGI20151J14362_10020863 | All Organisms → Viruses → Predicted Viral | 3454 | Open in IMG/M |
| 3300001450|JGI24006J15134_10166951 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 4572_77 | 704 | Open in IMG/M |
| 3300001939|GOS2225_1020705 | All Organisms → Viruses → Predicted Viral | 1146 | Open in IMG/M |
| 3300001951|GOS2249_1051065 | Not Available | 1336 | Open in IMG/M |
| 3300001956|GOS2266_1040732 | All Organisms → Viruses → Predicted Viral | 1735 | Open in IMG/M |
| 3300001965|GOS2243_1084636 | Not Available | 1664 | Open in IMG/M |
| 3300003216|JGI26079J46598_1073593 | Not Available | 648 | Open in IMG/M |
| 3300003427|JGI26084J50262_1013291 | All Organisms → Viruses → Predicted Viral | 2979 | Open in IMG/M |
| 3300005837|Ga0078893_10083416 | All Organisms → cellular organisms → Bacteria | 8960 | Open in IMG/M |
| 3300005837|Ga0078893_10728064 | All Organisms → Viruses → Predicted Viral | 1924 | Open in IMG/M |
| 3300006025|Ga0075474_10083576 | All Organisms → Viruses → Predicted Viral | 1045 | Open in IMG/M |
| 3300006405|Ga0075510_11057103 | All Organisms → Viruses → Predicted Viral | 3709 | Open in IMG/M |
| 3300006789|Ga0098054_1062800 | All Organisms → Viruses → Predicted Viral | 1411 | Open in IMG/M |
| 3300006810|Ga0070754_10212657 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300006867|Ga0075476_10085340 | All Organisms → Viruses → Predicted Viral | 1228 | Open in IMG/M |
| 3300006874|Ga0075475_10003560 | Not Available | 7951 | Open in IMG/M |
| 3300006916|Ga0070750_10001657 | Not Available | 12413 | Open in IMG/M |
| 3300006919|Ga0070746_10362039 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 656 | Open in IMG/M |
| 3300007647|Ga0102855_1136676 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300007655|Ga0102825_1126408 | Not Available | 528 | Open in IMG/M |
| 3300007953|Ga0105738_1002628 | All Organisms → Viruses → Predicted Viral | 1936 | Open in IMG/M |
| 3300008012|Ga0075480_10000416 | Not Available | 24890 | Open in IMG/M |
| 3300008050|Ga0098052_1000614 | Not Available | 22532 | Open in IMG/M |
| 3300008950|Ga0102891_1187033 | Not Available | 606 | Open in IMG/M |
| 3300009000|Ga0102960_1065319 | All Organisms → Viruses → Predicted Viral | 1335 | Open in IMG/M |
| 3300009003|Ga0102813_1062603 | All Organisms → Viruses → Predicted Viral | 1236 | Open in IMG/M |
| 3300009058|Ga0102854_1067188 | All Organisms → Viruses → Predicted Viral | 1025 | Open in IMG/M |
| 3300009071|Ga0115566_10217374 | All Organisms → Viruses → Predicted Viral | 1159 | Open in IMG/M |
| 3300009074|Ga0115549_1070332 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1207 | Open in IMG/M |
| 3300009420|Ga0114994_10119550 | All Organisms → Viruses → Predicted Viral | 1790 | Open in IMG/M |
| 3300009420|Ga0114994_10233919 | All Organisms → Viruses → Predicted Viral | 1232 | Open in IMG/M |
| 3300009435|Ga0115546_1109120 | All Organisms → Viruses → Predicted Viral | 1000 | Open in IMG/M |
| 3300009436|Ga0115008_10017925 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 5754 | Open in IMG/M |
| 3300009440|Ga0115561_1174312 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dojkabacteria → candidate division WS6 bacterium GW2011_GWA2_37_6 | 830 | Open in IMG/M |
| 3300009449|Ga0115558_1143974 | All Organisms → Viruses → Predicted Viral | 1012 | Open in IMG/M |
| 3300009608|Ga0115100_10921253 | Not Available | 714 | Open in IMG/M |
| 3300010149|Ga0098049_1116555 | Not Available | 832 | Open in IMG/M |
| 3300012920|Ga0160423_10003430 | Not Available | 13166 | Open in IMG/M |
| 3300012920|Ga0160423_10011549 | Not Available | 6853 | Open in IMG/M |
| 3300012920|Ga0160423_10122533 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1832 | Open in IMG/M |
| 3300012920|Ga0160423_10284858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → unclassified Pseudonocardiaceae → Pseudonocardiaceae bacterium | 1139 | Open in IMG/M |
| 3300012928|Ga0163110_10276345 | All Organisms → Viruses → Predicted Viral | 1220 | Open in IMG/M |
| 3300012954|Ga0163111_10180126 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 4572_77 | 1811 | Open in IMG/M |
| 3300013188|Ga0116834_1103269 | Not Available | 596 | Open in IMG/M |
| 3300017706|Ga0181377_1080321 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dojkabacteria → candidate division WS6 bacterium GW2011_GWA2_37_6 | 582 | Open in IMG/M |
| 3300017706|Ga0181377_1098955 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 4572_77 | 503 | Open in IMG/M |
| 3300017710|Ga0181403_1033242 | All Organisms → Viruses → Predicted Viral | 1087 | Open in IMG/M |
| 3300017717|Ga0181404_1175489 | Not Available | 513 | Open in IMG/M |
| 3300017724|Ga0181388_1005230 | All Organisms → Viruses → Predicted Viral | 3524 | Open in IMG/M |
| 3300017750|Ga0181405_1146415 | Not Available | 585 | Open in IMG/M |
| 3300017818|Ga0181565_10189043 | Not Available | 1421 | Open in IMG/M |
| 3300017824|Ga0181552_10358007 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 707 | Open in IMG/M |
| 3300017824|Ga0181552_10407496 | Not Available | 650 | Open in IMG/M |
| 3300017957|Ga0181571_10256577 | Not Available | 1114 | Open in IMG/M |
| 3300017967|Ga0181590_10369057 | Not Available | 1026 | Open in IMG/M |
| 3300017985|Ga0181576_10201955 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 1299 | Open in IMG/M |
| 3300018049|Ga0181572_10585211 | Not Available | 680 | Open in IMG/M |
| 3300018418|Ga0181567_10830618 | Not Available | 584 | Open in IMG/M |
| 3300018980|Ga0192961_10059146 | All Organisms → Viruses → Predicted Viral | 1118 | Open in IMG/M |
| 3300019765|Ga0194024_1050618 | Not Available | 920 | Open in IMG/M |
| 3300020165|Ga0206125_10014418 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 5178 | Open in IMG/M |
| 3300020165|Ga0206125_10020679 | All Organisms → cellular organisms → Bacteria | 3944 | Open in IMG/M |
| 3300020165|Ga0206125_10032516 | All Organisms → Viruses → Predicted Viral | 2811 | Open in IMG/M |
| 3300020165|Ga0206125_10060250 | Not Available | 1777 | Open in IMG/M |
| 3300020182|Ga0206129_10172513 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 992 | Open in IMG/M |
| 3300020187|Ga0206130_10178829 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1055 | Open in IMG/M |
| 3300020187|Ga0206130_10372520 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 4572_77 | 583 | Open in IMG/M |
| 3300020274|Ga0211658_1036004 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300020347|Ga0211504_1014128 | All Organisms → Viruses → Predicted Viral | 2281 | Open in IMG/M |
| 3300020379|Ga0211652_10004090 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 4526 | Open in IMG/M |
| 3300020404|Ga0211659_10058884 | All Organisms → Viruses → Predicted Viral | 1808 | Open in IMG/M |
| 3300020421|Ga0211653_10129400 | All Organisms → Viruses → Predicted Viral | 1118 | Open in IMG/M |
| 3300020438|Ga0211576_10396465 | Not Available | 706 | Open in IMG/M |
| 3300020438|Ga0211576_10580530 | Not Available | 560 | Open in IMG/M |
| 3300020439|Ga0211558_10005698 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 6599 | Open in IMG/M |
| 3300020469|Ga0211577_10196020 | Not Available | 1332 | Open in IMG/M |
| 3300020474|Ga0211547_10349786 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 747 | Open in IMG/M |
| 3300021085|Ga0206677_10000648 | Not Available | 32966 | Open in IMG/M |
| 3300021085|Ga0206677_10025560 | All Organisms → cellular organisms → Bacteria | 3429 | Open in IMG/M |
| 3300021085|Ga0206677_10052810 | All Organisms → Viruses → Predicted Viral | 2101 | Open in IMG/M |
| 3300021335|Ga0213867_1000024 | Not Available | 65799 | Open in IMG/M |
| 3300021335|Ga0213867_1078431 | All Organisms → Viruses → environmental samples → uncultured virus | 1212 | Open in IMG/M |
| 3300021364|Ga0213859_10000136 | Not Available | 32796 | Open in IMG/M |
| 3300021364|Ga0213859_10021347 | All Organisms → Viruses → Predicted Viral | 3011 | Open in IMG/M |
| 3300021364|Ga0213859_10268973 | Not Available | 776 | Open in IMG/M |
| 3300021365|Ga0206123_10117295 | Not Available | 1250 | Open in IMG/M |
| 3300021375|Ga0213869_10000653 | Not Available | 27300 | Open in IMG/M |
| 3300021379|Ga0213864_10387075 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 706 | Open in IMG/M |
| 3300021957|Ga0222717_10078829 | All Organisms → Viruses → Predicted Viral | 2086 | Open in IMG/M |
| 3300021957|Ga0222717_10289967 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| (restricted) 3300023109|Ga0233432_10103785 | All Organisms → Viruses → Predicted Viral | 1591 | Open in IMG/M |
| 3300023170|Ga0255761_10292467 | Not Available | 857 | Open in IMG/M |
| 3300023178|Ga0255759_10012850 | Not Available | 6792 | Open in IMG/M |
| 3300023693|Ga0232112_1039622 | Not Available | 526 | Open in IMG/M |
| 3300024237|Ga0228653_1018143 | All Organisms → Viruses → Predicted Viral | 1678 | Open in IMG/M |
| (restricted) 3300024255|Ga0233438_10257653 | Not Available | 686 | Open in IMG/M |
| 3300024322|Ga0228656_1104385 | Not Available | 604 | Open in IMG/M |
| 3300024346|Ga0244775_10261576 | All Organisms → Viruses → Predicted Viral | 1440 | Open in IMG/M |
| 3300024348|Ga0244776_10128611 | All Organisms → Viruses → Predicted Viral | 1866 | Open in IMG/M |
| 3300024508|Ga0228663_1047594 | Not Available | 814 | Open in IMG/M |
| 3300025070|Ga0208667_1017029 | All Organisms → Viruses → Predicted Viral | 1484 | Open in IMG/M |
| 3300025120|Ga0209535_1063291 | All Organisms → Viruses → Predicted Viral | 1494 | Open in IMG/M |
| 3300025626|Ga0209716_1000027 | Not Available | 140685 | Open in IMG/M |
| 3300025636|Ga0209136_1059224 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
| 3300025653|Ga0208428_1000050 | Not Available | 52464 | Open in IMG/M |
| 3300025695|Ga0209653_1005270 | Not Available | 8084 | Open in IMG/M |
| 3300025695|Ga0209653_1006333 | Not Available | 7138 | Open in IMG/M |
| 3300025701|Ga0209771_1118669 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 852 | Open in IMG/M |
| 3300025759|Ga0208899_1191399 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 659 | Open in IMG/M |
| 3300025892|Ga0209630_10085714 | All Organisms → Viruses → Predicted Viral | 1741 | Open in IMG/M |
| 3300027367|Ga0208801_1027044 | Not Available | 922 | Open in IMG/M |
| 3300027813|Ga0209090_10060114 | All Organisms → Viruses → Predicted Viral | 2112 | Open in IMG/M |
| 3300028109|Ga0247582_1051426 | All Organisms → Viruses → Predicted Viral | 1074 | Open in IMG/M |
| 3300031519|Ga0307488_10109822 | All Organisms → Viruses → Predicted Viral | 1995 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 14.48% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 11.72% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 8.97% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 7.59% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 6.90% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 6.90% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 6.21% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.83% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 4.83% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 4.83% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 4.14% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.76% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.76% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 1.38% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.38% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 1.38% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.38% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.38% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.69% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.69% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.69% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.69% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 0.69% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.69% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.69% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.69% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000121 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site MC sample ARG 03_11.3m | Environmental | Open in IMG/M |
| 3300000137 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample F_10_SI03_10 | Environmental | Open in IMG/M |
| 3300000168 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P12 10m | Environmental | Open in IMG/M |
| 3300000973 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93 | Host-Associated | Open in IMG/M |
| 3300001346 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001662 | sbbS | Environmental | Open in IMG/M |
| 3300001939 | Marine microbial communities from Block Island, New York, USA - GS009 | Environmental | Open in IMG/M |
| 3300001951 | Marine microbial communities from North Seamore Island, Equador - GS034 | Environmental | Open in IMG/M |
| 3300001956 | Marine microbial communities from Rangirora Atoll, Polynesia Archipelagos - GS051 | Environmental | Open in IMG/M |
| 3300001965 | Marine microbial communities from Coastal Floreana, Equador - GS028 | Environmental | Open in IMG/M |
| 3300003216 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA | Environmental | Open in IMG/M |
| 3300003427 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA | Environmental | Open in IMG/M |
| 3300004279 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300005969 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_Bottom_ad_4513_LV_A | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
| 3300006405 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
| 3300007655 | Estuarine microbial communities from the Columbia River estuary - High salinity metaG S.579 | Environmental | Open in IMG/M |
| 3300007953 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_3um | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008470 | Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563 | Environmental | Open in IMG/M |
| 3300008950 | Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02 | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009003 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 | Environmental | Open in IMG/M |
| 3300009058 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
| 3300009130 | Combined Assembly of Gp0139511, Gp0139512 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009440 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 | Environmental | Open in IMG/M |
| 3300009449 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 | Environmental | Open in IMG/M |
| 3300009608 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300013188 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 6m_Station1_GOM_Metagenome | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017957 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017985 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018418 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018940 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000536 (ERX1782257-ERR1712105) | Environmental | Open in IMG/M |
| 3300018980 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127) | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020169 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1 | Environmental | Open in IMG/M |
| 3300020182 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2 | Environmental | Open in IMG/M |
| 3300020187 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1 | Environmental | Open in IMG/M |
| 3300020253 | Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX555982-ERR598945) | Environmental | Open in IMG/M |
| 3300020274 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX556029-ERR598943) | Environmental | Open in IMG/M |
| 3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
| 3300020379 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168) | Environmental | Open in IMG/M |
| 3300020388 | Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064) | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300020445 | Marine microbial communities from Tara Oceans - TARA_B100001996 (ERX555961-ERR599087) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021379 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300023170 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG | Environmental | Open in IMG/M |
| 3300023178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG | Environmental | Open in IMG/M |
| 3300023693 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 29R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024237 | Seawater microbial communities from Monterey Bay, California, United States - 65D | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300024322 | Seawater microbial communities from Monterey Bay, California, United States - 68D | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024508 | Seawater microbial communities from Monterey Bay, California, United States - 77D | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025636 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025695 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025701 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027367 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027849 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028109 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300032032 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 32315 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_101163972 | 3300000101 | Marine | MEKQEIVKKIVELKLQKPQTQKIKLEIQKLQQKLNND* |
| DelMOSum2010_101874932 | 3300000101 | Marine | MNRKEISAEIRRLKIVKPQTQKIKLQIQKLQQKLEDD* |
| DelMOSum2010_102590522 | 3300000101 | Marine | MDKKEITAEVRRLKLIKPQTQKIKLQIQKLQQKLEE* |
| DelMOWin2010_100687883 | 3300000117 | Marine | MTNKEKIEKIIELKMVKPQTQKIKKEIQKLQQELDEKF* |
| TDF_OR_ARG04_113mDRAFT_10087644 | 3300000121 | Marine | MTIKEISAEIVRLKLLKPQTQEIKKKIQKLQQQIGNA* |
| LP_F_10_SI03_10DRAFT_10461552 | 3300000137 | Marine | MTKQEIVKKIVELKLIKPQTQKIKLQIQKLQQKLNND* |
| LPjun09P1210mDRAFT_10013313 | 3300000168 | Marine | MTTQEITKKIVELKLQKPQTQKVKLEIQKLQQKLNK* |
| BBAY93_101558762 | 3300000973 | Macroalgal Surface | MTTTEIHKEIVRLKLIRPQTQEIKLKIQKLQQQLSNG* |
| JGI20151J14362_100208636 | 3300001346 | Pelagic Marine | MTTTEIAKKIVELKLLKPQTQKIKLEIQKLQQKLNK* |
| JGI24006J15134_101669513 | 3300001450 | Marine | MTTKEITAEIRRLKSLKQSQYIKLQIQKLQQKLDAKN* |
| sbbSud_1000433 | 3300001662 | Marine | MMTTKEISEIIVALKLIKPQTQQIKLKIQKLQQQLNKDV* |
| GOS2225_10207052 | 3300001939 | Marine | MKKKEIVKKIVELKLQKPQTQKVKLEIQKLQQKLSND* |
| GOS2249_10510652 | 3300001951 | Marine | MTIDEIAKKIVELKLVKPQTQEIKLKIQKLQQKLNR* |
| GOS2266_10407324 | 3300001956 | Marine | MDKKDIAKEIVKLKLAKPQTQEIKLKIQKLQQKLGK* |
| GOS2243_10846363 | 3300001965 | Marine | MTKEQIVEKIVELKLVKPQTQEIKLQIQKLQQRLSK* |
| JGI26079J46598_10735932 | 3300003216 | Marine | MDKDLILKRIVALKQIKPQTXETKLEIQKLQQKLDDKIYXK* |
| JGI26084J50262_10132913 | 3300003427 | Marine | LIMTNKEKIQKILELKMVKPQTQKIKKEIQKLQQELDEKI* |
| Ga0066605_101329183 | 3300004279 | Marine | MTIKEISAEIRRLKLVKPQTQGIKIKIQKLQQQLFERDGI* |
| Ga0078893_1008341613 | 3300005837 | Marine Surface Water | MDNKEIIKKILELKLIKPQTQKIKAQIQKLQQKLEE* |
| Ga0078893_107280644 | 3300005837 | Marine Surface Water | MDKKKIIERIVELKLVKPQTQKIKLEIQKLQQKLNND* |
| Ga0066369_100438764 | 3300005969 | Marine | MDKQEIRYEIVRLKLINPQTQELKKQIQLLQQQL* |
| Ga0075474_100835763 | 3300006025 | Aqueous | MDKKEKIEKIIELKMVKPQTQKIKKEIQKLQQELDEKF* |
| Ga0075446_100743532 | 3300006190 | Marine | MTTKEIRDEIIRLKLIKPQTQALKKKIQKLQQIDVKN* |
| Ga0075510_110571039 | 3300006405 | Aqueous | KKEKIEKIIELKMVKPQTQKIKKEIQKLQQELDEKF* |
| Ga0098054_10628002 | 3300006789 | Marine | MDREKLVNKIVELKLIKPQTQKIKLQIQKLQQQLDNTKYD* |
| Ga0098054_12630792 | 3300006789 | Marine | MTIIEIVEEIVRLKLIKPQTQEIKLKIQKLQQQLSKGDQ* |
| Ga0070754_102126573 | 3300006810 | Aqueous | MTNKEKIEKIIELKMVKPQTQKIKKEIQKLQQELDEKI* |
| Ga0075476_100853403 | 3300006867 | Aqueous | LIMTNKEKIEKIIELKMVKPQTQKIKKEIQKLQQELDEKF* |
| Ga0075475_1000356016 | 3300006874 | Aqueous | NKEKIEKIIELKMVKPQTQKIKKEIQKLQQELDEKI* |
| Ga0070750_1000165712 | 3300006916 | Aqueous | MDKKEIIDTIVKLKLQKPQTQKIKLEIQRLQQKLNK* |
| Ga0070746_103620393 | 3300006919 | Aqueous | MDKKEKIEKIIELKMVKPQTQKIKKEIQKLQQELDEKI* |
| Ga0099849_10016468 | 3300007539 | Aqueous | MTIKEIHEEIVRLKLIKPQTQEIKIKIQKLQQQLNNG* |
| Ga0102855_11366762 | 3300007647 | Estuarine | MEKQKIVKKIVELKLQKPQTQKIKLQIQKLQQKLNND* |
| Ga0102825_11264081 | 3300007655 | Estuarine | MTVTEIAKKIVELKLRKPQTQKIKLEIQKLQQKLNND* |
| Ga0105738_10026284 | 3300007953 | Estuary Water | MNRKEITAEIRRLKLVKPQTQKIKLEIQKLQQKLEDD* |
| Ga0075480_100004161 | 3300008012 | Aqueous | KEKIEKIIELKMVKPQTQKIKKEIQKLQQELDEKF* |
| Ga0098052_10006142 | 3300008050 | Marine | MEKQEIVKKIVELKLQKPQTQKIKLQIQKLQQKLNND* |
| Ga0115371_1126456811 | 3300008470 | Sediment | MTTKEIRDEIIRLKLVKPQTQALKMRIQKLQQIEIDGTKN* |
| Ga0102891_11870331 | 3300008950 | Estuarine | MNRKEITSEIRRLKLVKPQTQKIKLEIQKLQQKLEDD* |
| Ga0102960_10653193 | 3300009000 | Pond Water | MTNQEIIKKIVELKLQKPQTQKIKLQIQKLQQKLNK* |
| Ga0102813_10626033 | 3300009003 | Estuarine | MDKKKIIERIVELKLVKPQTQKIKLEIQKLQQKLEDD* |
| Ga0102854_10671882 | 3300009058 | Estuarine | MTKQEIVKKIVELKLQKPQTQKIKLQIQKLQQKLNND* |
| Ga0115566_102173742 | 3300009071 | Pelagic Marine | MDREKLVNKIVELKLLKPQTQEIKLKIQKLQQKLNK* |
| Ga0115549_10257885 | 3300009074 | Pelagic Marine | MTTKEISAEIRRLKLVKPQTQRIKLKIQKLQQKLFLKDGI* |
| Ga0115549_10703324 | 3300009074 | Pelagic Marine | MTIKEKVEEIVRLKLIKPQTQKIKLKIQKLQQELNA* |
| Ga0118729_100192634 | 3300009130 | Marine | MTIKEIHEEIVRLKLIKPQTQEIKIKIQKLQQQLSNG* |
| Ga0114994_101195504 | 3300009420 | Marine | MDKKDIVKKIVELKLKKPQNQKTKLQIQKLQQKLNND* |
| Ga0114994_102339194 | 3300009420 | Marine | MNRKELSAEIRRLKMVKPQTQKIKLQIQKLQQQLEDE* |
| Ga0115005_100335295 | 3300009432 | Marine | MTTKEISAEIRRLKLVKPQTFETKKRIQKLQQQLNDA* |
| Ga0115546_11091203 | 3300009435 | Pelagic Marine | MDKKSIIDKIVELKLQKPQTQKIKLQIQKLQQKLNND* |
| Ga0115008_1001792515 | 3300009436 | Marine | MTTKEISAEIVRLKLIKPQTQKIKLKIQKLQQELNA* |
| Ga0115561_11743123 | 3300009440 | Pelagic Marine | MDREKLVNKIVKLKLLKPQTQEIKLKIQKLQQKLNK* |
| Ga0115558_11439742 | 3300009449 | Pelagic Marine | MNREKLVNKIVELKLLKPQTQEIKLKIQKLQQKLNK* |
| Ga0115100_109212532 | 3300009608 | Marine | MDKKEIIERIVELKLVKPQTQKIKLEIQKLQQKLNND* |
| Ga0098049_11165552 | 3300010149 | Marine | MEKKEIVNKIVELKLIKPQTQKIKLQIQKLQQQLDNTKYD* |
| Ga0160423_1000343011 | 3300012920 | Surface Seawater | MTKEQIVEKIVELKLVKPQTQEIKLKIQKLQQKLGK* |
| Ga0160423_100115494 | 3300012920 | Surface Seawater | MNSKEIVDEIVRLKLLKPQTQEIKLKIQKLQQKLKK* |
| Ga0160423_101225331 | 3300012920 | Surface Seawater | MTIKERVEVISSEIIKYKFEYPQTQKIKLKIQKLQQELNELTLSQ* |
| Ga0160423_102848583 | 3300012920 | Surface Seawater | MTINETSKKIVELKLMKPQTQEIKLKIQKLQQHLSKLTRESNDS* |
| Ga0163110_102763452 | 3300012928 | Surface Seawater | MTKEQIVEKIVELKLVKPQTQEIKLKIQKLQQKLNR* |
| Ga0163111_101801261 | 3300012954 | Surface Seawater | NIVNEILDLKLQKKQTQEMKERIQKLQQRLSDLTK* |
| Ga0116834_11032692 | 3300013188 | Marine | MDKKDIAKEIVKLKLVKPQTQEIKLKIQKLQQKLGK* |
| Ga0181377_10803212 | 3300017706 | Marine | MEKQEIVKKIVELKLQKPQTQKIKLQIQKLQQKLSND |
| Ga0181377_10989552 | 3300017706 | Marine | MTIKERVEVISSEIIKYKFEYPQTQKIKLKIQKLQQELNEITLNK |
| Ga0181403_10332422 | 3300017710 | Seawater | MTVTEIAKKIVELKLRKPQTQKIKLEIQKLQQKLNND |
| Ga0181404_11754892 | 3300017717 | Seawater | MDKKEIIERIVELKLVKPQTQKIKLEIQKLQQKLNGK |
| Ga0181388_10052302 | 3300017724 | Seawater | MNRKEITAEIRRLKLVKPQTQKIKLEIKKLQQKLEDD |
| Ga0181417_10082851 | 3300017730 | Seawater | MTIKEIASEIVRLKLIRPQTQEIKLKIQKLQQQLGK |
| Ga0181421_11756732 | 3300017741 | Seawater | MTIKEISAEIRRLKLLKPQTQGIKIKIQKLQQQLFERDGI |
| Ga0181389_10513661 | 3300017746 | Seawater | TITEIHEEIVRLKLIRPQTQEIKLKIQKLQQQLSNG |
| Ga0181405_11464152 | 3300017750 | Seawater | MDKKEIIERIVELKLVKPQTQKIKLEIQKLQQKLEDD |
| Ga0181565_101890433 | 3300017818 | Salt Marsh | MDKELILKKIVELKSTNPQTQEIKLEIQKLQQKLDEKF |
| Ga0181552_103580073 | 3300017824 | Salt Marsh | MDKEEKIQKILELKMVKPQTQKIKKEIQKLQQELDEKI |
| Ga0181552_104074962 | 3300017824 | Salt Marsh | MDKELILKKIVELKMNKPQTQKTKLEIQKLQQKLDEKI |
| Ga0181571_102565773 | 3300017957 | Salt Marsh | MDKELILKKIVELKSTNPQTQEIKLEIQKLQQKLDEKI |
| Ga0181590_103690572 | 3300017967 | Salt Marsh | MTNKEKIEKIIELKMVKPQTQKIKKEIQKLQQELDEKI |
| Ga0181576_102019554 | 3300017985 | Salt Marsh | MDKNLILKKIVELKAVKPQTQEIKLEIQKLQQKLDEKI |
| Ga0181572_105852111 | 3300018049 | Salt Marsh | MDKNLILKKIVELKAVKPQTQETKLQIQKLQQKLDNEKIYKK |
| Ga0181567_108306181 | 3300018418 | Salt Marsh | MDNNLTIKKIVELKMKKPQTQETKLKIQKLQQTLKI |
| Ga0192818_100460252 | 3300018940 | Marine | MTIEEIKKEIIRLKLLTQTPKIKLKIQKLQQQLNGN |
| Ga0192961_100591465 | 3300018980 | Marine | MTTKEISAEIVRLKLIKPQTQKIKLKIQKLQQELNA |
| Ga0194024_10506182 | 3300019765 | Freshwater | MTNKEKIEKIIELKMVKPQTQKIKKEIQKLQQELDEKF |
| Ga0206125_100144188 | 3300020165 | Seawater | MTTKEITAEIRRLKSLKQSQYIKLQIQKLQQKLDAKN |
| Ga0206125_100206799 | 3300020165 | Seawater | MDREKLVNKIVELKLLKPQTQEIKLKIQKLQQKLNK |
| Ga0206125_100325164 | 3300020165 | Seawater | MTTTEIAKKIVELKLLKPQTQKIKLEIQKLQQKLNK |
| Ga0206125_100602503 | 3300020165 | Seawater | MEKQEIVKKIVELKLQKPQTQKIKLQIQKLQQKLNND |
| Ga0206127_10258787 | 3300020169 | Seawater | MTTKEISAEIRRLKLVKPQTQRIKLKIQKLQQKLFLKDGI |
| Ga0206129_101725131 | 3300020182 | Seawater | EFTAEIRRLKSLKQSQYIKLQIQKLQQKLDKRDGI |
| Ga0206130_101788293 | 3300020187 | Seawater | MTTKEITAEIRRLKSLKQSQYIKLQIQKLQQKLDKRDGI |
| Ga0206130_103725201 | 3300020187 | Seawater | MTTKEITAEIRRLKSLKQSQYIKLQIQKLQQKLDAK |
| Ga0211685_10262072 | 3300020253 | Marine | MTTKEIRDEIIRLKLIKPQTQALKKKIQKLQQIDVKN |
| Ga0211685_10307594 | 3300020253 | Marine | MTTKEIRDEIIRLKLVKPQTQALKMRIQKLQQIEIDGTKN |
| Ga0211658_10360043 | 3300020274 | Marine | MTKEQIVEKIVELKLVKPQTQEIKLQIQKLQQRLSK |
| Ga0211504_10141284 | 3300020347 | Marine | MNKKEITAEVRRLKLIKPQTQKIKLQIQKLQQKLEE |
| Ga0211504_10402623 | 3300020347 | Marine | MTIKEISAEIRRLKLVKPQTQGIKIKIQKLQQQLFERDGI |
| Ga0211652_100040904 | 3300020379 | Marine | MDNERVIEEIVKLKLVKPQTQEIKLKIQKLQQKLNK |
| Ga0211678_102768554 | 3300020388 | Marine | MTIKEITAEIRRLKLVKPQTQGIKIKIQKLQQQLFELDAKN |
| Ga0211659_100588842 | 3300020404 | Marine | MTIDEIAKKIVELKLVKPQTQEIKLKIQKLQQKLNR |
| Ga0211653_101294002 | 3300020421 | Marine | MDKKKIIERIVELKLVKPQTQKIKLEIQKLQQKLNND |
| Ga0211576_103964653 | 3300020438 | Marine | MHNEAVIKKIVELKMIKPPTQEIKLKIQKLQQKLK |
| Ga0211576_105805301 | 3300020438 | Marine | MEKQKIVKKIVELKLQKPQTQKIKLQIQKLQQKLNND |
| Ga0211558_100056987 | 3300020439 | Marine | MKEHIKEVTEKIVEYKLKYPQTQKIKLKIQKLQQELNELTRTQ |
| Ga0211564_100289937 | 3300020445 | Marine | MTIIEIVEEIVRLKLIKPQTQEIKLKIQKLQQQLSKAD |
| Ga0211577_101960203 | 3300020469 | Marine | MDNKEIIKKILELKLIKPQTQKIKAQIQKLQQKLTK |
| Ga0211547_103497863 | 3300020474 | Marine | TIKERVEVISSEIIKYKFEYPQTQKIKLKIQKLQQELSEITLNR |
| Ga0206677_100006488 | 3300021085 | Seawater | MDKKEIIERIVELKLVKPQTQKIKLEIQKLQQKLNND |
| Ga0206677_100255608 | 3300021085 | Seawater | MNRKEITAEIRRLKLVKPQTQKIKLEIQKLQQKLEDD |
| Ga0206677_100528102 | 3300021085 | Seawater | MDKKEIIDTIVKLKLQKPQTQKVKLEIQKLQQKLNK |
| Ga0213867_100002455 | 3300021335 | Seawater | MDNKEIIKKILELKLIKPQTQKIKAQIQKLQQKLSK |
| Ga0213867_10784315 | 3300021335 | Seawater | MTQEEITKKIVNLKLKKQTPEIKLQIQKLQQKLDK |
| Ga0213859_100001363 | 3300021364 | Seawater | MDNEKVIEEIVKLKLVKPQTQEIKLKIQKLQQKLNK |
| Ga0213859_100213473 | 3300021364 | Seawater | MDKNIILKKIVELKAVKPQTQETKLEIQKLQQKLDNEKIYKK |
| Ga0213859_102689733 | 3300021364 | Seawater | MDSKKKKTLDEIVKLKLIKPQTQEIKLKIQKLQQKLEK |
| Ga0206123_101172953 | 3300021365 | Seawater | MDREKLVNKIVELKLLKPQTQEIKLKIQKLQQKLNND |
| Ga0213860_100782442 | 3300021368 | Seawater | MTIKEIHEEIVRLKLIKPQTQEIKIKIQKLQQQLNNG |
| Ga0213869_100006532 | 3300021375 | Seawater | MEKQEIVKKIVELKLQKPQTQKIKLEIQKLQQKLNND |
| Ga0213864_103870752 | 3300021379 | Seawater | MKLKMDKDIILKKIVELKAVKPQTQETKLEIQKLQQKLDNEKIYKK |
| Ga0222717_100788292 | 3300021957 | Estuarine Water | MTNQEIIKKIVELKLQKPQTQKIKLQIQKLQQKLNK |
| Ga0222717_102899673 | 3300021957 | Estuarine Water | MDKEKLVNKIVELKLIKPQTQEIKLQIQKLQQRLSK |
| (restricted) Ga0233432_101037855 | 3300023109 | Seawater | MDKKKIIDRIVELKLVKPQTQKIKLEIQKLQQKLEDD |
| Ga0255761_102924672 | 3300023170 | Salt Marsh | MDKEKLLNKIVELKLVKPQTQEIKLKIQKLQQKLNR |
| Ga0255759_1001285011 | 3300023178 | Salt Marsh | MDNNLTIKKIVELKMKKPQTQETKLKIQKLQQTLKKYD |
| Ga0232112_10396222 | 3300023693 | Seawater | MTKQEIVKKIVELKLIKPQTQKIKLQIQKLQQKLNND |
| Ga0228653_10181433 | 3300024237 | Seawater | MDNKKIIEKILELKLIKPQTQKVKEQIQKLQQKLNK |
| (restricted) Ga0233438_102576533 | 3300024255 | Seawater | MDKKKIIERIVELKLVKPQTQKIKLEIQKLQQKLEDD |
| Ga0228656_11043851 | 3300024322 | Seawater | MDNKKIIEKILELKLIKPQTQKVKEQIQKLQQKLN |
| Ga0244775_102615762 | 3300024346 | Estuarine | MNRKEITSEIRRLKLVKPQTQKIKLEIQKLQQKLEDD |
| Ga0244776_101286112 | 3300024348 | Estuarine | MTKQEIVKKIVELKLQKPQTQKIKLQIQKLQQKLNND |
| Ga0228663_10475941 | 3300024508 | Seawater | MTKQEIVKKIVELKLVKPQTQKIKLQIQKLQQKLNND |
| Ga0208667_10170293 | 3300025070 | Marine | MEKKEIVNKIVELKLIKPQTQKIKLQIQKLQQQLDNTKYD |
| Ga0209535_10632912 | 3300025120 | Marine | MSNMTTQEITKKIVELKLQKPQTQKVKLEIQKLQQKLNK |
| Ga0209716_100002791 | 3300025626 | Pelagic Marine | MDKKEITAEVRRLKLIKPQTQKIKLQIQKLQQKLEE |
| Ga0209136_10592242 | 3300025636 | Marine | MDKDLILKRIVALKQIKPQTMETKLEIQKLQQKLDDKIY |
| Ga0208428_100005028 | 3300025653 | Aqueous | MDKKEKIEKIIELKMVKPQTQKIKKEIQKLQQELDEKF |
| Ga0209653_100527013 | 3300025695 | Marine | MTNKEKIQKILELKMVKPQTQKIKKEIQKLQQELDEKI |
| Ga0209653_100633311 | 3300025695 | Marine | MDKKEKIQKILELKMIKPQTQKIKKEIQKLQQELDEKI |
| Ga0209771_11186691 | 3300025701 | Marine | MDKDLILKRIVALKQIKPQTIETKLEIQKLQQKLDDKIYKK |
| Ga0208899_11913993 | 3300025759 | Aqueous | MDKKEIIDTIVKLKLQKPQTQKIKLEIQRLQQKLNK |
| Ga0209630_100857144 | 3300025892 | Pelagic Marine | MNREKLVNKIVELKLLKPQTQEIKLKIQKLQQKLNND |
| Ga0208801_10270442 | 3300027367 | Estuarine | MEKQKIVKKIVELKLQKPQTQKIKLQIQKLQQKLNK |
| Ga0209090_100601142 | 3300027813 | Marine | MDKKDIVKKIVELKLKKPQNQKTKLQIQKLQQKLNND |
| Ga0209712_100083063 | 3300027849 | Marine | MTTKEISAEIRRLKLVKPQTFETKKRIQKLQQQLNDA |
| Ga0247582_10514262 | 3300028109 | Seawater | MTKQEIVKKIVELKLIKPQTQKIKLQIQKLQQKLNK |
| Ga0307488_101098222 | 3300031519 | Sackhole Brine | MNREKLVNKIVELKLIKPQTQEIKLKIQKLQQKLNK |
| Ga0315327_108501412 | 3300032032 | Seawater | RHLTEVEITNEIIELKTKKTQTQEIKLRIQKLQQQLNK |
| ⦗Top⦘ |