


| Basic Information | |
|---|---|
| Family ID | F050480 |
| Family Type | Metagenome |
| Number of Sequences | 145 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MDKEINGHLYITNDNLKRIADALEEILRLVKKDMEPRTKKKD |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 84.14 % |
| % of genes near scaffold ends (potentially truncated) | 20.69 % |
| % of genes from short scaffolds (< 2000 bps) | 94.48 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (81.379 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (62.759 % of family members) |
| Environment Ontology (ENVO) | Unclassified (97.241 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (93.793 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.14% β-sheet: 0.00% Coil/Unstructured: 42.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF03592 | Terminase_2 | 0.69 |
| PF08401 | ArdcN | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG3728 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 0.69 |
| COG4227 | Antirestriction protein ArdC | Replication, recombination and repair [L] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 81.38 % |
| All Organisms | root | All Organisms | 18.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 62.76% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 15.17% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 6.21% |
| Filtered Seawater | Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater | 3.45% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.07% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 2.07% |
| Marine Oceanic | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic | 1.38% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.38% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.69% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.69% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.69% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.69% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.69% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.69% |
| Diffuse Hydrothermal Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Fluids | 0.69% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001721 | Marine viral communities from the Pacific Ocean - LP-54 | Environmental | Open in IMG/M |
| 3300001727 | Marine viral communities from the Pacific Ocean - LP-55 | Environmental | Open in IMG/M |
| 3300001731 | Marine viral communities from the Pacific Ocean - LP-37 | Environmental | Open in IMG/M |
| 3300001733 | Marine viral communities from the Deep Pacific Ocean - MSP112 | Environmental | Open in IMG/M |
| 3300001743 | Marine viral communities from the Pacific Ocean - LP-38 | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002482 | Marine viral communities from the Pacific Ocean - ETNP_2_30 | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300002511 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 | Environmental | Open in IMG/M |
| 3300002514 | Marine viral communities from the Pacific Ocean - ETNP_6_85 | Environmental | Open in IMG/M |
| 3300002760 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 | Environmental | Open in IMG/M |
| 3300005430 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 | Environmental | Open in IMG/M |
| 3300005521 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255 | Environmental | Open in IMG/M |
| 3300005605 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV67 | Environmental | Open in IMG/M |
| 3300005969 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_Bottom_ad_4513_LV_A | Environmental | Open in IMG/M |
| 3300006076 | Microbial communities in diffuse hydrothermal fluids of Manus Basin, Bismarck Sea ? fluid A | Environmental | Open in IMG/M |
| 3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
| 3300006308 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0500m | Environmental | Open in IMG/M |
| 3300006325 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0500m | Environmental | Open in IMG/M |
| 3300006340 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0770m | Environmental | Open in IMG/M |
| 3300006341 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT236_2_0770m | Environmental | Open in IMG/M |
| 3300006736 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300006988 | Marine viral communities from Cariaco Basin, Caribbean Sea - 24B_WHOI_OMZ_CsCl | Environmental | Open in IMG/M |
| 3300007291 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_AAIW_ad_750m_LV_A | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008218 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009414 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 | Environmental | Open in IMG/M |
| 3300009577 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3750_2500 | Environmental | Open in IMG/M |
| 3300009602 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 | Environmental | Open in IMG/M |
| 3300009603 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 | Environmental | Open in IMG/M |
| 3300009604 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 | Environmental | Open in IMG/M |
| 3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
| 3300009620 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_51 | Environmental | Open in IMG/M |
| 3300009622 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155 | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300017718 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_11 viral metaG | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
| 3300021442 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300022227 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_150_PacBio MetaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300025029 | Marine viral communities from the Pacific Ocean - LP-39 (SPAdes) | Environmental | Open in IMG/M |
| 3300025039 | Marine viral communities from the Pacific Ocean - LP-41 (SPAdes) | Environmental | Open in IMG/M |
| 3300025040 | Marine viral communities from the Pacific Ocean - LP-43 (SPAdes) | Environmental | Open in IMG/M |
| 3300025042 | Marine viral communities from the Pacific Ocean - LP-47 (SPAdes) | Environmental | Open in IMG/M |
| 3300025043 | Marine viral communities from the Subarctic Pacific Ocean - LP-52 (SPAdes) | Environmental | Open in IMG/M |
| 3300025045 | Marine viral communities from the Pacific Ocean - LP-46 (SPAdes) | Environmental | Open in IMG/M |
| 3300025046 | Marine viral communities from the Pacific Ocean - LP-45 (SPAdes) | Environmental | Open in IMG/M |
| 3300025049 | Marine viral communities from the Pacific Ocean - LP-55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025050 | Marine viral communities from the Pacific Ocean - LP-54 (SPAdes) | Environmental | Open in IMG/M |
| 3300025052 | Marine viral communities from the Pacific Ocean - LP-37 (SPAdes) | Environmental | Open in IMG/M |
| 3300025069 | Marine viral communities from the Pacific Ocean - LP-38 (SPAdes) | Environmental | Open in IMG/M |
| 3300025072 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025078 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025112 | Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300025118 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025122 | Marine viral communities from the Pacific Ocean - ETNP_2_300 (SPAdes) | Environmental | Open in IMG/M |
| 3300025125 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025236 | Marine viral communities from the Deep Pacific Ocean - MSP-144 (SPAdes) | Environmental | Open in IMG/M |
| 3300025247 | Marine viral communities from the Deep Pacific Ocean - MSP-91 (SPAdes) | Environmental | Open in IMG/M |
| 3300025248 | Marine viral communities from the Deep Pacific Ocean - MSP-118 (SPAdes) | Environmental | Open in IMG/M |
| 3300025251 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 (SPAdes) | Environmental | Open in IMG/M |
| 3300025264 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025268 | Marine viral communities from the Deep Pacific Ocean - MSP-114 (SPAdes) | Environmental | Open in IMG/M |
| 3300025277 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 (SPAdes) | Environmental | Open in IMG/M |
| 3300025286 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 (SPAdes) | Environmental | Open in IMG/M |
| 3300025873 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300026080 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_NADW_ad_2500m_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300026213 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV73 (SPAdes) | Environmental | Open in IMG/M |
| 3300031804 | Marine microbial communities from Western Arctic Ocean, Canada - CB11b_AW_Bot5 | Environmental | Open in IMG/M |
| 3300032132 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - ASW #5 | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| 3300034629 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 543_2600 | Environmental | Open in IMG/M |
| 3300034654 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 487_2244 | Environmental | Open in IMG/M |
| 3300034655 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 494_2800 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24528J20060_10112922 | 3300001721 | Marine | MEKEINGHLYITNDNLKRIADAIEEILRLVKKDMEP |
| JGI24529J20061_1027213 | 3300001727 | Marine | LYITNDNLKRIADAIEEILRIVKKDMEPRTKKKEK* |
| JGI24529J20061_1076412 | 3300001727 | Marine | MKLEKEINGHLYITNDNLKRIADAIEEILRIVKKDMEPRTKEKS* |
| JGI24529J20061_1091822 | 3300001727 | Marine | NLERYNMEKEINGHLYITNDNLKRIADAIEEILRLVKKDMEPRDKNKK* |
| JGI24514J20073_10131552 | 3300001731 | Marine | MKLEKEINGHLYITNDNLKRIADAIEEILRLVKKDMEPRTKEKK* |
| JGI24655J20075_10213081 | 3300001733 | Deep Ocean | MKLEKEINGHLYITNDNLKRIADAIEEILRLVKKDMEPRTKEKK*SLKNQKRKQ |
| JGI24515J20084_10035033 | 3300001743 | Marine | MDKETNGHLYIANDNLKRIADALEEILRLVKKDMEPRTKKTDEA* |
| JGI24515J20084_10036682 | 3300001743 | Marine | MDKEINGHLYITNDNLKRIADAIEEILRIVKKDMEPRTKKETE* |
| JGI24515J20084_10127542 | 3300001743 | Marine | MEKEINGHLYITNDNLKRIADAIEEILRLVKKDMEPRTKKEKE* |
| KVRMV2_1013367301 | 3300002231 | Marine Sediment | MEKEVNGHLYIANDNLKRIADALDEILRLVKKDMEKYEEKKR* |
| JGI25127J35165_10556662 | 3300002482 | Marine | MDKEVNGHLYIANDNLKRIADALEEILRLVKQDMERMKKLND* |
| JGI25132J35274_10200042 | 3300002483 | Marine | MDKEVNGHLYIANDNLKRIADALEEILRLVKEDQERMKKLND* |
| JGI25132J35274_10268784 | 3300002483 | Marine | MDKEINGHLYIANDNLKRIADALEEILRLVKQDMQKYEKKN* |
| JGI25131J35506_10040812 | 3300002511 | Marine | MKLEKEINGHLYITNDNLKRIADAIEEILRLVKKDMEPREKNKK* |
| JGI25131J35506_10362321 | 3300002511 | Marine | MDKEINGHLYITNDNLKRIADALEEILRLVKKDMEPRTKKKTDENK* |
| JGI25133J35611_100420071 | 3300002514 | Marine | MDKEINGHLYIANDNLKRIADALEEILRLVKADQEKMRKIKDE* |
| JGI25133J35611_101775363 | 3300002514 | Marine | IMDKEVNGHLYIANDNLKRIADALEEILRLVKKDMEPREKKKN* |
| JGI25136J39404_10488842 | 3300002760 | Marine | MEKEINGHLYITNDNLKRIADALEEILRLVKKDMEPRTKKKD* |
| JGI25136J39404_10857771 | 3300002760 | Marine | MDKETNGHLYIANDNLKRIADAIEEILRLVKKDMEPRTKKTDET* |
| Ga0066849_103714383 | 3300005430 | Marine | MDKEINGHLYIANDNLKRIADALEEILRLVKEDQKKMEEYAKKK* |
| Ga0066862_103074981 | 3300005521 | Marine | MDKEVNGHLYIANDNLKRIADALDEILRLVKKDMEKYEKSKK* |
| Ga0066850_102283161 | 3300005605 | Marine | MDKEVNGHLYIANDNLKRIADALEEILRLVKKDLEPREKNKK* |
| Ga0066369_101347672 | 3300005969 | Marine | MDKEINGHLYITNDNLKRIADALEEILRLVKKDMEPRTKKEKE* |
| Ga0081592_11696922 | 3300006076 | Diffuse Hydrothermal Fluids | MEKEINGHLYITNDNLKRIADAIEEILRLVKKDMEPRTKKKD* |
| Ga0075446_101001262 | 3300006190 | Marine | MEKEINGHLYITNDNLKRIADALEEILRLVKKDMEPRTKKKDA* |
| Ga0068470_18450392 | 3300006308 | Marine | MEKEINGHLYITNDNLKRIADAIEEILRLVKKDMEPREKNKK* |
| Ga0068501_12717293 | 3300006325 | Marine | MDKEINGHLYITNDNLKRIADAIEEILRLVKKDMEPREKNKK* |
| Ga0068503_102728763 | 3300006340 | Marine | MDKETNGHLYIANDNLKRIADAIEEILRLVKKDMEPREK |
| Ga0068503_104419871 | 3300006340 | Marine | MEKEINGHLYITNDNLKRIADALEEILRLVKKDMEPKKK* |
| Ga0068503_104469593 | 3300006340 | Marine | MDKEVNGHLYIANDNLKRIADALDEILRLVKKDMETMKKAAK* |
| Ga0068503_105186443 | 3300006340 | Marine | MEKEINGHLYITNDNLKRIADALEEILRLVKKDMEPRTKEKK* |
| Ga0068503_105233641 | 3300006340 | Marine | MKKVKYHDTCLEKEINGHLYMTNDNLKRIADAIEEILRLVKKDMEPRTKKEKE* |
| Ga0068503_105537232 | 3300006340 | Marine | MDKEINGHLYITNDNLKRIADAIEEIMRLVKKDMEPRTKEKK* |
| Ga0068503_106600783 | 3300006340 | Marine | MDKEVNGHLYIANDNLKRLADAIEEILRLVKKDMEPRTKKKDE* |
| Ga0068493_107509532 | 3300006341 | Marine | MKKVKYHDTCLEKEINGHLYITNDNLKRIADAIEEILRLVKKDMEPRTKEKK* |
| Ga0098033_12112991 | 3300006736 | Marine | MEKEINGHLYITNDNLKRIADAIEEILRLVKKDMEPRTKEKDEKTK* |
| Ga0098035_10583633 | 3300006738 | Marine | MDKETNGHLYIANDNLKRIADILEEILKLVKKDMEPREKN* |
| Ga0098039_10496013 | 3300006753 | Marine | MDKETNGHLYIANDNLKRIADALDEILRLVKKDMEPRTKKNEEN* |
| Ga0098039_11092773 | 3300006753 | Marine | MKNLETNGHLYIANDNLKRIADALEEILRLVKEDQEKMRKINEKNN* |
| Ga0098039_12036364 | 3300006753 | Marine | MEKETNGHLYILNDNILRIADAIEEILRLVKKDMEPREKNKK* |
| Ga0098039_13035082 | 3300006753 | Marine | MEKEINGHLYITNDNLKRIADAIEEILRLVKKDMEPRDKNKK* |
| Ga0098044_10648353 | 3300006754 | Marine | MDKEVNGHLYIANDNLKRIADALDEILRLVKKDMEKYEEKNKK* |
| Ga0098044_12892521 | 3300006754 | Marine | LYIANDNLKRIADALDEILRLVKKDMEKYEKKKSKK* |
| Ga0098054_11797562 | 3300006789 | Marine | MDKEINGHLYIANDNLKRIADALEEILRLVKEDQEKMRKIKDE* |
| Ga0098055_10315057 | 3300006793 | Marine | MEKEVNGHLYIANDNLKRIADALDEILRLVKKDMEKYEKKKSKK* |
| Ga0098051_11340132 | 3300006924 | Marine | MDKETNGHLYIANDNLKRIADALDEILRLVKEDQEKM |
| Ga0098051_11565111 | 3300006924 | Marine | MEKEVNGHLYIANDNLKRIADALDEILRLVKKDMEKYEEKKNKK* |
| Ga0098041_12809132 | 3300006928 | Marine | MDKEINGHLYIANDNLKRIADALEEILRLVKEDQEKMRKISEEN* |
| Ga0098041_13032651 | 3300006928 | Marine | GHLYIANDNLKRIADALEEILRLVKKDMEKYEKKKH* |
| Ga0075444_102452851 | 3300006947 | Marine | MEKEINGHLYITNDNLKRIADAIEEILRLVKKDMEPRTKKKN* |
| Ga0098064_1330242 | 3300006988 | Marine | MDKEVNGHLYIANDNLKRIADALEEILRLVKADQEKMEKYKNENN* |
| Ga0066367_13796893 | 3300007291 | Marine | LERYNMEKEINGHLYITNDNLKRIADAIEEILRLVKKDMEPRTKEKN* |
| Ga0098052_12243691 | 3300008050 | Marine | EVNGHLYIANDNLKRIADALEEILRLVKKDMEKYEKKKH* |
| Ga0114904_10315242 | 3300008218 | Deep Ocean | MEKEINGHLYITNDNLKRIADAIEEILRLVKKDMEPRTKKKDE* |
| Ga0114904_11236671 | 3300008218 | Deep Ocean | MSLKGINMDKEINGHLYITNDNLKRIADAVEEILRLVKKDMEPKKK* |
| Ga0114996_108715751 | 3300009173 | Marine | INGHLYITNDNLKRIADALEEILRLVKKDMEPRTKEKD* |
| Ga0114909_11125613 | 3300009414 | Deep Ocean | MKGINMDKEINGHLYITNDNLKRIADAVEEILRLVKKDMEPRTKD |
| Ga0105230_1132481 | 3300009577 | Marine Oceanic | MKVEKEINGHLYITNDNLKRIADALEEILRLVKKDMEPRTKEKA* |
| Ga0114900_10957092 | 3300009602 | Deep Ocean | MSLKGINMDKEINGHLYITNDNLKRIADAVEEILRLVKKDMEPRTKDKE* |
| Ga0114911_10477771 | 3300009603 | Deep Ocean | IMDKEVNGHLYIANDNLKRIADALEEILRLVKKDMEPREKSKK* |
| Ga0114901_11299101 | 3300009604 | Deep Ocean | MEKEVNGHLYIANDNLKRIADAMEEILRLVKKDLETYEKKNKK* |
| Ga0114901_11787651 | 3300009604 | Deep Ocean | MSLKGINMDKEINGHLYITNDNLKRIADAVEEILRLVKKDMEPRTKDK |
| Ga0114906_10360743 | 3300009605 | Deep Ocean | MDKETNGHLYIANDNLKRIADALEEILRLVKKDMEPREKRKE* |
| Ga0114906_10744352 | 3300009605 | Deep Ocean | MDKEINGHLYITNDNLKRIADAVEEILRLVKKDMEPRTKDKE* |
| Ga0114912_10529452 | 3300009620 | Deep Ocean | MDKEVNGHLYIANDNLKRIADALEEILRLVKKDMEPREKSKK* |
| Ga0105173_10349101 | 3300009622 | Marine Oceanic | KEVNGHLYIANDNLKRIADAIEEILRLVKKDMEPKKK* |
| Ga0098056_11291921 | 3300010150 | Marine | MDKEVNGHLYIANDNLKRIADALEEILRLVKKDMEKYEKKKH* |
| Ga0098061_10728651 | 3300010151 | Marine | MEKEINGHLYITNDNLKRIADAIEEILRLVKKDMEPREKKKN* |
| Ga0098061_11117645 | 3300010151 | Marine | MEKEVNGHLYIANDNLKRIADALDEILRLVKKDMEKYEKSKK* |
| Ga0098059_12175333 | 3300010153 | Marine | MDKEVNGHLYIANDNLKRIADALEEILRLVKKDMETMKKAAK* |
| Ga0098059_13530221 | 3300010153 | Marine | MEKEVNGHLYIANDNLKRIADALDEILRLVKKDMEKYEEKNKK* |
| Ga0098047_104032381 | 3300010155 | Marine | MDKETNGHLYIANDNLKRIADALDEILRLVKKDMEPRTKKKDD* |
| Ga0160423_101940501 | 3300012920 | Surface Seawater | MEKEINGHLYIANDNLKRIADALEEILRLVKEDQERMKKLNE* |
| Ga0181375_10697501 | 3300017718 | Marine | MITKGYKMEKEINGHLYITNDNLKRIADAIEEILRLVKKDMEPREKNKK |
| Ga0181433_10796302 | 3300017739 | Seawater | MKNLETNGHLYIANDNLKRIADTLEEILRLVKKDMEDNK |
| Ga0187219_11846182 | 3300017751 | Seawater | YNMEKEINGHLYITNDNLKRIADALEEILRLVKKDMEPREKNKK |
| Ga0181409_11703992 | 3300017758 | Seawater | MNLERNIMKNLETNGHLYIANDNLKRIADALEEILRLVKKDMEDNKKRWAESEKD |
| Ga0211699_104568453 | 3300020410 | Marine | MDKEVNGHLYIANDNLKRIADALEEILRLVKQDMQKYEKKKH |
| Ga0206685_100029673 | 3300021442 | Seawater | MEKEMNGHLYITNDNLKRIADAIEEILRLVKKDMEPRAKKRST |
| Ga0222715_103477954 | 3300021960 | Estuarine Water | MDRETNGHLYIVNDNLKRIADAITEILRLVKEDMDRSKQHYEKENDND |
| Ga0187827_106605092 | 3300022227 | Seawater | MDKEVNGHLYIANDNLKRIADALEEILRLVKKDLEPREKNKK |
| Ga0207900_1188601 | 3300025029 | Marine | MKLEKEINGHLYITNDNLKRIADALEEILRLVKKDMEPRTKKKD |
| Ga0207878_1324251 | 3300025039 | Marine | MEKEINGHLYITNDNLKRIADALEEILRLVKKDMEPR |
| Ga0207888_1278082 | 3300025040 | Marine | MDKEINGHLYITNDNLKRIADAIEEILRIVKKDMEPRIKEKD |
| Ga0207889_10040511 | 3300025042 | Marine | MNIEREEKMKLEKEINGHLYITNDNLKRIADAIEEILRIVKKDMEPKKK |
| Ga0207907_1287561 | 3300025043 | Marine | MDKETNGHLYIANDNLKRIADALEEILRLVKKDMEPRTKK |
| Ga0207901_10103074 | 3300025045 | Marine | MDKETNGHLYIANDNLKRIADILEEILKLVKKDMEPKK |
| Ga0207902_10035141 | 3300025046 | Marine | MDKEVNGHLYIANDNLKRIADALDEILRLVREDMKEMK |
| Ga0207902_10097391 | 3300025046 | Marine | MDKEINGHLYITNDNLKRIADALEEILRLVKKDMEPRTKDKS |
| Ga0207902_10104491 | 3300025046 | Marine | MKLEKEINGHLYITNDNLKRIADAIEEILRLVKKDMEPRTKKKEK |
| Ga0207902_10461861 | 3300025046 | Marine | MEKEINGHLYITNDNLKRIADAIEEILRIVKKDMEPRIKEKD |
| Ga0207898_10097152 | 3300025049 | Marine | MDKEINGHLYITNDNLKRIADALEEILRLVKKDQEQYAKKEKE |
| Ga0207898_10113152 | 3300025049 | Marine | MNKETNGHLYIANDNLKRIADILEEILKLVKKDMGVK |
| Ga0207898_10157334 | 3300025049 | Marine | MKLEKEINGHLYITNDNLKRIADAIEEILRIVKKDMEPRTKEKS |
| Ga0207898_10181752 | 3300025049 | Marine | MDKEINGHLYITNDNLKRIADALEEILRLVKKDMEPRTKKEKD |
| Ga0207892_10254031 | 3300025050 | Marine | MKLEKEINGHLYITNDNLKRIADAIEEILRLVKKDMEPRIKEKD |
| Ga0207892_10281291 | 3300025050 | Marine | MKKVKYHDTCLEKEINGHLYMTNDNLKRIADAIEEILRLVKKDMEPRTKKEKE |
| Ga0207892_10477092 | 3300025050 | Marine | MDKEINGHLYITNDNLKRIADALEEILRLVKKDMEPRTKKKD |
| Ga0207906_10324491 | 3300025052 | Marine | MEKEINGHLYITNDNLKRIADAIEEILRLVKKDMEPRAKKRST |
| Ga0207906_10342271 | 3300025052 | Marine | MEKEINGHLYITNDNLKRIADAIEEILRLVKKDMEPRTKDKN |
| Ga0207906_10489821 | 3300025052 | Marine | MDKEVNGHLYIANDNLKRIADALDEILRLVKKDMEPKKK |
| Ga0207906_10537923 | 3300025052 | Marine | MDKEVNGHLYIANDNLKRIADAIEEILRLVKKDMERMEKIKDE |
| Ga0207906_10546261 | 3300025052 | Marine | MDKEVNGHLYIANDNLKRIADALDEILRLVKKDMEKMEKIK |
| Ga0207887_10450682 | 3300025069 | Marine | MDKEINGHLYITNDNLKRIADALEEILRLVKKDMEPRTKKETE |
| Ga0207887_10502681 | 3300025069 | Marine | MKGINMDKEINGHLYITNDNLKRIADAIEEILRLVKKDMEPRTKKEKE |
| Ga0208920_10488731 | 3300025072 | Marine | MDKETNGHLYIANDNLKRIADILEEILKLVKKDMEPREKN |
| Ga0208668_10163321 | 3300025078 | Marine | MEKEINGHLYITNDNLKRIADAIEEILRLVKKDMEPREKNKK |
| Ga0208013_11144312 | 3300025103 | Marine | MDKEINGHLYIANDNLKRIADALEEILRLVKEDQEKMRKIKDE |
| Ga0208793_10105076 | 3300025108 | Marine | MEKEVNGHLYIANDNLKRIADALDEILRLVKKDMEKYEKKKSKK |
| Ga0208158_10977643 | 3300025110 | Marine | MDKEINGHLYIANDNLKRIADALEEILRLVKEDQEKMRKINDE |
| Ga0209349_11432301 | 3300025112 | Marine | MDKEINGHLYIANDNLKRIADALEEILRLVKADQEKMRKIKDE |
| Ga0209349_11537631 | 3300025112 | Marine | MDKEVNGHLYIANDNLKRIADALEEILRLVKLDQEKYQKLNEKK |
| Ga0208790_11092652 | 3300025118 | Marine | MDKEVNGHLYIANDNLKRIADALDEILRLVKKDMEKYEEKNKK |
| Ga0209434_10797513 | 3300025122 | Marine | MDKEVNGHLYIANDNLKRIADALDEILRLVRKDMENMKEAAK |
| Ga0209644_10235363 | 3300025125 | Marine | MKLEKEINGHLYITNDNLKRIADAIEEILRLVKKDMEPREKNKK |
| Ga0209644_10902572 | 3300025125 | Marine | MDKEINGHLYITNDNLKRIADALEEILRLVKKDMEPRTKEKK |
| Ga0209348_10435672 | 3300025127 | Marine | MDKEVNGHLYIANDNLKRIADALEEILRLVKEDMERMKKIND |
| Ga0208919_12516031 | 3300025128 | Marine | MEKEVNGHLYIANDNLKRIADALDEILRLVKKDMEKYEE |
| Ga0208299_10214131 | 3300025133 | Marine | EVNGHLYIANDNLKRIADALEEILRLVKKDMEKYEKKKH |
| Ga0207884_10084964 | 3300025236 | Deep Ocean | MDKEINGHLYIANDNLKRIADILEEILRLIKKDMGEMKKAAK |
| Ga0207884_10732001 | 3300025236 | Deep Ocean | NMDKEINGHLYITNDNLKRIADALEEILRLVKKDMEPRTKKEKE |
| Ga0207880_10049355 | 3300025247 | Deep Ocean | MEKEINGHLYITNDNLKRIADALEEILRLVKKDMEPRTKKKN |
| Ga0207904_10234591 | 3300025248 | Deep Ocean | EKEINGHLYITNDNLKRIADAIEEILRLVKKDMEPRTKEKK |
| Ga0207904_10690622 | 3300025248 | Deep Ocean | MKLEKEINGHLYITNDNLKRIADAIEEILRLVKKDMEPRTKDKT |
| Ga0207904_10825281 | 3300025248 | Deep Ocean | MDKEINGHLYITNDNLKRIADAIEEILRLVKKDMEPRTKKKE |
| Ga0208182_10105842 | 3300025251 | Deep Ocean | MEKEINGHLYITNDNLKRIADALEEILRLVKKDMGELKKVAK |
| Ga0208029_10219602 | 3300025264 | Deep Ocean | MDKEVNGHLYIANDNLKRIADALEEILRLVKKDMEPREKSKK |
| Ga0207894_10910461 | 3300025268 | Deep Ocean | MDKETNGHLYIANDNLKRIADILEEILKLVKKDMEPKKK |
| Ga0208180_10647482 | 3300025277 | Deep Ocean | MSLKGINMDKEINGHLYITNDNLKRIADAVEEILRLVKKDMEPRTKDKE |
| Ga0208315_10233455 | 3300025286 | Deep Ocean | MEKEVNGHLYIANDNLKRIADALDEILRLVKKDMEKYEEKKR |
| Ga0209757_100424401 | 3300025873 | Marine | MNEKQLNKEVNGHLYIANDNLKRIADAIEEILRLVKKDMEPKKK |
| Ga0209757_101447892 | 3300025873 | Marine | MEKEINGHLYITNDNLKRIADAIEEILRIVKKDMEPRAKKRST |
| Ga0209757_101829911 | 3300025873 | Marine | MDKEINGHLYITNDNLKRIADALEEILRLVKKDMEPRTKKT |
| Ga0209757_101893112 | 3300025873 | Marine | MEKEINGHLYITNDNLKRIADAIEEILRLVKKDMEPRTKKENK |
| Ga0209757_102804172 | 3300025873 | Marine | MDKEINGHLYITNDNLKRIADAIEEILRIVKKDMEPRTKEKEKA |
| Ga0207963_10993321 | 3300026080 | Marine | MDKEINGHLYIANDNLKRIADILEEILRIVKKDMETK |
| Ga0208131_11551991 | 3300026213 | Marine | MDKEINGHLYITNDNLKRIADALEEILRLVKKDMEP |
| Ga0310124_106208501 | 3300031804 | Marine | MLEKEINGHLYITNDNLKRIADALEEILRLVKKDMEPRTKKKD |
| Ga0315336_12195102 | 3300032132 | Seawater | MDKETNGHLYIANDNLKRIADALDEILKLVKQDMEPREKKN |
| Ga0314858_078428_512_643 | 3300033742 | Sea-Ice Brine | MEKEINGHLYITNDNLKRIADALEEILRLVKKDMEPRTKKKEK |
| Ga0326756_027253_507_629 | 3300034629 | Filtered Seawater | MEKEINGHLYITNDNLKRIADALEEILRLVKKDMEPRTKK |
| Ga0326741_021096_683_832 | 3300034654 | Filtered Seawater | MNIESEEIMKLEKEINGHLYITNDNLKRIADAIEEILRIVKKDMEPKKK |
| Ga0326741_023205_988_1095 | 3300034654 | Filtered Seawater | MDKEINGHLYIANDNLKRIADILEEILRLIKKDMGV |
| Ga0326741_047808_419_547 | 3300034654 | Filtered Seawater | MDKEVNGHLYIANDNLKRIADALEEILRLVKKDMETMKDAAK |
| Ga0326746_029675_457_570 | 3300034655 | Filtered Seawater | KEINGHLYITNDNLKRIADAIEEILRIVKKDMEPKKK |
| ⦗Top⦘ |