


| Basic Information | |
|---|---|
| Family ID | F050386 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 145 |
| Average Sequence Length | 43 residues |
| Representative Sequence | LRGPRKSYLWKRISEVHKLMVDIQTAHAKLGSQDGNSREH |
| Number of Associated Samples | 134 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 13.99 % |
| % of genes near scaffold ends (potentially truncated) | 81.38 % |
| % of genes from short scaffolds (< 2000 bps) | 82.07 % |
| Associated GOLD sequencing projects | 133 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (70.345 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.897 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.586 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.069 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.06% β-sheet: 0.00% Coil/Unstructured: 52.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF00961 | LAGLIDADG_1 | 1.38 |
| PF03175 | DNA_pol_B_2 | 1.38 |
| PF00499 | Oxidored_q3 | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG0839 | NADH:ubiquinone oxidoreductase subunit 6 (chain J) | Energy production and conversion [C] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 70.34 % |
| All Organisms | root | All Organisms | 29.66 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886013|SwBSRL2_contig_1239357 | Not Available | 2488 | Open in IMG/M |
| 3300000305|bgg_mtDRAFT_1051402 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Tricholomatineae → Lyophyllaceae → Hypsizygus → Hypsizygus marmoreus | 1304 | Open in IMG/M |
| 3300000305|bgg_mtDRAFT_1055081 | Not Available | 637 | Open in IMG/M |
| 3300000545|CNXas_1009133 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Tricholomatineae → Lyophyllaceae → Hypsizygus → Hypsizygus marmoreus | 699 | Open in IMG/M |
| 3300001152|JGI12699J13341_100410 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Tricholomatineae → Lyophyllaceae → Hypsizygus → Hypsizygus marmoreus | 1531 | Open in IMG/M |
| 3300001159|JGI12650J13346_1000196 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Tricholomatineae → Lyophyllaceae → Hypsizygus → Hypsizygus marmoreus | 2044 | Open in IMG/M |
| 3300002654|Ga0005464J37254_102373 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Tricholomatineae → Lyophyllaceae → Hypsizygus → Hypsizygus marmoreus | 2311 | Open in IMG/M |
| 3300002655|Ga0005476J37264_101936 | Not Available | 2316 | Open in IMG/M |
| 3300002668|Ga0005482J37270_106670 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Tricholomatineae → Lyophyllaceae → Hypsizygus → Hypsizygus marmoreus | 1021 | Open in IMG/M |
| 3300003161|Ga0006765J45826_102451 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Tricholomatineae → Lyophyllaceae → Hypsizygus → Hypsizygus marmoreus | 2267 | Open in IMG/M |
| 3300004132|Ga0058902_1023996 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Tricholomatineae → Lyophyllaceae → Hypsizygus → Hypsizygus marmoreus | 4681 | Open in IMG/M |
| 3300004135|Ga0058884_1000469 | Not Available | 3127 | Open in IMG/M |
| 3300004135|Ga0058884_1397202 | Not Available | 955 | Open in IMG/M |
| 3300004612|Ga0068961_1330203 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Tricholomatineae → Lyophyllaceae → Hypsizygus → Hypsizygus marmoreus | 1230 | Open in IMG/M |
| 3300005542|Ga0070732_10022966 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Thelephorales → Thelephoraceae → Thelephora → Thelephora ganbajun | 3520 | Open in IMG/M |
| 3300005591|Ga0070761_10016540 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales | 4098 | Open in IMG/M |
| 3300006423|Ga0075039_1053845 | Not Available | 663 | Open in IMG/M |
| 3300006423|Ga0075039_1086342 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Tricholomatineae → Lyophyllaceae → Hypsizygus → Hypsizygus marmoreus | 1125 | Open in IMG/M |
| 3300006423|Ga0075039_1123092 | Not Available | 876 | Open in IMG/M |
| 3300006426|Ga0075037_1160969 | Not Available | 812 | Open in IMG/M |
| 3300007788|Ga0099795_10126199 | Not Available | 1028 | Open in IMG/M |
| 3300007819|Ga0104322_107348 | Not Available | 1075 | Open in IMG/M |
| 3300009641|Ga0116120_1132350 | Not Available | 809 | Open in IMG/M |
| 3300010093|Ga0127490_1029820 | Not Available | 1442 | Open in IMG/M |
| 3300010126|Ga0127482_1083061 | Not Available | 594 | Open in IMG/M |
| 3300010134|Ga0127484_1173015 | Not Available | 727 | Open in IMG/M |
| 3300010860|Ga0126351_1195533 | Not Available | 676 | Open in IMG/M |
| 3300010864|Ga0126357_1185831 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Tricholomatineae → Lyophyllaceae → Hypsizygus → Hypsizygus marmoreus | 2069 | Open in IMG/M |
| 3300010870|Ga0102750_10178471 | Not Available | 857 | Open in IMG/M |
| 3300011120|Ga0150983_12054085 | Not Available | 761 | Open in IMG/M |
| 3300011332|Ga0126317_10528217 | Not Available | 2100 | Open in IMG/M |
| 3300012041|Ga0137430_1109506 | Not Available | 784 | Open in IMG/M |
| 3300012154|Ga0153953_1016988 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Meruliaceae → Phlebia → Phlebia radiata | 1668 | Open in IMG/M |
| 3300012157|Ga0137353_1070782 | Not Available | 649 | Open in IMG/M |
| 3300012208|Ga0137376_10370340 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Tricholomatineae → Lyophyllaceae → Hypsizygus → Hypsizygus marmoreus | 1244 | Open in IMG/M |
| 3300012224|Ga0134028_1214259 | Not Available | 589 | Open in IMG/M |
| 3300012349|Ga0137387_10692149 | Not Available | 738 | Open in IMG/M |
| 3300012378|Ga0134025_1094015 | Not Available | 825 | Open in IMG/M |
| 3300012380|Ga0134047_1085512 | Not Available | 569 | Open in IMG/M |
| 3300012925|Ga0137419_10956581 | Not Available | 708 | Open in IMG/M |
| 3300012925|Ga0137419_11078637 | Not Available | 668 | Open in IMG/M |
| 3300016357|Ga0182032_10913392 | Not Available | 747 | Open in IMG/M |
| 3300019039|Ga0193123_10257167 | Not Available | 686 | Open in IMG/M |
| 3300019168|Ga0184569_104745 | Not Available | 2353 | Open in IMG/M |
| 3300019192|Ga0184603_109649 | Not Available | 601 | Open in IMG/M |
| 3300019249|Ga0184648_1126382 | Not Available | 578 | Open in IMG/M |
| 3300019254|Ga0184641_1301819 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Polyporaceae → Polyporus → Polyporus grammocephalus | 1552 | Open in IMG/M |
| 3300019258|Ga0181504_1306537 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Tricholomatineae → Lyophyllaceae → Hypsizygus → Hypsizygus marmoreus | 1410 | Open in IMG/M |
| 3300019886|Ga0193727_1018364 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Tricholomatineae → Lyophyllaceae → Hypsizygus → Hypsizygus marmoreus | 2542 | Open in IMG/M |
| 3300020061|Ga0193716_1254033 | Not Available | 629 | Open in IMG/M |
| 3300020064|Ga0180107_1345733 | Not Available | 770 | Open in IMG/M |
| 3300020199|Ga0179592_10002488 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 7662 | Open in IMG/M |
| 3300020580|Ga0210403_10526030 | Not Available | 959 | Open in IMG/M |
| 3300021088|Ga0210404_10751900 | Not Available | 556 | Open in IMG/M |
| 3300021286|Ga0179583_1084309 | Not Available | 2383 | Open in IMG/M |
| 3300021315|Ga0179958_1047824 | Not Available | 770 | Open in IMG/M |
| 3300021405|Ga0210387_10579184 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Tricholomatineae → Lyophyllaceae → Hypsizygus → Hypsizygus marmoreus | 997 | Open in IMG/M |
| 3300021411|Ga0193709_1067529 | Not Available | 812 | Open in IMG/M |
| 3300021951|Ga0222624_1053767 | Not Available | 1286 | Open in IMG/M |
| 3300021951|Ga0222624_1234228 | Not Available | 1756 | Open in IMG/M |
| 3300021951|Ga0222624_1304900 | Not Available | 693 | Open in IMG/M |
| 3300022501|Ga0242645_1000223 | Not Available | 2612 | Open in IMG/M |
| 3300022506|Ga0242648_1026628 | Not Available | 778 | Open in IMG/M |
| 3300022507|Ga0222729_1000484 | Not Available | 2433 | Open in IMG/M |
| 3300022522|Ga0242659_1046910 | Not Available | 754 | Open in IMG/M |
| 3300022527|Ga0242664_1000660 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 2911 | Open in IMG/M |
| 3300022530|Ga0242658_1032466 | Not Available | 1019 | Open in IMG/M |
| 3300022717|Ga0242661_1004369 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 1757 | Open in IMG/M |
| 3300022724|Ga0242665_10084169 | Not Available | 915 | Open in IMG/M |
| 3300022726|Ga0242654_10414059 | Not Available | 519 | Open in IMG/M |
| 3300023014|Ga0233358_100440 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Meruliaceae → Phlebia → Phlebia radiata | 1310 | Open in IMG/M |
| 3300023045|Ga0233344_1000962 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Tricholomatineae → Lyophyllaceae → Hypsizygus → Hypsizygus marmoreus | 3063 | Open in IMG/M |
| 3300023052|Ga0233331_1000146 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 4700 | Open in IMG/M |
| 3300023270|Ga0247784_1168977 | Not Available | 571 | Open in IMG/M |
| 3300023533|Ga0247537_100327 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Cantharellales → Ceratobasidiaceae → Rhizoctonia → Rhizoctonia solani | 1150 | Open in IMG/M |
| 3300023675|Ga0247533_103619 | Not Available | 617 | Open in IMG/M |
| 3300023691|Ga0228704_121037 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Tricholomatineae → Lyophyllaceae → Hypsizygus → Hypsizygus marmoreus | 537 | Open in IMG/M |
| 3300024187|Ga0247672_1033735 | Not Available | 834 | Open in IMG/M |
| 3300024245|Ga0247677_1068956 | Not Available | 523 | Open in IMG/M |
| 3300026317|Ga0209154_1093705 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Meruliaceae → Phlebia → Phlebia radiata | 1285 | Open in IMG/M |
| 3300027181|Ga0208997_1009990 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Meruliaceae → Phlebia → Phlebia radiata | 1255 | Open in IMG/M |
| 3300027303|Ga0208999_1000328 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 3327 | Open in IMG/M |
| 3300027432|Ga0209421_1127808 | Not Available | 524 | Open in IMG/M |
| 3300027528|Ga0208985_1010204 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 1769 | Open in IMG/M |
| 3300027574|Ga0208982_1068038 | Not Available | 713 | Open in IMG/M |
| 3300027633|Ga0208988_1128960 | Not Available | 617 | Open in IMG/M |
| 3300027652|Ga0209007_1036552 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Meruliaceae → Phlebia → Phlebia radiata | 1257 | Open in IMG/M |
| 3300028554|Ga0302047_10158116 | Not Available | 857 | Open in IMG/M |
| 3300030551|Ga0247638_1000360 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Meruliaceae → Phlebia → Phlebia radiata | 2200 | Open in IMG/M |
| 3300030585|Ga0247639_1057607 | Not Available | 877 | Open in IMG/M |
| 3300030591|Ga0247626_1028123 | Not Available | 1055 | Open in IMG/M |
| 3300030592|Ga0247612_1161602 | Not Available | 559 | Open in IMG/M |
| 3300030684|Ga0247617_1023479 | Not Available | 746 | Open in IMG/M |
| 3300030684|Ga0247617_1054247 | Not Available | 638 | Open in IMG/M |
| 3300030741|Ga0265459_12196824 | Not Available | 669 | Open in IMG/M |
| 3300030743|Ga0265461_10027560 | Not Available | 1787 | Open in IMG/M |
| 3300030761|Ga0265722_100879 | Not Available | 955 | Open in IMG/M |
| 3300030777|Ga0075402_10131692 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Tricholomatineae → Lyophyllaceae → Hypsizygus → Hypsizygus marmoreus | 1291 | Open in IMG/M |
| 3300030778|Ga0075398_10052747 | Not Available | 1070 | Open in IMG/M |
| 3300030784|Ga0102758_11040823 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Tricholomatineae → Lyophyllaceae → Hypsizygus → Hypsizygus marmoreus | 1217 | Open in IMG/M |
| 3300030827|Ga0315871_101265 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Meruliaceae → Phlebia → Phlebia radiata | 1664 | Open in IMG/M |
| 3300030827|Ga0315871_101352 | Not Available | 1624 | Open in IMG/M |
| 3300030830|Ga0308205_1000348 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Tricholomatineae → Lyophyllaceae → Hypsizygus → Hypsizygus marmoreus | 2510 | Open in IMG/M |
| 3300030852|Ga0075389_10093960 | Not Available | 1132 | Open in IMG/M |
| 3300030858|Ga0102759_1062895 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Tricholomatineae → Lyophyllaceae → Hypsizygus → Hypsizygus marmoreus | 2418 | Open in IMG/M |
| 3300030863|Ga0265766_1022005 | Not Available | 530 | Open in IMG/M |
| 3300030872|Ga0265723_1006981 | Not Available | 721 | Open in IMG/M |
| 3300030882|Ga0265764_106241 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Tricholomatineae → Lyophyllaceae → Hypsizygus → Hypsizygus marmoreus | 683 | Open in IMG/M |
| 3300030887|Ga0265733_100275 | Not Available | 1358 | Open in IMG/M |
| 3300030916|Ga0075386_10099995 | Not Available | 1165 | Open in IMG/M |
| 3300030935|Ga0075401_10082399 | Not Available | 1111 | Open in IMG/M |
| 3300030935|Ga0075401_10121546 | Not Available | 1139 | Open in IMG/M |
| 3300030937|Ga0138302_1857215 | Not Available | 1219 | Open in IMG/M |
| 3300030968|Ga0075376_10083687 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Meruliaceae → Phlebia → Phlebia radiata | 1277 | Open in IMG/M |
| 3300030989|Ga0308196_1009853 | Not Available | 973 | Open in IMG/M |
| 3300031014|Ga0102756_1456916 | Not Available | 556 | Open in IMG/M |
| 3300031017|Ga0265744_113291 | Not Available | 535 | Open in IMG/M |
| 3300031022|Ga0138301_1205661 | Not Available | 713 | Open in IMG/M |
| 3300031024|Ga0265724_103193 | Not Available | 579 | Open in IMG/M |
| 3300031044|Ga0265747_103763 | Not Available | 799 | Open in IMG/M |
| 3300031051|Ga0074029_1117696 | Not Available | 1149 | Open in IMG/M |
| 3300031057|Ga0170834_106442979 | Not Available | 543 | Open in IMG/M |
| 3300031058|Ga0308189_10105743 | Not Available | 900 | Open in IMG/M |
| 3300031105|Ga0315823_107171 | Not Available | 999 | Open in IMG/M |
| 3300031411|Ga0102761_10186680 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 1170 | Open in IMG/M |
| 3300031474|Ga0170818_100811843 | Not Available | 954 | Open in IMG/M |
| 3300031678|Ga0310114_118378 | Not Available | 632 | Open in IMG/M |
| 3300031678|Ga0310114_123749 | Not Available | 533 | Open in IMG/M |
| 3300031708|Ga0310686_103618818 | Not Available | 1565 | Open in IMG/M |
| 3300031810|Ga0316044_118958 | Not Available | 725 | Open in IMG/M |
| 3300031827|Ga0247532_101593 | Not Available | 766 | Open in IMG/M |
| 3300032551|Ga0321339_1137361 | Not Available | 542 | Open in IMG/M |
| 3300032625|Ga0214501_1204539 | Not Available | 628 | Open in IMG/M |
| 3300032757|Ga0314753_1037430 | Not Available | 881 | Open in IMG/M |
| 3300032760|Ga0314754_1047905 | Not Available | 672 | Open in IMG/M |
| 3300032812|Ga0314745_1108657 | Not Available | 572 | Open in IMG/M |
| 3300032913|Ga0314739_1056665 | Not Available | 736 | Open in IMG/M |
| 3300032915|Ga0314749_1089808 | Not Available | 662 | Open in IMG/M |
| 3300032934|Ga0314741_1100975 | Not Available | 665 | Open in IMG/M |
| 3300032959|Ga0314738_1059598 | Not Available | 691 | Open in IMG/M |
| 3300033530|Ga0314760_1122290 | Not Available | 640 | Open in IMG/M |
| 3300033544|Ga0316215_1009461 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Tricholomatineae → Lyophyllaceae → Hypsizygus → Hypsizygus marmoreus | 960 | Open in IMG/M |
| 3300034663|Ga0314784_009569 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Tricholomatineae → Lyophyllaceae → Hypsizygus → Hypsizygus marmoreus | 1335 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 16.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 11.03% |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 6.90% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.21% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 4.14% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.14% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 2.76% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 2.76% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.38% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.38% |
| Leaf Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Leaf Litter | 1.38% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 1.38% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.38% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.69% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.69% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.69% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.69% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.69% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.69% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.69% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Permafrost Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.69% |
| Quercus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere | 0.69% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.69% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.69% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886013 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300000305 | Blue grama grass rhizosphere microbial communities from Sevilleta, New Mexico, USA - Combined Assembly | Host-Associated | Open in IMG/M |
| 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Host-Associated | Open in IMG/M |
| 3300001152 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O1 | Environmental | Open in IMG/M |
| 3300001159 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 | Environmental | Open in IMG/M |
| 3300002654 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF113 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
| 3300002655 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF125 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
| 3300002668 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF131 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
| 3300003161 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300004132 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF240 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004135 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004612 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 53 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300006423 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_056 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006426 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_054 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300007819 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-1-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
| 3300010093 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010126 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010134 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010860 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010864 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010870 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012041 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2 | Environmental | Open in IMG/M |
| 3300012154 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ037 MetaG | Host-Associated | Open in IMG/M |
| 3300012157 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT760_2 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012224 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012378 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012380 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300019039 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137) | Environmental | Open in IMG/M |
| 3300019168 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLI2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZA3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019249 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019254 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019258 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300020061 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1 | Environmental | Open in IMG/M |
| 3300020064 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT27_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021286 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021315 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_2_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021411 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2 | Environmental | Open in IMG/M |
| 3300021951 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022501 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023014 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-P29 | Environmental | Open in IMG/M |
| 3300023045 | Leaf litter microbial communities from Shasta-Trinity National Forest, California, United States - GEON-DECOMP-281 | Environmental | Open in IMG/M |
| 3300023052 | Leaf litter microbial communities from Shasta-Trinity National Forest, California, United States - GEON-DECOMP-205 | Environmental | Open in IMG/M |
| 3300023270 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L169-409R-5 | Environmental | Open in IMG/M |
| 3300023533 | Metatranscriptome of spruce litter microbial communities from Bohemian Forest, Czech Republic - CLE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023675 | Metatranscriptome of spruce litter microbial communities from Bohemian Forest, Czech Republic - CLI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023691 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 1-17_Aug_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024187 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13 | Environmental | Open in IMG/M |
| 3300024245 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18 | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300027181 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027303 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027528 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027574 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028554 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (v9) | Environmental | Open in IMG/M |
| 3300030551 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb3 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030585 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb4 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030591 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bb3 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030592 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Ab1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030684 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Anb6 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300030761 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030777 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030778 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030784 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 6A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030827 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T28 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030830 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_368 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030852 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030858 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 6B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030872 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030887 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030935 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030937 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300030968 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030989 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031014 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 5B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031017 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031022 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031024 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031044 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031051 | Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus C1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031105 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T12 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031411 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031678 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031810 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031827 | Metatranscriptome of spruce litter microbial communities from Bohemian Forest, Czech Republic - CLI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032551 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032625 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032757 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032760 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032812 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032913 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032915 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032934 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032959 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033530 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Host-Associated | Open in IMG/M |
| 3300034663 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SwBSRL2_0434.00005570 | 2162886013 | Switchgrass Rhizosphere | IIYKIYVIRFRLRGPRKSYRWKRISKVHKLMIDIQTAHAKLGSQDGNSR |
| bgg_mtDRAFT_10514024 | 3300000305 | Host-Associated | LRGSRKSYQWKRISELHKLMVDIQTAHAKLGSQDGNSR |
| bgg_mtDRAFT_10550812 | 3300000305 | Host-Associated | LRGPRKSYLWKRISELHKLMVDIQTTQAKLGSQDGNS |
| CNXas_10091331 | 3300000545 | Quercus Rhizosphere | LRGSRKSYQWKRISEVHKLMVDIQTAHAKLGSRDGNSREHEIKVPNDY* |
| JGI12699J13341_1004101 | 3300001152 | Forest Soil | LRGSRKSYQWKRISEVHKLMVDIQTAHAKLGSQDGNSREHEIKVPNDY* |
| JGI12650J13346_10001961 | 3300001159 | Forest Soil | LRGPRKSYLWKRISEVHKLMVDIQTAHAKLGSQDGNSREH* |
| Ga0005464J37254_1023732 | 3300002654 | Forest Soil | LRGPRKSYQWKRISEVHKLMVDIQTAHAKLGSQDGNSREHEIKVPNDY* |
| Ga0005476J37264_1019361 | 3300002655 | Forest Soil | LRGSRKSYQWKRISEVHKLMIDIQTAHAKLGSQDGNSREHEIKVPNDY* |
| Ga0005482J37270_1066701 | 3300002668 | Forest Soil | LRGPRKSYQWKRISEVHKLMVDIQTAHAKLGSRDGNSREHEIKVPNDY* |
| Ga0006765J45826_1024511 | 3300003161 | Avena Fatua Rhizosphere | LWGPRKSYQWKRNSEVHKLMIDIQTAHDKLGSQDGNSREHEIKVPNDY* |
| Ga0058902_10239962 | 3300004132 | Forest Soil | LWGPRKSYLWKRISELHKLMVDIQTTHAKLGSQDGNSREH* |
| Ga0058884_10004691 | 3300004135 | Forest Soil | LRGSKKSYQWKRISEVHKLMVDIQTAHAKLGSQDGNSREHDIKVPNDY* |
| Ga0058884_13972021 | 3300004135 | Forest Soil | KFYTFRLRGSRKSYLWKRISELHKLMVDIQTAHAKLGSQDGNSREH* |
| Ga0068961_13302031 | 3300004612 | Peatlands Soil | MWGPRKSYLWKRISELHKLVVANQTAHAKLGSQDGNSREH* |
| Ga0070732_100229661 | 3300005542 | Surface Soil | LRGSKKSYQWKRISEVHKLMVDIQTAHDKLGSQDGNSREHEIKVPNDY* |
| Ga0070761_100165401 | 3300005591 | Soil | LRGSRKSYQWKRISEVHKLMLDIQTIHAKLNSQDGNSREHRSRSQMIIK* |
| Ga0075039_10538451 | 3300006423 | Permafrost Soil | PRKSYHWNPNSKLHKLLVDIQTTNAKLSSQDGNSREH* |
| Ga0075039_10863421 | 3300006423 | Permafrost Soil | MTFSLRGPRKSYHWNPNSKLHKLLVDIQTTNAKLSSQDGNSR |
| Ga0075039_11230921 | 3300006423 | Permafrost Soil | FSLRGPRKSYHWNPNSKLHKLLVDIQTTNAKLSSQDGNSREH* |
| Ga0075037_11609691 | 3300006426 | Permafrost Soil | SLRGPRKSYHWNPNSKLHKLLVDIQTTNAKLSSQDGNSREH* |
| Ga0099795_101261991 | 3300007788 | Vadose Zone Soil | DLVNRVKLFYAFRLRGPRKSYLWKRISELHKLMVDIQTAQAKLGSQDGNSREH* |
| Ga0104322_1073481 | 3300007819 | Permafrost Soil | FRLRGSRKSYLWKRISELHKLMIDIQTVHAKLDSQDGNSREH* |
| Ga0116120_11323501 | 3300009641 | Peatland | KSYQWKRISEVHKLMVDIQTAHAKLGSQDGNSREHEIKVPNDY* |
| Ga0127490_10298201 | 3300010093 | Grasslands Soil | NKFYTFRLRGSRKSYLWKRISELHKLMVDIQTTQAKLGSQDGNSREHEIKVPNDY* |
| Ga0127482_10830612 | 3300010126 | Grasslands Soil | EVHKLMIDIHTAHDKLGSQDGNSREHEIKVPNDY* |
| Ga0127484_11730151 | 3300010134 | Grasslands Soil | FRLWGPRKSYQWKRNSEVHKLMIDIQTAHDKLGSQDGNSREHEIKVPNDY* |
| Ga0126351_11955332 | 3300010860 | Boreal Forest Soil | SRKSYLWKRISELHKLMIDIQTVHAKLDSQDGNSREH* |
| Ga0126357_11858311 | 3300010864 | Boreal Forest Soil | MTFSLRGPRKSYHWNPNSKLHKLLVDIQTTNAKLSSQDGNSREH* |
| Ga0102750_101784711 | 3300010870 | Soil | RKSYQWKRISEVHKLVVKFQTAHDKLSSQDGNSREHN* |
| Ga0150983_120540851 | 3300011120 | Forest Soil | SRKSYLWKRISELHKLMIDIQTAHAKLGSQDGNSREH* |
| Ga0126317_105282171 | 3300011332 | Soil | SYQWKRISEVHKLMVDIQTAHAKLGSQDGNSREH* |
| Ga0137430_11095062 | 3300012041 | Soil | GSLKSYHWNSNSKLHKLLVDIQTANAQLSSQDGNSREH* |
| Ga0153953_10169881 | 3300012154 | Attine Ant Fungus Gardens | RGSRKSYQWKRNSELHKLIIDIQTIHDKLNSQDGNSREHRSRSQMIIK* |
| Ga0137353_10707821 | 3300012157 | Soil | GPRKSYQWKRISEVHKLMVDIQTAHAKLGSQDGNSREHEIKVPNDY* |
| Ga0137383_109753191 | 3300012199 | Vadose Zone Soil | RKSYLWKRISELHKLMVDIQTTHAKLGSQDGNSREHRSRSQMVVQ* |
| Ga0137376_103703401 | 3300012208 | Vadose Zone Soil | LRGSRKSYLWKRISELHKLMIDIQTIHAKLNSQDGNSREH |
| Ga0134028_12142591 | 3300012224 | Grasslands Soil | RKSYLWKRISELHKLMVDIQTAHAKLGSQDGNSREH* |
| Ga0137387_106921491 | 3300012349 | Vadose Zone Soil | KSYLWKRISELHKLMIDIQTAHDKLGSQDGNSREH* |
| Ga0134025_10940152 | 3300012378 | Grasslands Soil | KSYLWKRISEVHKLMVDIQTAHAKLGSQDGNSREH* |
| Ga0134047_10855121 | 3300012380 | Grasslands Soil | RNSEVHKLMIDIQTAHDKLGSQDGNSREHEIKVPNDY* |
| Ga0137419_109565812 | 3300012925 | Vadose Zone Soil | KSYLWKRISELHKLMIDIQTVHAKLDSQDGNSREH* |
| Ga0137419_110786371 | 3300012925 | Vadose Zone Soil | NSELHKLMVDIQTAHAKLGSQDGNSREHMIKVPNDY* |
| Ga0182032_109133921 | 3300016357 | Soil | MFKLWGPQKSYLWKSISEVHKLMLDIQTIKDKLDSQDGNSREHRSRSQMIIK |
| Ga0193123_102571672 | 3300019039 | Marine | NKFNLNNYLFKFYTFRLRGPRKSYLWKRISELHKLMVDIQTVHAKLDSQDGNSREH |
| Ga0184569_1047451 | 3300019168 | Soil | LLGVQVEGTWKSYLWKRNSELHKLMVDIQTAHAKLGSQDGNSREH |
| Ga0184603_1096491 | 3300019192 | Soil | GSRKSYLWKRISELHKSMIDIQTVHAKLDSQDGNSREH |
| Ga0184648_11263821 | 3300019249 | Groundwater Sediment | RGPRKSYLWKRISELHKLMVDIQTIHAKLDSQDGNSREHRSRSQMIVK |
| Ga0184641_13018191 | 3300019254 | Groundwater Sediment | MRGLRKSYLWSRISELHKLIIDIQTALAKLRSQDGNSRE |
| Ga0181504_13065371 | 3300019258 | Peatland | LRGPRKSYLWKRISEVHKLMVDIQTAHAKLGSQDGNS |
| Ga0193727_10183641 | 3300019886 | Soil | MKEEFRLRGPRKSYLWKRISEVHKLMVDIQTAHAKLSSQDGNSREHEIKVPNDY |
| Ga0193716_12540331 | 3300020061 | Soil | AFRLRGPRKSYQWKRISEVHKLMVDIQTAHAKLGSQDGNSREHEIKVPNDY |
| Ga0180107_13457331 | 3300020064 | Groundwater Sediment | KSYLWKRISELHKLMIDIQTVHAKLDSQDGNSREH |
| Ga0179592_100024881 | 3300020199 | Vadose Zone Soil | TYQWKRISEVHKLMVDIQTAHAKLGSQDGNSREHEIKVPNDY |
| Ga0210403_105260301 | 3300020580 | Soil | MQIKLITNISYAFRLRGLRKSYLWKRISELHKLMVDIQTAHAKLGSQDGNSREH |
| Ga0210404_107519001 | 3300021088 | Soil | YQWKRISEVHKLMVDIQTAHAKLGSQDGNSREHEIKVPNDY |
| Ga0179583_10843091 | 3300021286 | Vadose Zone Soil | KRISEVHKLMVDIQTAHAKLGSQDGNSREHEIKLPNDY |
| Ga0179958_10478241 | 3300021315 | Vadose Zone Soil | FKFYSFRLRGSRKSYLWKRISELHKLMVDIQTIQAKLGSQDGNSR |
| Ga0210387_105791841 | 3300021405 | Soil | LRGPRKSYQWKRISEVHKLMVDIQTAHAKLGSRDGN |
| Ga0193709_10675291 | 3300021411 | Soil | FRLRGPRKSYQWKRISEVHKLMVDIQTAHAKLGSQDGNSREHRSRSQMIVK |
| Ga0222624_10537671 | 3300021951 | Groundwater Sediment | LRGPRKSYHWNPISKLHKLLVDIQTTNAKLSSQDGNSR |
| Ga0222624_12342281 | 3300021951 | Groundwater Sediment | SLRGPRKSYHWNPISKLHKLLVDIQTTNAKLSSQDGNSREHRSRSQMIIK |
| Ga0222624_13049001 | 3300021951 | Groundwater Sediment | SLRGPRKSYHWNPISKLHKLLVDIQTTNAKLSSQDGNSREH |
| Ga0242645_10002231 | 3300022501 | Soil | KSYLWKRNSELHKLMVDIQTAHAKLGSQDGNSREH |
| Ga0242648_10266281 | 3300022506 | Soil | RISEVHKLMVDIQTAHAKLGSQDGNSREHEIKVPNDY |
| Ga0222729_10004841 | 3300022507 | Soil | KSYLWKRISELHKLMVDIQTAHAKLGSQDGNSREH |
| Ga0242659_10469101 | 3300022522 | Soil | RGPRKSYQWKRISEVHKLMVDIQTAHAKLGSQDGNSREHESRSRMIIK |
| Ga0242664_10006601 | 3300022527 | Soil | LRGPRKSYQWKRISEVHKLMIDIQTAHAKLGSQDGNSREHEIKVPNDY |
| Ga0242658_10324661 | 3300022530 | Soil | LRGSRKSYLWKRISELHKLMIDIQTAHAKLGSQDGNSREH |
| Ga0242661_10043691 | 3300022717 | Soil | FRLRGSRKSYQWKRNSELHKLIIDIQTIHDKLNSQNGNSREHGSRSRMIIK |
| Ga0242665_100841691 | 3300022724 | Soil | FRLRGSRKSYLWKRISELHKSMIDIQTVHAKLDSQDGNSREH |
| Ga0242654_104140591 | 3300022726 | Soil | KKSYQWKRISEVHKLMVDIQTAHAKLGSQDGNSREHEIKVPNDY |
| Ga0233358_1004401 | 3300023014 | Soil | SRKSYQWKRISEVHKLMVDIQTAHAKLGSQDGNSREHEIKVPNDY |
| Ga0233344_10009622 | 3300023045 | Leaf Litter | MTEGMKKIEAFRLWGPRKSYQWKRNSEVHKLMVDIQTAHDKLGSQDGNSREHEIKVPNDY |
| Ga0233331_10001461 | 3300023052 | Leaf Litter | MAFRLRGPRKSYQWKRISELHKLMIDIQTAHAKLGSQDGNSREHEIKVPNDY |
| Ga0247784_11689771 | 3300023270 | Plant Litter | NNIIFYTFRLRGPRKSYLWKRISELHKLMIDIQTAHAKLGSQDGNSREHRSRSQMIVK |
| Ga0247537_1003271 | 3300023533 | Soil | FRLRGPRKSYLWKRISEVHKLMVDIQTAHAKLGSQDGNSREHRSRSQMIIK |
| Ga0247533_1036191 | 3300023675 | Soil | GPRKSYLWKRISEVHKLMVDIQTAHAKLGSQDGNSREHRSRSQMIIK |
| Ga0228704_1210371 | 3300023691 | Freshwater | MXKSYQWKVISEXHKLMVDIQTAHDKLGSQDGNSREHVSRSQMIIKXN |
| Ga0247672_10337351 | 3300024187 | Soil | IKNLNTFRLRGSRKSYLWKRISELHKLMIDIQTVHAKLDSQDGNSREH |
| Ga0247677_10689562 | 3300024245 | Soil | NEVFLICFRLRGPRKSYLWKRISELHKLMIDIQTAHAKLGSQDGNSREH |
| Ga0209154_10937051 | 3300026317 | Soil | WGPRKSYLWKRISELHKLLVDIQTVHAKLGSQDGNSREHRSRSQMIVK |
| Ga0208997_10099901 | 3300027181 | Forest Soil | EAFRLRGPRKSYQWKRISEVHKLMIDIQTAHAKLGSQDGNSREHEIKVPNDY |
| Ga0208999_10003283 | 3300027303 | Forest Soil | WKRISEVHKLMVDIQTAHAKLGSQDGNSREHEIKVPHDY |
| Ga0209421_11278081 | 3300027432 | Forest Soil | RLRGSRKSYQWKRISEVHKLMVDIQTAHAKLGSRDGNSREHEIKVPNDY |
| Ga0208985_10102041 | 3300027528 | Forest Soil | EFRLWGPRKSYQWKRNSEVHKLMVDIQTAHAKLGSQDGNSREHEIKVPNDY |
| Ga0208982_10680381 | 3300027574 | Forest Soil | RNSEVHKLMIDIQTAHAKLGSQDGNSREHEIKVPNDY |
| Ga0208988_11289601 | 3300027633 | Forest Soil | KSYQWKRNSEVHKLMVDIQTAHAKLGSQDGNSREHEIKVPNDY |
| Ga0209007_10365521 | 3300027652 | Forest Soil | RKSYQWKRISEVHKLMVDIQTAHAKLGSQDGNSREHEIKVPNDY |
| Ga0302047_101581161 | 3300028554 | Soil | RKSYQWKRISEVHKLVVKFQTAHDKLSSQDGNSREHN |
| Ga0247638_10003601 | 3300030551 | Soil | LRGPRKSYLWKRISELHKLMIDIQTAHAKLGSQDGNSREH |
| Ga0247639_10576071 | 3300030585 | Soil | LRGPRKSYQWKRISEVHKLMVDIQTAHAKLGSQDGNSREHESRSQMIIK |
| Ga0247626_10281231 | 3300030591 | Soil | FRLRGPRKSYLWKRISELHKLMVDIQTIHAKLDSQDGNSREHRSRSQMIVK |
| Ga0247612_11616021 | 3300030592 | Soil | WRRISELHKLIVDIQTTLAKLSSQDGNSREHRIKVPNDY |
| Ga0247617_10234791 | 3300030684 | Soil | FRLWGPRKSYLWKRISELHKLMLDIQTAHAKLGSQDGNSREH |
| Ga0247617_10542471 | 3300030684 | Soil | FRLRGLRKSYLWKRISELHKLMVDIQTIHAKLDSQDGNSREH |
| Ga0265459_121968241 | 3300030741 | Soil | SELHKLVVDIQTAHAKLGSQDGNSREHRIKVPNDY |
| Ga0265461_100275601 | 3300030743 | Soil | AFRLRGPRKSYLWKRISELHKLKIDIQTAHAKLGSQDGNSREH |
| Ga0265722_1008791 | 3300030761 | Soil | LRGPRKSYLWKRISEVHKLMVDIQTTHAKLGSQDGNSREHRSRSQMIIK |
| Ga0075402_101316921 | 3300030777 | Soil | MFRLRGSRKSYLWKRISELHKLMVDIQTTHAKLGSQDGNSREHRSRSQMIVK |
| Ga0075398_100527471 | 3300030778 | Soil | KSYLWKRISELHKLKIDIHPIYDKIDRGDGNSREH |
| Ga0102758_110408231 | 3300030784 | Soil | MRGPRKSYQWKRISEVHKLLVKFQTAHDKLSSQDGNSREHN |
| Ga0315871_1012651 | 3300030827 | Plant Litter | TFRLRGPRKSYQWKRISELHKLMIDIQTAHAKLGSQDGNSREHEIKVPNDY |
| Ga0315871_1013521 | 3300030827 | Plant Litter | LRGPRKSYQWKRISELHKLMIDIQTAHAKLGSQDGNSR |
| Ga0308205_10003481 | 3300030830 | Soil | MFRLRGPRKSYLWKRISELHKLMIDIQTAHAKLGSQDGNSREH |
| Ga0075389_100939601 | 3300030852 | Soil | KKIFLNAFRLRGSRKSYLWKRISELHKLMIDIQTVHAKLDSQDGNSREH |
| Ga0102759_10628951 | 3300030858 | Soil | MRGPRKSYLWKRISELHKLMVDIQTAQAKLGSQDGNSREH |
| Ga0265766_10220051 | 3300030863 | Soil | VQVEGTWKSYLWKRNSELHKLMVDIQTAHAKLGSQDGNSREHEIKVPNDY |
| Ga0265723_10069811 | 3300030872 | Soil | KSYQWKRISEVHKLMVDIQTAHAKLGSQDGNSREHEIKVPNDY |
| Ga0265764_1062411 | 3300030882 | Soil | LRGPRKSYQWKRISEVHKLMVDIQTAHAKLGSQDGN |
| Ga0265733_1002751 | 3300030887 | Soil | LIVHLYLLGVQVEGTWKSYLWKRISELHKLMVDIQTAHAKLGSQDGNSREH |
| Ga0075386_100999951 | 3300030916 | Soil | KKNFLNAFRLRGSRKSYLWKRISELHKLMIDIQTVHAKLDSQDGNSREH |
| Ga0075401_100823991 | 3300030935 | Soil | ISEVHKLMVDIQTAHAKLGSQDGNSREHEIKVPNDY |
| Ga0075401_101215461 | 3300030935 | Soil | LRGSRKSYLWKRISELHKLMIDIQTVHAKLDSQDGNSREH |
| Ga0138302_18572151 | 3300030937 | Soil | GSRKSYLWKRISELHKLMVDIQTAHAKLGSQDGNSREH |
| Ga0075376_100836871 | 3300030968 | Soil | LNAFRLRGSRKSYLWKRISELHKLMIDIQTVHAKLDSQDGNSREH |
| Ga0308196_10098531 | 3300030989 | Soil | RLRGPRKSYLWKRISELHKLMIDIQTAHAKLGSQDGNSREH |
| Ga0102756_14569161 | 3300031014 | Soil | KSYQWKRISEVHKLLVKFQTAHDKLSSQDGNSREHN |
| Ga0265744_1132911 | 3300031017 | Soil | RNSEVHKLMVDIQTAHAKLGSQDGNSREHEIKVPNDY |
| Ga0138301_12056611 | 3300031022 | Soil | RKSYQWKXNSELHKLMVDIQTAHAKLGSQDGNSREHMIKVPNDY |
| Ga0265724_1031931 | 3300031024 | Soil | SEVHKLMVDIQTAHAKLGSQDGNSREHEIKVPNDY |
| Ga0265747_1037631 | 3300031044 | Soil | RKSYLWKRISELHKLMVDIQTAHAKLGSQDGNSREH |
| Ga0074029_11176961 | 3300031051 | Soil | RGSRKSYLWKRISELHKLMVDIQTAHAKLGSQDGNSREH |
| Ga0170834_1064429791 | 3300031057 | Forest Soil | LYFKFYTFRLRGLRKSYLWKRISELHKLMVDIQTAQAKLGSQDGNSREH |
| Ga0308189_101057431 | 3300031058 | Soil | MQIKLITRPFYAFRLWGPRKSYLWKRISELHKLMVDIQTAHAKLGSQDGNSREH |
| Ga0315823_1071711 | 3300031105 | Plant Litter | FRLRGPRKSYQWKRISELHKLMIDIQTAHAKLGSQDGNSREHEIKVPNDY |
| Ga0102761_101866803 | 3300031411 | Soil | TWKSYLWKRISELRKLMVDIQTAHAKLGSQDGNSREH |
| Ga0308194_102737641 | 3300031421 | Soil | RKSYLWKRISELHKLMVDIQTIHAKLDSQDGNSREHRSRSQMIVK |
| Ga0170818_1008118431 | 3300031474 | Forest Soil | RLRGPRKSYLWKRISELHKLMVDIQTAPAKLGSQEGNSRKH |
| Ga0310114_1183782 | 3300031678 | Soil | GPRKSYLWKRISELHKLMVDIQTAHAKLGSQDGNSREH |
| Ga0310114_1237491 | 3300031678 | Soil | AFRLRGPRKSYLWKRISEVHKLMVDIQTAHAKLGSQEGNSREHRSRSQMIIK |
| Ga0310686_1036188181 | 3300031708 | Soil | AFRLRGPRKSYLWKRISEVHKLMVDIQTAHAKLGSQDGNSREHRSRSQMIIK |
| Ga0316044_1189581 | 3300031810 | Soil | PRKSYLWKRISELHKLMVDIQTTHAKLGSQDGNSREH |
| Ga0247532_1015931 | 3300031827 | Soil | GPRKSYQWKRISEVHKLMVDIQTAHAKLGSQDGNSREHEIKVPNDY |
| Ga0321339_11373611 | 3300032551 | Switchgrass Phyllosphere | VKILQWISNSELHKLMIDIQTIHAKLDSQDGNSREH |
| Ga0214501_12045391 | 3300032625 | Switchgrass Phyllosphere | WYCAFRLRGSSKSYQWNLNSEVHKLMLDIQTAHDKLSSQDENSREHALRSQMIIK |
| Ga0314753_10374301 | 3300032757 | Switchgrass Phyllosphere | RKSYQWKRISELHKLMIDIQTAHAKLGSQDGNSREHESRSQMIIK |
| Ga0314754_10479051 | 3300032760 | Switchgrass Phyllosphere | LVMRGPRKSYLWRTISELHKLIVDIQTTLAKLSSQDGNSREHEIKVPNDY |
| Ga0314745_11086571 | 3300032812 | Switchgrass Phyllosphere | FRLRGPRKSYLWKRISELHKLMVDIQTTHAKLGSQDGNSREH |
| Ga0314739_10566651 | 3300032913 | Switchgrass Phyllosphere | GPRKSYLWKRISELHKLMIDIQTVHAKLDSRDGNSREH |
| Ga0314749_10898081 | 3300032915 | Switchgrass Phyllosphere | GPRKSYQWKRISELHKLMIDIQTAHAKLGSQDGNSREHEIKVPNDY |
| Ga0314741_11009751 | 3300032934 | Switchgrass Phyllosphere | RKSYQWKRISELHKLMIDIQTAHAKLGSQDGNSREHEIKVPNDY |
| Ga0314738_10595981 | 3300032959 | Switchgrass Phyllosphere | SKSYQWNLNSEVHKLMVDIQTAHAKLGSRDGNSREH |
| Ga0314760_11222901 | 3300033530 | Switchgrass Phyllosphere | GSRKSYLWKRISELHKLIIDIQTAHAKLGSRDGNSREH |
| Ga0316215_10094611 | 3300033544 | Roots | LRGSRKSYQWKRISEVHKLMVDIQTAHAKLGSQDGN |
| Ga0314784_009569_1217_1333 | 3300034663 | Soil | GPRKSYLWKRISELHKLMVDIQTIHAKLDSQDGNSREH |
| ⦗Top⦘ |