


| Basic Information | |
|---|---|
| Family ID | F050431 |
| Family Type | Metagenome |
| Number of Sequences | 145 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MRYAVGAFLLYTIGYLGGDIIIASIWVGIAYGFIDLMKQGKI |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 34.48 % |
| % of genes near scaffold ends (potentially truncated) | 16.55 % |
| % of genes from short scaffolds (< 2000 bps) | 85.52 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (91.034 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (33.793 % of family members) |
| Environment Ontology (ENVO) | Unclassified (90.345 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (77.931 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.86% β-sheet: 0.00% Coil/Unstructured: 47.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF01230 | HIT | 16.55 |
| PF01165 | Ribosomal_S21 | 3.45 |
| PF13759 | 2OG-FeII_Oxy_5 | 2.76 |
| PF04820 | Trp_halogenase | 2.07 |
| PF00462 | Glutaredoxin | 2.07 |
| PF02675 | AdoMet_dc | 1.38 |
| PF13365 | Trypsin_2 | 1.38 |
| PF11969 | DcpS_C | 1.38 |
| PF00154 | RecA | 0.69 |
| PF01075 | Glyco_transf_9 | 0.69 |
| PF13489 | Methyltransf_23 | 0.69 |
| PF05992 | SbmA_BacA | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 3.45 |
| COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 1.38 |
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 0.69 |
| COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 91.03 % |
| All Organisms | root | All Organisms | 8.97 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 33.79% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 18.62% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 13.79% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 6.21% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 5.52% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 5.52% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 4.83% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 3.45% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 2.76% |
| Diffuse Hydrothermal Flow Volcanic Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent | 1.38% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.69% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine Estuarine | 0.69% |
| Diffuse Hydrothermal Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Fluids | 0.69% |
| Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume | 0.69% |
| Marine, Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Marine, Hydrothermal Vent Plume | 0.69% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Fluids | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573026 | Marine microbial communities from Columbia River, CM, sample from Cape Meares, GS311-FOS-0p8-Deep1200 | Environmental | Open in IMG/M |
| 3300000142 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 500m | Environmental | Open in IMG/M |
| 3300000157 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2008 P26 1000m | Environmental | Open in IMG/M |
| 3300000179 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P16 500m | Environmental | Open in IMG/M |
| 3300000219 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - February 2010 P16 1000m | Environmental | Open in IMG/M |
| 3300000222 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P12 500m | Environmental | Open in IMG/M |
| 3300001683 | Hydrothermal vent plume microbial communities from Guaymas Basin, Gulf of California - IDBA assembly | Environmental | Open in IMG/M |
| 3300002919 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Bottom_A/KNORR_S2/LV | Environmental | Open in IMG/M |
| 3300003539 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS891_Anemone_DNA | Environmental | Open in IMG/M |
| 3300003702 | Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Piccard2013-Plume - Microbial Assembly | Environmental | Open in IMG/M |
| 3300005399 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F14-07SV275 | Environmental | Open in IMG/M |
| 3300005400 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV261 | Environmental | Open in IMG/M |
| 3300005402 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV73 | Environmental | Open in IMG/M |
| 3300005408 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV72 | Environmental | Open in IMG/M |
| 3300005423 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV47 | Environmental | Open in IMG/M |
| 3300005427 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV65 | Environmental | Open in IMG/M |
| 3300005605 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV67 | Environmental | Open in IMG/M |
| 3300005948 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_O2min_ad_571m_LV | Environmental | Open in IMG/M |
| 3300005969 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_Bottom_ad_4513_LV_A | Environmental | Open in IMG/M |
| 3300006002 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_NADW_ad_2505m_LV_A | Environmental | Open in IMG/M |
| 3300006013 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_NADW_ad_2500m_LV_B | Environmental | Open in IMG/M |
| 3300006019 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_NADW_ad_2500m_LV_A | Environmental | Open in IMG/M |
| 3300006076 | Microbial communities in diffuse hydrothermal fluids of Manus Basin, Bismarck Sea ? fluid A | Environmental | Open in IMG/M |
| 3300006091 | Marine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP125 | Environmental | Open in IMG/M |
| 3300006303 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT234_1_1000m | Environmental | Open in IMG/M |
| 3300006304 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_1000m | Environmental | Open in IMG/M |
| 3300006310 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_3_0500m | Environmental | Open in IMG/M |
| 3300006311 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_1000m | Environmental | Open in IMG/M |
| 3300006313 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0770m | Environmental | Open in IMG/M |
| 3300006326 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0770m | Environmental | Open in IMG/M |
| 3300006330 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_1_1000m | Environmental | Open in IMG/M |
| 3300006331 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_1000m | Environmental | Open in IMG/M |
| 3300006336 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0500m | Environmental | Open in IMG/M |
| 3300006338 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_1_0770m | Environmental | Open in IMG/M |
| 3300006340 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0770m | Environmental | Open in IMG/M |
| 3300006341 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT236_2_0770m | Environmental | Open in IMG/M |
| 3300006344 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0500m | Environmental | Open in IMG/M |
| 3300006347 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_1000m | Environmental | Open in IMG/M |
| 3300006567 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0770m | Environmental | Open in IMG/M |
| 3300006613 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS891_Anemone_DNA | Environmental | Open in IMG/M |
| 3300006900 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_A | Environmental | Open in IMG/M |
| 3300006902 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_250_ad_251m_LV_A | Environmental | Open in IMG/M |
| 3300007160 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_1000m | Environmental | Open in IMG/M |
| 3300007291 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_AAIW_ad_750m_LV_A | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300012950 | Marine microbial communities from the Central Pacific Ocean - Fk160115 155m metaG | Environmental | Open in IMG/M |
| 3300017704 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_07 viral metaG | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300020263 | Marine microbial communities from Tara Oceans - TARA_B100000809 (ERX555942-ERR599125) | Environmental | Open in IMG/M |
| 3300020295 | Marine microbial communities from Tara Oceans - TARA_B100000071 (ERX555980-ERR599109) | Environmental | Open in IMG/M |
| 3300020333 | Marine microbial communities from Tara Oceans - TARA_B100000959 (ERX556081-ERR598953) | Environmental | Open in IMG/M |
| 3300020367 | Marine microbial communities from Tara Oceans - TARA_B100000508 (ERX556112-ERR599005) | Environmental | Open in IMG/M |
| 3300020369 | Marine microbial communities from Tara Oceans - TARA_B100000446 (ERX556016-ERR599044) | Environmental | Open in IMG/M |
| 3300020389 | Marine microbial communities from Tara Oceans - TARA_B100000809 (ERX556139-ERR599008) | Environmental | Open in IMG/M |
| 3300020447 | Marine microbial communities from Tara Oceans - TARA_B100000745 (ERX556090-ERR599159) | Environmental | Open in IMG/M |
| 3300021068 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 100m 12015 | Environmental | Open in IMG/M |
| 3300021084 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 | Environmental | Open in IMG/M |
| 3300021442 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 | Environmental | Open in IMG/M |
| 3300021791 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmer | Environmental | Open in IMG/M |
| 3300021792 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Illium_FS922 150_kmer | Environmental | Open in IMG/M |
| 3300021975 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Hafa_FS927 _150kmer | Environmental | Open in IMG/M |
| 3300021978 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Perseverance_CTD_V16A_01_btl17 _150kmer | Environmental | Open in IMG/M |
| 3300025052 | Marine viral communities from the Pacific Ocean - LP-37 (SPAdes) | Environmental | Open in IMG/M |
| 3300025097 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026084 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_AAIW_ad_876m_LV_B (SPAdes) | Environmental | Open in IMG/M |
| 3300026087 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_NADW_ad_2505m_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300026119 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_NADW_ad_2500m_LV_B (SPAdes) | Environmental | Open in IMG/M |
| 3300026259 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV63 (SPAdes) | Environmental | Open in IMG/M |
| 3300026268 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV253 (SPAdes) | Environmental | Open in IMG/M |
| 3300027838 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300027844 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300028190 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_1000m | Environmental | Open in IMG/M |
| 3300028192 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_500m | Environmental | Open in IMG/M |
| 3300028487 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_2000m | Environmental | Open in IMG/M |
| 3300028488 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_1320m | Environmental | Open in IMG/M |
| 3300028489 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_1000m | Environmental | Open in IMG/M |
| 3300031800 | Marine microbial communities from Western Arctic Ocean, Canada - CB6_Bottom_1051 | Environmental | Open in IMG/M |
| 3300031801 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_Tmax_986 | Environmental | Open in IMG/M |
| 3300031803 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_AW_983 | Environmental | Open in IMG/M |
| 3300031886 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 3416 | Environmental | Open in IMG/M |
| 3300032019 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 21515 | Environmental | Open in IMG/M |
| 3300032048 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 32315 | Environmental | Open in IMG/M |
| 3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
| 3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300034695 | Seawater microbial communities from the Northeast subarctic Pacific Ocean - P26_June_2012_500m | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GS311G0146KB_00647680 | 2189573026 | Marine Estuarine | MRYFIGAFVLYIIGFLGGDVLIASLWVGASFGFIDLMKQGKI |
| LPaug09P16500mDRAFT_10419852 | 3300000142 | Marine | MRYFIGAFVLYIIGFLGGDVLXASLWVGASFGFIDLMKQGXI* |
| LPaug08P261000mDRAFT_10095344 | 3300000157 | Marine | MKYMRYAVGAFILYTVGYLGGDIIIVSIWMGIAYGFIDLMKQGEI* |
| LPaug08P261000mDRAFT_10234012 | 3300000157 | Marine | MRYFIGAFVLYIIGFLGGDVLIASLWVGASFGFIDLMKQGNI* |
| LPjun09P16500mDRAFT_10339711 | 3300000179 | Marine | MRYVVGAFLLYCTGWLGGDILISAIWIGVAYGFIDLMKQGKI* |
| LPfeb10P161000mDRAFT_10590002 | 3300000219 | Marine | MRYFIGAFVLYIIGFLGGDVLIASVWVGASFGFIDLMKQGNI* |
| LPjun09P12500mDRAFT_10461734 | 3300000222 | Marine | MRYFVGAWVLCCIGYVGGDILTSSLGVGAAFGFIDF |
| GBIDBA_100336749 | 3300001683 | Hydrothermal Vent Plume | MRYFIGAWVLCCIGYVGGDILTSSLGVGVAFGFIDFMKERSM* |
| JGI26061J44794_10094586 | 3300002919 | Marine | MRYFIGTWLLYAMAYLGSDIIIASIWIGAAYGFIDLMKERRM* |
| JGI26061J44794_10255642 | 3300002919 | Marine | MRYFVGTWLLYAIAYMGGDIIVVSLWMGAAYGFIDFMKERSM* |
| JGI26061J44794_10548342 | 3300002919 | Marine | MRYFFGTWILYVIGYLGGDIIIASIWMGAAYGFIDLMKQGKI* |
| FS891DNA_101913452 | 3300003539 | Diffuse Hydrothermal Flow Volcanic Vent | MRYALGAFILYTIGYLGGDIIIVSIWMGIAYGFIDLMRQGKL* |
| PicMicro_100284419 | 3300003702 | Marine, Hydrothermal Vent Plume | MRYFVGTWLLYAMAYMGGDIIIASIWIGAAYGFIDLMKERRM* |
| Ga0066860_101210333 | 3300005399 | Marine | MRYAVGAFLLYTIGYLGGDIIIASIWVGIAYGFIDLMKQGKI* |
| Ga0066867_100133698 | 3300005400 | Marine | MRYFFGATLLYFIGYFGGDVLIASLWVGASYGFIDIMRERNT* |
| Ga0066855_101091762 | 3300005402 | Marine | MRYALGAFILYTVGYLGGDIIIVSIWMGIAYGFIDLMKQGEI* |
| Ga0066848_100360241 | 3300005408 | Marine | MRYFFGATLLYFIGYSGGDVLIASLWVGASYGFIDIMRERNT* |
| Ga0066828_102234351 | 3300005423 | Marine | MRYFFGATLLYFIGYFGGDVLISSLWVGASYGFIDIMRERNT* |
| Ga0066851_101020883 | 3300005427 | Marine | MKYMRYALGAFILYTVGYLGGDIIIVSIWMGIAYGFIDLMKQGEI* |
| Ga0066850_103536883 | 3300005605 | Marine | MRYFFGATLLYFIGYFGGDVLISSLWVGASYGFIDIMRE |
| Ga0066380_101810781 | 3300005948 | Marine | MRYAVGAFLLYTIGYLGGDIIIASVWVGIAYGFIDLMKQGKI* |
| Ga0066369_101072944 | 3300005969 | Marine | MKYMRYALGAFILYTVGYLGGDIIIVSIWMGIAYGFIDIMKQGKI* |
| Ga0066368_100398645 | 3300006002 | Marine | MRYFVGTWLLYAIAYLGGDIIVASLWVGAAYGFIDFMKERSM* |
| Ga0066368_100932122 | 3300006002 | Marine | MKYMRYALGAFILYTVGYLGGDIIIVSIWMGIAYGFIDLMKQGKL* |
| Ga0066368_102684171 | 3300006002 | Marine | MRYFIGAWILYAIAYLGGDIIIASIWIGVAYGFID |
| Ga0066382_101384283 | 3300006013 | Marine | MRYFFGAWLLYGIGYLGGDIIVASLWMGAAYGFIDLMKEGSI* |
| Ga0066375_100513723 | 3300006019 | Marine | MKYMRYALGAFILYTVGYLGGDIIIVSIWMGIAYGFIDLMKQGKI* |
| Ga0081592_10463897 | 3300006076 | Diffuse Hydrothermal Fluids | MRYAVGAFLLYSIGYLGGDIIIASIWMGIAYGFIDLMKQGKI* |
| Ga0082018_10661831 | 3300006091 | Marine | MRYAVGAFLLYTIGYLGGDIIIASIWVGIAYGFIDLMKQGRI* |
| Ga0068490_13645711 | 3300006303 | Marine | DMKYMRYAVGAFLLYTIGYLGGDIIIASIWVGIAYGFIDLMKQGRL* |
| Ga0068504_11545762 | 3300006304 | Marine | MKYMRYAVGAFLLYTIGYLGGDIIIASIWVGIAYGFIDLMKQGEI* |
| Ga0068471_14600382 | 3300006310 | Marine | MRYAVGAFLLYTIGYLGGDIIIASVWVGIAYGFIDLMKQGEI* |
| Ga0068471_15752462 | 3300006310 | Marine | MRYVFGAFVLYSIGFFGGDIIIASLWMGIAYGFIDLMKQGEI* |
| Ga0068478_12018762 | 3300006311 | Marine | MRYAVGAFLLYTIGYLGGDIIIASIWVGIAYGFIDLMKQGEI* |
| Ga0068478_12701661 | 3300006311 | Marine | TWLLYAIAYLGGDIIVASLWVGAAYGFIDFMKERSM* |
| Ga0068472_106412352 | 3300006313 | Marine | MRYAVGAFLLYSIGYLGGDIIIASIWVGIAYGFIDLMKQGKI* |
| Ga0068477_12015881 | 3300006326 | Marine | MRYALGAFLLYTIGYLGGDIIIASIWVGIAYGFIDLMKQGEI* |
| Ga0068483_14636151 | 3300006330 | Marine | MKYMRYAVGAFLLYTIGYLGGDIIIASIWVGIAYGFIDLMKQGRL* |
| Ga0068488_11986461 | 3300006331 | Marine | MRYFVGTWLLYAIAYLGGDIIIASVWIGAAYGFIDLMKERSM* |
| Ga0068502_12866802 | 3300006336 | Marine | MRYALGAFLLYTIGYLGGDIIIASIWVGIAYGFIDLMKQGEL* |
| Ga0068502_13938502 | 3300006336 | Marine | MRYAVGAFLLYIIGYLGGDIIIASIWVGVAYGFIDLMKQGKI* |
| Ga0068502_17583732 | 3300006336 | Marine | MRYALGAFLLYTIGYLGGDIIIASVWVGIAYGFIDIMKQGEI* |
| Ga0068482_12227157 | 3300006338 | Marine | MTIMRYAVGAFLLYTIGYLGGDIIIASVWVGIAYGFIDLMKQGKI* |
| Ga0068482_15170922 | 3300006338 | Marine | MRYAVGAFLLYTIGYLGGDIIIASIWVGIAYGFIDLMKQGRL* |
| Ga0068503_102215963 | 3300006340 | Marine | MRYAVGAFLLYTIGYLGGDIIIASIWVGVAYGFIDLMKQGEI* |
| Ga0068503_104614361 | 3300006340 | Marine | GSWLLYATAYLGGDIIIASVWIGAAYGFIDLMKERSM* |
| Ga0068503_104892094 | 3300006340 | Marine | MRYFIGAFVLYIIGFLGGDVLMASLWVGASFGFIDLMKQGNI* |
| Ga0068503_105081662 | 3300006340 | Marine | MKYMRYAVGAFLLYTIGYLGGDIIIASIWVGIAYGFIDIMKQGEI* |
| Ga0068503_106118381 | 3300006340 | Marine | MRYAVGAFLLYTIGYLGGDIIIASIWVGIAYGFIDLMKDNKI* |
| Ga0068503_110085832 | 3300006340 | Marine | MRYFFGLWMLYGIGYLGGDIIVASLWVGAAYGFIDFMKERSI* |
| Ga0068493_1030517514 | 3300006341 | Marine | MRYFLGAFVLYIIGFLGGDVLIASLWVGASFGFIDLMKQGNI* |
| Ga0068493_107173482 | 3300006341 | Marine | MRYAVGAFLLYTIGYLGGDIIIASVWVGIAYGFIDLMKQGRL* |
| Ga0099695_10745146 | 3300006344 | Marine | MKYMRYAFGAFILYTVGYLGGDIIIVSIWMGIAYGFIDLMKQGRL* |
| Ga0099695_11501032 | 3300006344 | Marine | MRYAVGAFLLYTIGYLGGDIIIASVWVGIAYGFIDLMKQGRI* |
| Ga0099697_10965875 | 3300006347 | Marine | MRYAVGAFLLYTIGYLGGDIIIASIWVGIAYGFIDLM |
| Ga0099958_13006652 | 3300006567 | Marine | MRYALGAFLLYTIGYLGGDIIIASIWVGIAYGFIDLMKQGKI* |
| Ga0101494_11913452 | 3300006613 | Diffuse Hydrothermal Flow Volcanic Vent | MKYMRYALGAFILYTIGYLGGDIIIVSIWMGIAYGFIDLMRQGKL* |
| Ga0066376_102626563 | 3300006900 | Marine | AFILYTVGYLGGDIIIVSIWMGIAYGFIDLMKQGKL* |
| Ga0066376_104414151 | 3300006900 | Marine | FRNWTIMRYFFGTWILYVIGYLGGDIIIASIWMGIAYGFIDLMKQGKI* |
| Ga0066376_104425533 | 3300006900 | Marine | MRYFIGAWILYAIAYLGGDIIIASIWIGVAYGFIDLMKQGRI* |
| Ga0066376_104544082 | 3300006900 | Marine | MRYAVGSFLLYTIRYLGGDIIIASIWVGIAYGFIDFMKQGKI* |
| Ga0066376_105331421 | 3300006900 | Marine | MRYALGAFLLYSIGYLGGDIIIASIWMGIAYGFIDLMKQGKL* |
| Ga0066372_100411597 | 3300006902 | Marine | MRYLFGVSMLYSIGYFGGDVLTTSLWMGAAYGFIDIMK |
| Ga0066372_103303952 | 3300006902 | Marine | MRYAVGVFLLYTIGYLGGDIIIASVWVGIAYGFIDFMKQGKHGK* |
| Ga0066372_104004193 | 3300006902 | Marine | MRYFIGAFVLYIIGFFGGDVLIASLWVGASYGFIDLMKQGKI* |
| Ga0066372_104329962 | 3300006902 | Marine | MRYVLGAFVLYSIGFFGGDILIASLWMGIAYGFLDLMKQGKI* |
| Ga0066372_108887022 | 3300006902 | Marine | MRYFFGVSMLYSIGYFGGDVLTSSLCMGAAYGFIDHMKERSI* |
| Ga0099959_10831213 | 3300007160 | Marine | MKYMRYAVGAFILYTVGYLGGDIIIVSIWMGIAYGFIDLMKQGKI* |
| Ga0066367_12050452 | 3300007291 | Marine | MRYAVGAFLLYTIGYLGGDIIIASIWMGIAYGFIDLMKQGEI* |
| Ga0114996_100643216 | 3300009173 | Marine | MRYFIGAFILYIIGFLGGDVLIASLWMGASFGFIDLMKQGKI* |
| Ga0114996_109847543 | 3300009173 | Marine | MKYMRYAVGAFLLYTVGYLGGNIIITSIWMGIAYGFIDLMKQGEI* |
| Ga0114996_110145772 | 3300009173 | Marine | MRYVFGAFVLYSIGFFGGDILIASLWVGIAYGFIDMMKQGKI* |
| Ga0114993_109864663 | 3300009409 | Marine | MRYAVGAFLLYTVGYLEGNIIITSIWMGIAYGFIDLMKQGEI* |
| Ga0114997_104812872 | 3300009425 | Marine | MRYAIGAFLLYAVGYLGGNIIIVSIWMGITYGFIDLMKQGKI* |
| Ga0114999_111766812 | 3300009786 | Marine | MKYMRYAFGAFLLYTIGYLGGDIIIASIWVGIAYGFIDLMKQGEI* |
| Ga0114999_113594201 | 3300009786 | Marine | MRYFIGAFVLYIIGFLGGDVLIASLWVGASYGFIGLMKQGII* |
| Ga0133547_114909922 | 3300010883 | Marine | MRYFVGAWVLCCIGYVGGDILTSSLGVGAAFGFIDFMKERSM* |
| Ga0163108_111052201 | 3300012950 | Seawater | MRYAVGAFLLYTIGYLGGDIIIASIWMGIAYGFIDLMKQGKI* |
| Ga0181371_10205391 | 3300017704 | Marine | MDVLGRIMRYFFGATLLYFIGYFGGDVLIASLWVGASYGFI |
| Ga0181432_10851563 | 3300017775 | Seawater | MKYMRYAVGAFLLYTIGYLGGDIIIASIWVGIAYGFIDLMKQGEI |
| Ga0181432_11812122 | 3300017775 | Seawater | MRYFIGAFVLYIIGFLGGDVLIASLWVGASYGFIDLMKQGNI |
| Ga0181432_12788172 | 3300017775 | Seawater | MRYALGAFLLYSIGFFGGDILIASLWVGIAYGFIDMMKQGKI |
| Ga0181432_13070011 | 3300017775 | Seawater | MRYFVGSWLLYATAYLGGDIIIASVWIGAAFGFIDLMKERQM |
| Ga0211679_10298262 | 3300020263 | Marine | MKYMRYALGAFILYTVGYLGGDIIIVSIWMGIAYGFIDLMKQGEI |
| Ga0211530_100379912 | 3300020295 | Marine | MRYFFGATLLYFIGYFGGDVLIASLWVGASYGFIDIMRER |
| Ga0211661_10156703 | 3300020333 | Marine | MRYFFGATLLYFIGYFGGDVLIASLWVGASYGFIDIMRERNT |
| Ga0211703_101287762 | 3300020367 | Marine | MRYFVGTWLLYAIAYLGGDIIIASVWIGAAYGFIDLMKERSM |
| Ga0211709_102616871 | 3300020369 | Marine | MRYALGAFILYTVGYLGGDIIIVSIWMGIAYGFIDLMKQGEI |
| Ga0211680_103116632 | 3300020389 | Marine | MRYFVGAWVLFAIGYVGGDVLISSLWVGAAYGFIDLMKEGLM |
| Ga0211691_101272173 | 3300020447 | Marine | MRYFIGAWVLFAIGYMGGDVLISSLWVGAAYGFIDFMKEIST |
| Ga0211691_103638701 | 3300020447 | Marine | MRYAVGAFLLYTIGYLGGDIIIASIWVGIAYGFIDLMKQRKI |
| Ga0206684_10257842 | 3300021068 | Seawater | MRYFFGMSVLYSIGYFGGDVLTSSLCMGAAYGFIDHIKERSI |
| Ga0206678_100095201 | 3300021084 | Seawater | FLLYCTGWLGGDILISAIWIGAAYGFIDLMKQGKI |
| Ga0206685_102954601 | 3300021442 | Seawater | MRYAVGAFLLYTIGYLGGDIIIASVWVGIAYGFIDLMKQGRI |
| Ga0226832_104338922 | 3300021791 | Hydrothermal Vent Fluids | MRYVFGAFVLYSIGQFGGDILIAALWMGIVYGFIDLMKQGKI |
| Ga0226832_104853511 | 3300021791 | Hydrothermal Vent Fluids | MRYVLGAFVLYSIGFFGGDILIASLWMGIAYGFIDLMKQGKI |
| Ga0226836_101408502 | 3300021792 | Hydrothermal Vent Fluids | MKYMRYALGAFILYTVGYLGGDIIIVSIWVGIAYGFIDLMKQGKI |
| Ga0226836_107118212 | 3300021792 | Hydrothermal Vent Fluids | MRYALGAFLLYSIGYLGGDIIIASIWMGIAYGFIDLMKQGKL |
| Ga0232643_13042632 | 3300021975 | Hydrothermal Vent Fluids | MRYFFGAWILYVIGYLGGDIIIASIWMGVAYGFIDLMKQGKI |
| Ga0232646_10708822 | 3300021978 | Hydrothermal Vent Fluids | MRYFFGTWILYVIGYLGGDIIIASIWMGAAYGFIDLMKQGKI |
| Ga0207906_10540661 | 3300025052 | Marine | MRYFVGAFVLYIIGFLGGDVLIASLWVGASFGFIDLMKQGNI |
| Ga0208010_10602311 | 3300025097 | Marine | MRYFFGATLLYFIGYFGGDVLIASLWVGASYGFIDIMRE |
| Ga0208881_10974752 | 3300026084 | Marine | YMRYALGAFILYTIGYLGGDIIIASIWVGIAYGFIDLMKQGEI |
| Ga0208113_10260926 | 3300026087 | Marine | MRYALGAFLLYIVGYFEGDIIIASIWMGVAYGFIDLMKQGKI |
| Ga0207966_10968933 | 3300026119 | Marine | MRYFFGAWLLYGIGYLGGDIIVASLWMGAAYGFIDLMKEGSI |
| Ga0208896_10608452 | 3300026259 | Marine | MRYFFGATLLYFIGYFGGDVLISSLWVGASYGFIDIMRERNT |
| Ga0208896_11111833 | 3300026259 | Marine | MRYFFGATLLYFIGYFGGDVLISSLWVGASYGFIDIMRERN |
| Ga0208641_10644403 | 3300026268 | Marine | MKYMRYALGAFILYTVGYLGGDIIIVSIWMGIAYGFIDLMKQ |
| Ga0209089_100173206 | 3300027838 | Marine | MRYFIGAFILYIIGFLGGDVLIASLWMGASFGFIDLMKQGKI |
| Ga0209089_106620743 | 3300027838 | Marine | MRYALGAFILYTVGYLGGDIIIVSIWMGIAYGFIDLMK |
| Ga0209501_104502351 | 3300027844 | Marine | MKYMRYAVGAFLLYTVGYLGGNIIITSIWMGIAYGFIDLMKQGEI |
| Ga0257108_10096169 | 3300028190 | Marine | MRYFIGAFVLYIIGFLGGDVLIASVWVGASFGFIDLMKQGNI |
| Ga0257108_10313995 | 3300028190 | Marine | MRYFLGTWLLYAIAYLGGDIIVASLWVGAAYGFIDFMKERSM |
| Ga0257108_10752684 | 3300028190 | Marine | MRYFVGTWFLYAIAYLGGDIIVASIWIGAAYGFIDLMKERSM |
| Ga0257108_10880613 | 3300028190 | Marine | MKYMRYAVGAFILYTVGYLGGDIIIVSIWMGIAYGFIDLMKQGEI |
| Ga0257108_10929543 | 3300028190 | Marine | MKYMRYALGAFILYSIGYLGGDIIIASIWVGIAYGFIDLMKQGKI |
| Ga0257108_12291501 | 3300028190 | Marine | MRYAVGAFLLYTIGYLGGDIIIASIWVGIAYGFIDLMKQGEI |
| Ga0257107_10047596 | 3300028192 | Marine | MRYFVGAWVLCCIGYVGGDILTSSLGVGAAFGFIDFMKERSM |
| Ga0257107_10722474 | 3300028192 | Marine | MRYFIGAFVLYIIGFLGGDVLMASLWVGASFGFIDLMKQGNI |
| Ga0257107_11461373 | 3300028192 | Marine | KYMRYALGAFILYTVGYLGGDIIIVSIWMGIAYGFIDLMKQGEI |
| Ga0257109_10926794 | 3300028487 | Marine | MRYFVGTWLLYAIAYLGGDIIVASLWVGAAYGFIDFMKERSM |
| Ga0257113_10741773 | 3300028488 | Marine | MRYFVGTWLLYAIAYLGGDIIIASVWIGAAYGFIDFMKERSL |
| Ga0257112_101811122 | 3300028489 | Marine | MRYALGAFLLYSIGYLGGDIIIASIWMGIAYGFIDLMKQGRL |
| Ga0310122_100409573 | 3300031800 | Marine | MRYFFGVWMLYGIGYLGGDIIIASLWVGAAFGFIDIMKKKST |
| Ga0310122_101495281 | 3300031800 | Marine | MRYALGAFLLYIIGYFGGDIIIASIWMGAAYGFIDLMKQGKI |
| Ga0310122_102202401 | 3300031800 | Marine | MRYALGAFILYTVGYLGGDIIIVSIWMGIAYGFIDLMKQGKI |
| Ga0310122_104176731 | 3300031800 | Marine | MRYFVGTWLLYAIAYMGGDIIVASLWVGAAYGFIDFMKERSM |
| Ga0310122_104813962 | 3300031800 | Marine | FMRYALGAFLLYIVGYFGGDIIIASIWMGIAYGFIDLMKQGKI |
| Ga0310121_100116588 | 3300031801 | Marine | MKYLRYFFGVWMLYGIGYLGGDIIVASLWAGAAFGFIDIMKGMST |
| Ga0310121_103282703 | 3300031801 | Marine | MRYFIGAFVLYIIGFLGGDVLIASLWVGASYGFIDLMREGKI |
| Ga0310120_103856301 | 3300031803 | Marine | RQMKYLRYFFGVWMLYGIGYLGGDIIVASLWAGAAFGFIDIMKGMST |
| Ga0315318_104865963 | 3300031886 | Seawater | MRYALGAFLLYTIGYLGGDIIIASVWVGIAYGFIDIMKQGKI |
| Ga0315318_107813711 | 3300031886 | Seawater | MKYIRYTFGAFILYTVGYLGGDIIIVSIWMGIAYGFIDLMKQGEI |
| Ga0315324_103845812 | 3300032019 | Seawater | MKYMRYAFGAFILYTVGYLGGDIIIVSIWMGIAYGFIDLMKQGEI |
| Ga0315329_106667872 | 3300032048 | Seawater | MRYFLGAFVLYIIGFFGGDVLIASLWVGASYGFIDLMKQGKI |
| Ga0310345_104689084 | 3300032278 | Seawater | MRYAVGAFLLYTIGYLGGDIIIASVWVGIAYGFIDLMKQGEI |
| Ga0310345_110511431 | 3300032278 | Seawater | MRYVFGAFVLYSIGFFGGDILIASLWIGIAYGFIDMMKQGKI |
| Ga0310345_116325042 | 3300032278 | Seawater | MKYMRYAVGAFLLYTIGYLGGDIIIASIWVGIAYGFIDIMKQGEI |
| Ga0310345_116356672 | 3300032278 | Seawater | MRYALGAFLLYTIGYLGGDIIIASVWMGIAYGFIDLMKQGKI |
| Ga0310345_118995861 | 3300032278 | Seawater | MRYFIGAFILYIIGFLGGDVLIASLWVGASFGFIDLMK |
| Ga0310345_121515672 | 3300032278 | Seawater | MRYFIGAFVLYIIGFLGGDVLIASLWMGASYGFIDLMKQGNI |
| Ga0315334_102648812 | 3300032360 | Seawater | MRYFIGAFVLYIIGFFGGDVLIASLWVGASYGFIDLMKQGKI |
| Ga0315334_118346322 | 3300032360 | Seawater | MRYFFGLWMLYGIGYLGGDIIVASLWVGAAYGFIDFMKERSI |
| Ga0310342_1024448032 | 3300032820 | Seawater | MRYFIGAFVLYIIGFLGGDVLIASLWVGASYGFIDLMKQGKI |
| Ga0372840_172148_483_620 | 3300034695 | Seawater | MKYMRYVVGAFLLYCTGWLGGDILISAIWIGVAYGFIDLMKQGKI |
| ⦗Top⦘ |