


| Basic Information | |
|---|---|
| Family ID | F050440 |
| Family Type | Metagenome |
| Number of Sequences | 145 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MATEERVLCFERKLLEELGVFQGLSLEVEKYLPVVTS |
| Number of Associated Samples | 132 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 66.90 % |
| % of genes near scaffold ends (potentially truncated) | 98.62 % |
| % of genes from short scaffolds (< 2000 bps) | 92.41 % |
| Associated GOLD sequencing projects | 127 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.345 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (13.103 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.966 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.759 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.08% β-sheet: 0.00% Coil/Unstructured: 76.92% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF06439 | 3keto-disac_hyd | 5.52 |
| PF00691 | OmpA | 2.07 |
| PF02641 | DUF190 | 2.07 |
| PF08666 | SAF | 1.38 |
| PF01041 | DegT_DnrJ_EryC1 | 1.38 |
| PF01687 | Flavokinase | 1.38 |
| PF00005 | ABC_tran | 1.38 |
| PF03567 | Sulfotransfer_2 | 1.38 |
| PF04616 | Glyco_hydro_43 | 1.38 |
| PF02537 | CRCB | 1.38 |
| PF00248 | Aldo_ket_red | 1.38 |
| PF07690 | MFS_1 | 1.38 |
| PF03683 | UPF0175 | 1.38 |
| PF02894 | GFO_IDH_MocA_C | 1.38 |
| PF01964 | ThiC_Rad_SAM | 0.69 |
| PF00072 | Response_reg | 0.69 |
| PF00501 | AMP-binding | 0.69 |
| PF01343 | Peptidase_S49 | 0.69 |
| PF07635 | PSCyt1 | 0.69 |
| PF03449 | GreA_GreB_N | 0.69 |
| PF00293 | NUDIX | 0.69 |
| PF00581 | Rhodanese | 0.69 |
| PF00034 | Cytochrom_C | 0.69 |
| PF12695 | Abhydrolase_5 | 0.69 |
| PF14066 | DUF4256 | 0.69 |
| PF07681 | DoxX | 0.69 |
| PF12787 | EcsC | 0.69 |
| PF05685 | Uma2 | 0.69 |
| PF00889 | EF_TS | 0.69 |
| PF03459 | TOBE | 0.69 |
| PF01751 | Toprim | 0.69 |
| PF13177 | DNA_pol3_delta2 | 0.69 |
| PF13385 | Laminin_G_3 | 0.69 |
| PF12706 | Lactamase_B_2 | 0.69 |
| PF14078 | DUF4259 | 0.69 |
| PF13414 | TPR_11 | 0.69 |
| PF05726 | Pirin_C | 0.69 |
| PF01904 | DUF72 | 0.69 |
| PF03358 | FMN_red | 0.69 |
| PF01261 | AP_endonuc_2 | 0.69 |
| PF13927 | Ig_3 | 0.69 |
| PF09363 | XFP_C | 0.69 |
| PF08241 | Methyltransf_11 | 0.69 |
| PF14100 | DUF6807 | 0.69 |
| PF01207 | Dus | 0.69 |
| PF12345 | DUF3641 | 0.69 |
| PF04474 | DUF554 | 0.69 |
| PF04545 | Sigma70_r4 | 0.69 |
| PF06283 | ThuA | 0.69 |
| PF03466 | LysR_substrate | 0.69 |
| PF03641 | Lysine_decarbox | 0.69 |
| PF04166 | PdxA | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG1993 | PII-like signaling protein | Signal transduction mechanisms [T] | 2.07 |
| COG0196 | FAD synthase | Coenzyme transport and metabolism [H] | 1.38 |
| COG0239 | Fluoride ion exporter CrcB/FEX, affects chromosome condensation | Cell cycle control, cell division, chromosome partitioning [D] | 1.38 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 1.38 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 1.38 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 1.38 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.38 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 1.38 |
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 1.38 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 1.38 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 1.38 |
| COG2886 | Predicted antitoxin, contains HTH domain | General function prediction only [R] | 1.38 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| COG0264 | Translation elongation factor EF-Ts | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| COG0422 | 4-amino-2-methyl-5-hydroxymethylpyrimidine (HMP) synthase ThiC | Coenzyme transport and metabolism [H] | 0.69 |
| COG0782 | Transcription elongation factor, GreA/GreB family | Transcription [K] | 0.69 |
| COG1611 | Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family | Nucleotide transport and metabolism [F] | 0.69 |
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 0.69 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.69 |
| COG1811 | Uncharacterized membrane protein YqgA, affects biofilm formation | Function unknown [S] | 0.69 |
| COG1995 | 4-hydroxy-L-threonine phosphate dehydrogenase PdxA | Coenzyme transport and metabolism [H] | 0.69 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.69 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.69 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.69 |
| COG4813 | Trehalose utilization protein | Carbohydrate transport and metabolism [G] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.34 % |
| Unclassified | root | N/A | 29.66 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001213|JGIcombinedJ13530_108525170 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 525 | Open in IMG/M |
| 3300001431|F14TB_100441815 | Not Available | 603 | Open in IMG/M |
| 3300002911|JGI25390J43892_10039433 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
| 3300005180|Ga0066685_10311807 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium | 1090 | Open in IMG/M |
| 3300005180|Ga0066685_10735741 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 674 | Open in IMG/M |
| 3300005187|Ga0066675_11330010 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 529 | Open in IMG/M |
| 3300005332|Ga0066388_106609629 | Not Available | 584 | Open in IMG/M |
| 3300005340|Ga0070689_100863843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Thermoactinomycetaceae → Desmospora → Desmospora activa → Desmospora activa DSM 45169 | 799 | Open in IMG/M |
| 3300005444|Ga0070694_100407554 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1066 | Open in IMG/M |
| 3300005450|Ga0066682_10182523 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1342 | Open in IMG/M |
| 3300005535|Ga0070684_100353043 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
| 3300005540|Ga0066697_10540055 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300005544|Ga0070686_101598468 | Not Available | 551 | Open in IMG/M |
| 3300005552|Ga0066701_10937742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 512 | Open in IMG/M |
| 3300005561|Ga0066699_10874201 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 629 | Open in IMG/M |
| 3300005617|Ga0068859_102694479 | Not Available | 546 | Open in IMG/M |
| 3300006046|Ga0066652_101656956 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300006237|Ga0097621_101453240 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300006796|Ga0066665_10251093 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
| 3300006797|Ga0066659_11714032 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae | 530 | Open in IMG/M |
| 3300006800|Ga0066660_11680441 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 505 | Open in IMG/M |
| 3300006804|Ga0079221_11510282 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 540 | Open in IMG/M |
| 3300006876|Ga0079217_10944932 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 622 | Open in IMG/M |
| 3300006880|Ga0075429_100318429 | All Organisms → cellular organisms → Bacteria | 1361 | Open in IMG/M |
| 3300006904|Ga0075424_102710129 | Not Available | 517 | Open in IMG/M |
| 3300009012|Ga0066710_101901275 | Not Available | 891 | Open in IMG/M |
| 3300009131|Ga0115027_10983434 | Not Available | 659 | Open in IMG/M |
| 3300009137|Ga0066709_102075131 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 786 | Open in IMG/M |
| 3300009137|Ga0066709_103661105 | Not Available | 558 | Open in IMG/M |
| 3300009143|Ga0099792_11047866 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 547 | Open in IMG/M |
| 3300009609|Ga0105347_1101340 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → unclassified Gemmataceae → Gemmataceae bacterium | 1086 | Open in IMG/M |
| 3300009678|Ga0105252_10422037 | Not Available | 612 | Open in IMG/M |
| 3300009700|Ga0116217_10994552 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 513 | Open in IMG/M |
| 3300010044|Ga0126310_11181157 | Not Available | 613 | Open in IMG/M |
| 3300010046|Ga0126384_11517487 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 628 | Open in IMG/M |
| 3300010336|Ga0134071_10307209 | Not Available | 797 | Open in IMG/M |
| 3300010339|Ga0074046_10832484 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 539 | Open in IMG/M |
| 3300010341|Ga0074045_10671197 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300010361|Ga0126378_12700400 | Not Available | 567 | Open in IMG/M |
| 3300010399|Ga0134127_11545174 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 737 | Open in IMG/M |
| 3300010400|Ga0134122_13129127 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 518 | Open in IMG/M |
| 3300010401|Ga0134121_11794620 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300010401|Ga0134121_13143346 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 510 | Open in IMG/M |
| 3300011416|Ga0137422_1014606 | Not Available | 1825 | Open in IMG/M |
| 3300012038|Ga0137431_1131134 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300012038|Ga0137431_1238802 | Not Available | 509 | Open in IMG/M |
| 3300012040|Ga0137461_1225789 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 547 | Open in IMG/M |
| 3300012175|Ga0137321_1005634 | All Organisms → cellular organisms → Bacteria | 2322 | Open in IMG/M |
| 3300012175|Ga0137321_1039515 | Not Available | 1014 | Open in IMG/M |
| 3300012205|Ga0137362_11567099 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 545 | Open in IMG/M |
| 3300012207|Ga0137381_11406923 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 590 | Open in IMG/M |
| 3300012209|Ga0137379_11194684 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300012210|Ga0137378_10481481 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300012351|Ga0137386_10633774 | Not Available | 769 | Open in IMG/M |
| 3300012351|Ga0137386_10932793 | Not Available | 620 | Open in IMG/M |
| 3300012356|Ga0137371_10534352 | Not Available | 904 | Open in IMG/M |
| 3300012358|Ga0137368_10816059 | Not Available | 576 | Open in IMG/M |
| 3300012360|Ga0137375_10530357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 995 | Open in IMG/M |
| 3300012526|Ga0136637_1072419 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
| 3300012923|Ga0137359_11420078 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 582 | Open in IMG/M |
| 3300012929|Ga0137404_11202008 | Not Available | 697 | Open in IMG/M |
| 3300012929|Ga0137404_12180656 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 518 | Open in IMG/M |
| 3300012930|Ga0137407_11659583 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300012948|Ga0126375_10287817 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 1133 | Open in IMG/M |
| 3300013296|Ga0157374_10800829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 958 | Open in IMG/M |
| 3300014159|Ga0181530_10450867 | Not Available | 647 | Open in IMG/M |
| 3300014160|Ga0181517_10640924 | Not Available | 530 | Open in IMG/M |
| 3300014501|Ga0182024_11256863 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300014501|Ga0182024_11450721 | Not Available | 786 | Open in IMG/M |
| 3300014502|Ga0182021_10723777 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1194 | Open in IMG/M |
| 3300014969|Ga0157376_10964703 | Not Available | 874 | Open in IMG/M |
| 3300015241|Ga0137418_10054430 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 3670 | Open in IMG/M |
| 3300015245|Ga0137409_11352005 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 556 | Open in IMG/M |
| 3300015264|Ga0137403_10626492 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 939 | Open in IMG/M |
| 3300016270|Ga0182036_10560546 | Not Available | 912 | Open in IMG/M |
| 3300016294|Ga0182041_11077872 | Not Available | 729 | Open in IMG/M |
| 3300016357|Ga0182032_11553887 | Not Available | 575 | Open in IMG/M |
| 3300017656|Ga0134112_10243399 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 712 | Open in IMG/M |
| 3300017926|Ga0187807_1261528 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 569 | Open in IMG/M |
| 3300017943|Ga0187819_10778554 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300017988|Ga0181520_10542943 | Not Available | 815 | Open in IMG/M |
| 3300018042|Ga0187871_10683116 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 571 | Open in IMG/M |
| 3300018057|Ga0187858_10870907 | Not Available | 531 | Open in IMG/M |
| 3300018081|Ga0184625_10190140 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium | 1076 | Open in IMG/M |
| 3300018090|Ga0187770_11162885 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 623 | Open in IMG/M |
| 3300018482|Ga0066669_12080165 | Not Available | 535 | Open in IMG/M |
| 3300020109|Ga0194112_10374970 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300020221|Ga0194127_10013466 | All Organisms → cellular organisms → Bacteria | 8051 | Open in IMG/M |
| 3300020583|Ga0210401_10641499 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 923 | Open in IMG/M |
| 3300020583|Ga0210401_10753851 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300021080|Ga0210382_10097018 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1224 | Open in IMG/M |
| 3300021081|Ga0210379_10115241 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300021082|Ga0210380_10447517 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 592 | Open in IMG/M |
| 3300021559|Ga0210409_10092456 | All Organisms → cellular organisms → Bacteria | 2793 | Open in IMG/M |
| 3300022226|Ga0224512_10451608 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300022413|Ga0224508_10486677 | Not Available | 771 | Open in IMG/M |
| 3300023068|Ga0224554_1022838 | Not Available | 1894 | Open in IMG/M |
| 3300023091|Ga0224559_1123246 | Not Available | 942 | Open in IMG/M |
| 3300024177|Ga0247686_1006715 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1190 | Open in IMG/M |
| 3300024279|Ga0247692_1044557 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 685 | Open in IMG/M |
| 3300025911|Ga0207654_11160893 | Not Available | 563 | Open in IMG/M |
| 3300025923|Ga0207681_11776011 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 515 | Open in IMG/M |
| 3300026320|Ga0209131_1051658 | All Organisms → cellular organisms → Bacteria | 2317 | Open in IMG/M |
| 3300026325|Ga0209152_10491186 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 504 | Open in IMG/M |
| 3300027693|Ga0209704_1254181 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 513 | Open in IMG/M |
| 3300027854|Ga0209517_10649202 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 551 | Open in IMG/M |
| 3300027903|Ga0209488_10471150 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300027903|Ga0209488_11209442 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 508 | Open in IMG/M |
| 3300027908|Ga0209006_11239266 | Not Available | 581 | Open in IMG/M |
| 3300027908|Ga0209006_11412408 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 532 | Open in IMG/M |
| 3300028146|Ga0247682_1114628 | Not Available | 507 | Open in IMG/M |
| 3300028854|Ga0302268_1079791 | All Organisms → cellular organisms → Bacteria → PVC group | 821 | Open in IMG/M |
| 3300029910|Ga0311369_11096638 | Not Available | 622 | Open in IMG/M |
| 3300029911|Ga0311361_10924255 | Not Available | 745 | Open in IMG/M |
| 3300029913|Ga0311362_10233826 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2033 | Open in IMG/M |
| 3300029914|Ga0311359_10329007 | Not Available | 1246 | Open in IMG/M |
| 3300029915|Ga0311358_10056287 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 4434 | Open in IMG/M |
| 3300029915|Ga0311358_10702651 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300029953|Ga0311343_11160934 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300029957|Ga0265324_10123974 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 877 | Open in IMG/M |
| 3300029985|Ga0302280_1262487 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300030020|Ga0311344_10060133 | All Organisms → cellular organisms → Bacteria | 4618 | Open in IMG/M |
| 3300030041|Ga0302274_10018062 | All Organisms → cellular organisms → Bacteria | 4931 | Open in IMG/M |
| 3300030043|Ga0302306_10382830 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 538 | Open in IMG/M |
| 3300030503|Ga0311370_10801692 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1085 | Open in IMG/M |
| 3300030521|Ga0307511_10182043 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1130 | Open in IMG/M |
| 3300030606|Ga0299906_10253817 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1381 | Open in IMG/M |
| 3300031128|Ga0170823_12034910 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 502 | Open in IMG/M |
| 3300031241|Ga0265325_10437078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 571 | Open in IMG/M |
| 3300031247|Ga0265340_10242400 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 804 | Open in IMG/M |
| 3300031261|Ga0302140_10085486 | All Organisms → cellular organisms → Bacteria | 3235 | Open in IMG/M |
| 3300031524|Ga0302320_11546183 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 649 | Open in IMG/M |
| 3300031525|Ga0302326_10306487 | All Organisms → cellular organisms → Bacteria | 2533 | Open in IMG/M |
| 3300031754|Ga0307475_10605953 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300032001|Ga0306922_12028453 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 560 | Open in IMG/M |
| 3300032675|Ga0316225_1259216 | Not Available | 522 | Open in IMG/M |
| 3300032805|Ga0335078_11572868 | Not Available | 730 | Open in IMG/M |
| 3300032892|Ga0335081_11137057 | Not Available | 896 | Open in IMG/M |
| 3300032893|Ga0335069_10477469 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1450 | Open in IMG/M |
| 3300032893|Ga0335069_12277717 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 565 | Open in IMG/M |
| 3300032898|Ga0335072_11449925 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300032954|Ga0335083_10954857 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300033486|Ga0316624_11305695 | Not Available | 663 | Open in IMG/M |
| 3300033513|Ga0316628_102074514 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 755 | Open in IMG/M |
| 3300034282|Ga0370492_0201067 | All Organisms → cellular organisms → Bacteria → PVC group | 812 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.28% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 7.59% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 5.52% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.14% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.76% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.76% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.07% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.07% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.07% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.07% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.38% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.38% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.38% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.38% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.38% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.38% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.38% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.38% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.38% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.38% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.38% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.38% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.38% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.69% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.69% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.69% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.69% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.69% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.69% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.69% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.69% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.69% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.69% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.69% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.69% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.69% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.69% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011416 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT551_2 | Environmental | Open in IMG/M |
| 3300012038 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2 | Environmental | Open in IMG/M |
| 3300012040 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2 | Environmental | Open in IMG/M |
| 3300012175 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT399_2 | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012526 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ857 (21.06) | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
| 3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022226 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_13 | Environmental | Open in IMG/M |
| 3300022413 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300023068 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 20-24 | Environmental | Open in IMG/M |
| 3300023091 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 30-34 | Environmental | Open in IMG/M |
| 3300024177 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK27 | Environmental | Open in IMG/M |
| 3300024279 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33 | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
| 3300028854 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_1 | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Host-Associated | Open in IMG/M |
| 3300029985 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_1 | Environmental | Open in IMG/M |
| 3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030041 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Host-Associated | Open in IMG/M |
| 3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032675 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18015 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ13530_1085251701 | 3300001213 | Wetland | MPTEERVLCFERKLLDDLGAFQGINLEVEKSLPAITSSSQPSYRNRSEAEN |
| F14TB_1004418153 | 3300001431 | Soil | MATEERVLCFPRKLLENLGVFQGXXLEIEKYLPVVTSSAELTYLNRSDAE |
| JGI25390J43892_100394331 | 3300002911 | Grasslands Soil | MATEERVLCFERKLFEELGVFQGLSLAIEKYLPAVTSSANT |
| Ga0066685_103118072 | 3300005180 | Soil | MATEERVLCFERKLLDELGVFQGLSLEVEKYLPVVTSSSRLLYLNRSDAEHDK |
| Ga0066685_107357412 | 3300005180 | Soil | MATEERVLCFERKLLEEIGLFQGLSLEVEKYLPAVITTSRLVYLNRSDAEQDKRYK |
| Ga0066675_113300102 | 3300005187 | Soil | MENGRMATEERVLCFERKLMDELGVFQGLSLEVEKYLPVLTSSSRLIYRNRSE |
| Ga0066388_1066096292 | 3300005332 | Tropical Forest Soil | MAAEERVLCFERKLLEELGVFQGLSLEVEKYLPVVTAISN |
| Ga0070689_1008638432 | 3300005340 | Switchgrass Rhizosphere | MEERVLCFERKLLEDLGVFQGLSLEVEKYLPVVTAASSLTYLNRSDAEQDKRYK |
| Ga0070694_1004075544 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MAAEERVLCFQRKLLEQIGVFQGISLDIEKYLPVVTAASHICYLNRSE |
| Ga0066682_101825231 | 3300005450 | Soil | MAAEERVLCFERKLFEELGVFQGLGLDVEKYLPVVTSPSNL |
| Ga0070684_1003530434 | 3300005535 | Corn Rhizosphere | MATEERVLCFERKLLEDLGVFQGLSLDVEKYLPVVTASKNIL |
| Ga0066697_105400552 | 3300005540 | Soil | MATEERVLCFERKLLDELGVFQGLSLDVEKYLPVVTSSSRL |
| Ga0070686_1015984682 | 3300005544 | Switchgrass Rhizosphere | MCGDMPAEERVLCFERKLLEELGVFQGLSLEVEKYLPAVTSSTRLVYRNRSEAE |
| Ga0066701_109377421 | 3300005552 | Soil | MATEERVLCFERKLLEELGVFEGLSLEIEKYLPVVTSPSHLLYLN |
| Ga0066699_108742011 | 3300005561 | Soil | MPAEERVLCFERKLLEELGVFQGLSLDVEKYLPVITTSSR |
| Ga0068859_1026944791 | 3300005617 | Switchgrass Rhizosphere | MPAEERVLCFPRELLEELGVFQGLSLDIEKYLPVVTSPNRI |
| Ga0066652_1016569561 | 3300006046 | Soil | MREEKVLCFERKVLEEAGLFQGLSLQIEKYLPVVTSRSNLVYLNRSDAEQDK |
| Ga0097621_1014532402 | 3300006237 | Miscanthus Rhizosphere | MATEERVLCFQRKLLEELGVFQGLSLEIEKYLPAVTSASHILY |
| Ga0066665_102510931 | 3300006796 | Soil | MATEERVLCFERKLLEELGVFQGLSLEVEKYLPVVSSSSRLVYLNRSDAEHDKRYK |
| Ga0066659_117140322 | 3300006797 | Soil | MAAEERVLCFERKLLEKLGVFQGLSLDVDKYLPVVTSAS |
| Ga0066660_116804411 | 3300006800 | Soil | MATEERVLCFRRELFEEIGPFQGLSLEVEKYLPAVTSPANLLYLNRSEAEND |
| Ga0079221_115102821 | 3300006804 | Agricultural Soil | MPAEEKVLCFERKLLEDLGVFQGLSLDVDKYLPTVT |
| Ga0079217_109449322 | 3300006876 | Agricultural Soil | LRMATEERVLCFPRKLLEKLGVFQGLSLEIEKYLPVVTSSAELTYLNR |
| Ga0075429_1003184293 | 3300006880 | Populus Rhizosphere | MATEERVLCFPRKLLEELGVFQGLSLEVEKYLPVVTSS |
| Ga0075424_1027101292 | 3300006904 | Populus Rhizosphere | MTTEERVLCFPRKLLEQIGVFQGLSLEVEKYLPVVTSSSQLIYLN |
| Ga0066710_1019012752 | 3300009012 | Grasslands Soil | MTTEERVLCFERKLLDELGVFQGLSLEVEKYLPVVTSSSRLVYLNRSDAEH |
| Ga0115027_109834342 | 3300009131 | Wetland | MAKEEKVLCFERKILEELGLFQGLSLEVEKYLPVLTSSTRLTYLNRSEA |
| Ga0066709_1020751311 | 3300009137 | Grasslands Soil | MATEERVLCFERKLLDEVGVFQGLSLEIGKYLPVVTSPSRLVYLNRNDAEHNQRY |
| Ga0066709_1036611052 | 3300009137 | Grasslands Soil | MPTEERVLCFERKLLEELGVFQGLSLEVEKYLPVVSSSSRLVYLNRSDAEHD |
| Ga0099792_110478662 | 3300009143 | Vadose Zone Soil | MTSGGENKQEMATEERVLCFKRKLLEDTGMFAGLNLNVEKYLPVVTSPSQLVYLN |
| Ga0105347_11013403 | 3300009609 | Soil | MATEERVLCFPRKLLENLGVFQGLSLEIEKYLPVVTSSSELTYLNRSDAEQD |
| Ga0105252_104220373 | 3300009678 | Soil | MGSEERVLCFPRQLLEEIGVFQGLSMEVEKYLPVVTSSKQLVYINRSAAELDTR |
| Ga0116217_109945522 | 3300009700 | Peatlands Soil | MPAEERVLCFERKLLEQLGLFQGLSLDVAKYLPVLTSASNLVYLNR |
| Ga0126310_111811572 | 3300010044 | Serpentine Soil | MPKEEKVLCFKRQLLEECGIFQGLSLDVEKYLPVVTAPSQITYL |
| Ga0126384_115174872 | 3300010046 | Tropical Forest Soil | MAAEERVLCFERKLFEELGVFHGLSLEVDKYLPVVTA |
| Ga0134071_103072091 | 3300010336 | Grasslands Soil | MATEERVLCFERKLLEELGVFQGLSLDVEKYLPEV |
| Ga0074046_108324842 | 3300010339 | Bog Forest Soil | MATEERVLCFERKLLEELGVFQGLSLEVEKYLPVLTSNSQLVYRNRS |
| Ga0074045_106711972 | 3300010341 | Bog Forest Soil | MAREERVLCFERKLFEELGVFQGLSLDVEKYLPILT |
| Ga0126378_127004001 | 3300010361 | Tropical Forest Soil | MAAEERVLCFRRTLLEELGMFQGLSLEVEKYLPVVT |
| Ga0134127_115451742 | 3300010399 | Terrestrial Soil | MATEERVLCFPRKLLEQLGVFQGLSLEVEKYLPVVTSSSQLIYLNRGE |
| Ga0134122_131291272 | 3300010400 | Terrestrial Soil | MEAEERVLCFERKLFEELGVFQGLSLDVEKYLPIVTAAS |
| Ga0134121_117946201 | 3300010401 | Terrestrial Soil | MPAEERVLCFKRELFEKLGVFQGLSLEVQKYLPVLTASENLLYFNRSDA |
| Ga0134121_131433461 | 3300010401 | Terrestrial Soil | MPTEERVLCFERKLFEQLGVFQGISLDVEKYLPVVTSTSNIVYL |
| Ga0137422_10146063 | 3300011416 | Soil | MATEERVLCFERRLLEEPGVFQGLSLQIDKYLPVVTSPKQILYLNR |
| Ga0137431_11311343 | 3300012038 | Soil | MATEERVLCFPRKLLEEVGGFQGLSLDVEKYLPVVTSSAQLVYLNRTEAEQDKRY |
| Ga0137431_12388022 | 3300012038 | Soil | MGSEERVLCFPRQLLEEIGVFQGLSMEVDKYLPVVTSSKQL |
| Ga0137461_12257891 | 3300012040 | Soil | MAAEERVLCFERKLFEKLGVFQGLSLDVEKYLPIVTAPSN |
| Ga0137321_10056343 | 3300012175 | Soil | MATEERVLCFERRLLEEPGVFQGLSLQIDKYLPVVTSPK |
| Ga0137321_10395153 | 3300012175 | Soil | MATEERVLCFERKLLEEVGVFQGLSLEIDKYLPVVTASKRILYLNRSEAE |
| Ga0137362_115670992 | 3300012205 | Vadose Zone Soil | MTAEERVLCFPRKLFEELGVFQGLSLEVEKYLPVVTSASNILY |
| Ga0137381_114069232 | 3300012207 | Vadose Zone Soil | MATEERVLCFPRKVLEDLGVFHGLNLAIEKYLPVVTSSS |
| Ga0137379_111946843 | 3300012209 | Vadose Zone Soil | MPTEERVLCFERKLLEELGVFQGLSLEVDKYLPVVTSVS |
| Ga0137378_104814813 | 3300012210 | Vadose Zone Soil | MPTEERVLCFERGLLEEVGVFQGLSLEVDKYLPVVTSVSQMVYLNRSDAER |
| Ga0137386_106337741 | 3300012351 | Vadose Zone Soil | MATEERVLCFERKLLDELGVFQGLSLEVEKYLPVVTSA |
| Ga0137386_109327932 | 3300012351 | Vadose Zone Soil | MATEERVLCFERKLLEELGLFQGLSLEVEKYLPAVT |
| Ga0137371_105343523 | 3300012356 | Vadose Zone Soil | MAAEERVLCFERKLLEDLGMFQGLSLEVAKYLPVLTSSSHFTYLNRSEAEQDRRYKQ |
| Ga0137368_108160592 | 3300012358 | Vadose Zone Soil | MAEERVLCFERKLFKELNVFQGLSLDVERYLPMVTTLTNLQYRNRSNAEQDK |
| Ga0137375_105303571 | 3300012360 | Vadose Zone Soil | MATEERVLCFERKLLDELGVFQGLSLEVEKYMAVVTSSSRLVYLN |
| Ga0136637_10724191 | 3300012526 | Polar Desert Sand | MATEEKVLCFERKLLEELGVFQGLSLEIEKYLPVVTSA |
| Ga0137359_114200783 | 3300012923 | Vadose Zone Soil | MATEERVLCFKRKLLEDLGMFQGLSLEVEKYLPMVTSPAH |
| Ga0137404_112020081 | 3300012929 | Vadose Zone Soil | MATEERVLCFERKLLEELGVFQGLSLEVQKYLPAVTSSSRLVYLNRSDA* |
| Ga0137404_121806561 | 3300012929 | Vadose Zone Soil | MATEERVLCFERKLLDELGVFQGLSLEVEKYLPAVTTSSRLTYRNRSDAERDKG |
| Ga0137407_116595832 | 3300012930 | Vadose Zone Soil | MATEERVLCFERKLLEELGVFQGISLDVDKYLPVVTSVSRLVYRNR |
| Ga0126375_102878171 | 3300012948 | Tropical Forest Soil | MAAEERVLCFRRTLLEELGMFQGLSLEVEKYLPVVTS |
| Ga0157374_108008291 | 3300013296 | Miscanthus Rhizosphere | LATEERVLCFERELLEQLGVFQGINLDVQKYLPVLTAPAKLV |
| Ga0181530_104508671 | 3300014159 | Bog | MATEERVLCFERKLLEELGVFQGLSLEVEKYLPVVTS |
| Ga0181517_106409241 | 3300014160 | Bog | MATEERVLCFERKLFEDLGVFQGISLDAGKYLPVVTSADRVLYLNRGA |
| Ga0182024_112568631 | 3300014501 | Permafrost | MATEERVLCFQRKLFEELGVFQGLSLAVEKYLPVVTSPSQLVY |
| Ga0182024_114507212 | 3300014501 | Permafrost | MATEERVLCFERKLLEELGVFQGLSLEVEKFLPVVTATSHLVYLNRSE |
| Ga0182021_107237773 | 3300014502 | Fen | MATEERVLCFERKLLEHLGLFQGLSLEVEKYLPVVTSSS |
| Ga0157376_109647031 | 3300014969 | Miscanthus Rhizosphere | MCGDMPAEERVLCFERKLLEELGVFQGLSLEVEKY |
| Ga0137418_100544304 | 3300015241 | Vadose Zone Soil | MATEERVLCFSRELLEDLGVFQGLSLEVDKYLPVVTSR |
| Ga0137409_113520051 | 3300015245 | Vadose Zone Soil | MLKRMIEERVLCFPRKLLEDLGVFQGLSLEVDKYLPVVTSSSQLVYRNRSEA |
| Ga0137403_106264921 | 3300015264 | Vadose Zone Soil | MATEERVLCFKRKLLEDLGVFQGLSLDIEKYLPVVTAAYNILYMN |
| Ga0182036_105605462 | 3300016270 | Soil | MPEERVLCFERRLLDELGAFQGVNFEVDKYLEVVTSRPNLTYRNRR |
| Ga0182041_110778721 | 3300016294 | Soil | MPTEERVLCFQRSLLEQLGLFQGINHKIDKYLPVITAKANLVYL |
| Ga0182032_115538872 | 3300016357 | Soil | MATEERVLCFERKLLEQLGVFQGLSLEVEKYLPVVTASASLVYR |
| Ga0134112_102433991 | 3300017656 | Grasslands Soil | MATEERVLCFQRKLLEELGVFQGLSLEIERYLPVVTSASNILYMN |
| Ga0187807_12615281 | 3300017926 | Freshwater Sediment | MEERVLCFERTFFEKLGVFQGLSLEVEKYLPVLTAESNVLYLNRGEA |
| Ga0187819_107785542 | 3300017943 | Freshwater Sediment | MAKEERVLCFERKLFENLGVFQGLSLEIEKYLPVVTSSS |
| Ga0181520_105429432 | 3300017988 | Bog | MATEERVLCFERKLLEKLGVFQGLSLEVEKYLPVVTASAHLVYRNR |
| Ga0187871_106831161 | 3300018042 | Peatland | MATEERVLCFKRKLLEELGVFQGLSLEVGKYLPVFT |
| Ga0187858_108709072 | 3300018057 | Peatland | MATEERVLCFERKLLEELGVFQGLSLEVEKYLPVLTSTSHL |
| Ga0184625_101901402 | 3300018081 | Groundwater Sediment | MATEERVLCFQRKLLEELGVFQGLSLEIEKYLPAVTSSA |
| Ga0187770_111628851 | 3300018090 | Tropical Peatland | MATEERVLCFERKLFEELGVFQGLNLAIEKYLPVVTSAANIRYLN |
| Ga0066669_120801652 | 3300018482 | Grasslands Soil | MAKEERVLCFERKLLLDLGVFEGISLEIERYLPVVTSPSDLLYLTRSEAEQDNRYE |
| Ga0194112_103749703 | 3300020109 | Freshwater Lake | MAAEERVLCFERRLFEELGVFQGLSLEVERYLPVVTAPSRLL |
| Ga0194127_100134666 | 3300020221 | Freshwater Lake | MAAEERVLCFERRLFEELGVFQGLSLEVERYLPVVTAPSRLLYLTR |
| Ga0210401_106414991 | 3300020583 | Soil | MATEERVLCFERKLLEELGVFQGLSHDTEKYLPVVTSPSNIHY |
| Ga0210401_107538513 | 3300020583 | Soil | MARHDTENLPRIMPTEERVLCFERKLLEELGVFQGINLDVQKYLPIVTAQPKLVYLNRSEAEQDKRY |
| Ga0210382_100970182 | 3300021080 | Groundwater Sediment | MATEERVLCFERKLLDELGVFQGLSLEVEKCLPVVTSS |
| Ga0210379_101152411 | 3300021081 | Groundwater Sediment | MPTEERVLCFKRQLLEELDVFQGLSLDVEKYLPVVT |
| Ga0210380_104475171 | 3300021082 | Groundwater Sediment | MAAEERVLCFKRSLLEDLGMFQGLSLEVAKYLPVVTSTSHLVYLNRSEA |
| Ga0210409_100924561 | 3300021559 | Soil | VLCFERKLLEELGVFQGINLDVEKYLPVVTAQARLVYLNRSEAEHDKR |
| Ga0224512_104516081 | 3300022226 | Sediment | MAADERVVCFERTLLDEVGSFQGLIVDVEKYLPIVTRPS |
| Ga0224508_104866771 | 3300022413 | Sediment | MPADEKVLCFERRLLDEVGLFQGLSVDVEKYLKFVT |
| Ga0224554_10228383 | 3300023068 | Soil | MATEERVLCFERKLLEDLGVFQGLSLDARKYLPVLTSSAHLVYL |
| Ga0224559_11232462 | 3300023091 | Soil | MATEERVLCFERKLFEELGVFQGLSLDTDKYLPTVTSPSKVLYIN |
| Ga0247686_10067151 | 3300024177 | Soil | MAAEERVLCFERKLFEQLGVFQGISLDVEKYLPVVTSS |
| Ga0247692_10445571 | 3300024279 | Soil | MASEERVLCFERKLLEELGVFQGLSLEVDKYLPVVTASSRLVYLNRSD |
| Ga0207654_111608932 | 3300025911 | Corn Rhizosphere | MATEERVLCFQRKLLEELGVFQGISLEIEKYLPAVTSSS |
| Ga0207681_117760111 | 3300025923 | Switchgrass Rhizosphere | MATEERVLCFPRKLLENLGVFQGLSLEIEKYLPVVTSSAELTYLNR |
| Ga0209131_10516583 | 3300026320 | Grasslands Soil | MAKEERVLCFPRKLLEASGVFQGISLEVEKYLPIVTDRAQLTYLNRSEAELDRVSNS |
| Ga0209152_104911861 | 3300026325 | Soil | MATEERVLCFERKLFEELGVFQGLSLAIEKYLPVVTSSSNTLYLN |
| Ga0209704_12541811 | 3300027693 | Freshwater Sediment | MPSEERVLCFKRQLLEELGVFQGLSLEVEKYLSVVT |
| Ga0209517_106492021 | 3300027854 | Peatlands Soil | MATEERVLCFERKLFEGLGVFQGLSLEVEKYLPVVTSAANLVYRN |
| Ga0209488_104711502 | 3300027903 | Vadose Zone Soil | MATEERVLCFKRKLLEDLGMFQGLSMEVGKYLPMVTSPSHLMYLN |
| Ga0209488_112094421 | 3300027903 | Vadose Zone Soil | MATEERVLCFKRKLFEDLGVFQGLSLEIEKYLPVVTSRS |
| Ga0209006_112392662 | 3300027908 | Forest Soil | MPTEERVLCFERKLLEQLGVFQGLSLDIDKYLPVVTASKNILYKNR |
| Ga0209006_114124082 | 3300027908 | Forest Soil | MPTEERVLCFERKLLEELGVFQGLNWEVEKYLPVVTSISNMKY |
| Ga0247682_11146281 | 3300028146 | Soil | MATEERVLCFERKLLEQLGAFQGLSLEVGKYLPVVTASKNLVYRNR |
| Ga0302268_10797911 | 3300028854 | Bog | MATEERVLCFERKLLEELGVFQGISLDTAKYLPIVTAA |
| Ga0311369_110966381 | 3300029910 | Palsa | MATEERVLCFERKLFEELGVFQGLSLEIEKYLPFL |
| Ga0311361_109242552 | 3300029911 | Bog | MATEERVLCFERKLLEELEVFQGLSLATEKYLPVVT |
| Ga0311362_102338261 | 3300029913 | Bog | MATEERVLCFERNLFEKLGIFQGLSLEVDKYLPVVTAKTNVI |
| Ga0311359_103290072 | 3300029914 | Bog | MATEERVLCFERKLFEDLGVFQGINLDPGKYLPVVTSANQVLYLNR |
| Ga0311358_100562877 | 3300029915 | Bog | MATEERVLCFERKLLEELGVFQGISLDTAKYLPIVTAAA |
| Ga0311358_107026513 | 3300029915 | Bog | MATEERVLCLERTLFEKLGVFQGMSLDVEKYLPVVTAQA |
| Ga0311343_111609342 | 3300029953 | Bog | MATEERVLCFERNLFENLGVFQGISLDVEKYLPVVTAPSNVLYRNRSE |
| Ga0265324_101239741 | 3300029957 | Rhizosphere | MAAEERVLCFERRLLEEAGVFQGLSLEVEKYLPVVTAPANLVYR |
| Ga0302280_12624872 | 3300029985 | Fen | MATEERVLCFERKLLEELGVFQGLSPDIAKYLPVV |
| Ga0311344_100601331 | 3300030020 | Bog | MATEERVLCFERNLFEKLGVFQGISLDVEKYLPVVTAT |
| Ga0302274_100180621 | 3300030041 | Bog | MATEERVLCFERNLFEKLGVFQGISLDVEKYLPVV |
| Ga0302306_103828301 | 3300030043 | Palsa | MATEERVLCFERSLFEKLGVFQGLSLEVEKYLPVVT |
| Ga0311370_108016922 | 3300030503 | Palsa | MPTEERVLCFERKLLEELGVFQGLSLETDKYLPVVTS |
| Ga0307511_101820431 | 3300030521 | Ectomycorrhiza | MATEERVLCFKRKLLEDLGVFQGISLDIEKYLPVVTA |
| Ga0299906_102538172 | 3300030606 | Soil | MAAEERVLCFERKLIEELGVFQGLNLNVEKYLPVVTSPS |
| Ga0170823_120349101 | 3300031128 | Forest Soil | MPAEERVLCFERKLLEQLEVFQGINLEIEKYLPVVTASKNILYINRS |
| Ga0265325_104370781 | 3300031241 | Rhizosphere | MATEERVLCFERKLFEELGVFQGINLDIEKYLPVVTSAAKILYLNRS |
| Ga0265340_102424002 | 3300031247 | Rhizosphere | MATEERVLCFERKLFEELGVFQGLSLDTGKYLPVVTSASKILYLN |
| Ga0302140_100854861 | 3300031261 | Bog | MATEERVLCFERNLFEKLGIFQGLSREVEKYLPVVTAKANVVY |
| Ga0302320_115461831 | 3300031524 | Bog | MAAEERVLCFERTLFEELGVFQGLSLETEKYLPVVTSTAKVVYLNR |
| Ga0302326_103064871 | 3300031525 | Palsa | MMTEERVLCFERKLLEELGVFQGLSLEVEKYLPILTASSHLVYL |
| Ga0307475_106059532 | 3300031754 | Hardwood Forest Soil | MATEERVLCFERKLLEELGVFQGLSLEVEKYLPVVTSVSRLVYRNRSEAEQDK |
| Ga0306922_120284532 | 3300032001 | Soil | MPTEERVLCFERKLLEELGVFQGINLDVQKYLPVITAQQKLVYLNRSEA |
| Ga0316225_12592161 | 3300032675 | Freshwater | MATEERVLCFERKLLEKLGVFQGISLEAEKYLPVLSSSSNVAYLNRSAA |
| Ga0335078_115728681 | 3300032805 | Soil | MPAEERVLCFERKLLESLGVFQGLSLDVNKYLAVL |
| Ga0335081_111370571 | 3300032892 | Soil | MPTEERVLCFERKLLEQLGVFQGISDEVPKYLPLVT |
| Ga0335069_104774691 | 3300032893 | Soil | MPVDERVLCFRRELFEQLGVFQGLSLAVERYLPIVTM |
| Ga0335069_122777172 | 3300032893 | Soil | MPAEERVLCFERKLLDTLGLFQGLSLEVDKYLPVVTS |
| Ga0335072_114499252 | 3300032898 | Soil | MATEERVLCIERALFEKLGVFQGMSTEVEKYLPVVTA |
| Ga0335083_109548571 | 3300032954 | Soil | MAKEEEVLCFERRRFEELGAFQGLSLDVDKYLSVLT |
| Ga0316624_113056951 | 3300033486 | Soil | MAHTHMATEERVLCFERKLLEELGMFQGLSLEVDKYLPQ |
| Ga0316628_1020745142 | 3300033513 | Soil | MATEERVLCFPRRLLEEAGAFQGLSLEVEKYLPIVTASAQLRYLNR |
| Ga0370492_0201067_2_112 | 3300034282 | Untreated Peat Soil | MATEERVLCFERKLLEELGVFQGISLDTAKYLPIVTA |
| ⦗Top⦘ |