


| Basic Information | |
|---|---|
| Family ID | F050382 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 145 |
| Average Sequence Length | 38 residues |
| Representative Sequence | NIQISNKIKSQLFGILNFGHCDLFGICVLLFEIF |
| Number of Associated Samples | 57 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.41 % |
| % of genes near scaffold ends (potentially truncated) | 96.55 % |
| % of genes from short scaffolds (< 2000 bps) | 92.41 % |
| Associated GOLD sequencing projects | 51 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (63.448 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment (20.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.379 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (42.759 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.61% β-sheet: 0.00% Coil/Unstructured: 48.39% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF00005 | ABC_tran | 3.45 |
| PF01568 | Molydop_binding | 2.07 |
| PF00293 | NUDIX | 2.07 |
| PF00155 | Aminotran_1_2 | 1.38 |
| PF03473 | MOSC | 1.38 |
| PF06808 | DctM | 1.38 |
| PF00158 | Sigma54_activat | 1.38 |
| PF00441 | Acyl-CoA_dh_1 | 1.38 |
| PF01040 | UbiA | 1.38 |
| PF09837 | DUF2064 | 1.38 |
| PF02769 | AIRS_C | 1.38 |
| PF02653 | BPD_transp_2 | 1.38 |
| PF00072 | Response_reg | 1.38 |
| PF00120 | Gln-synt_C | 1.38 |
| PF13458 | Peripla_BP_6 | 1.38 |
| PF06750 | DiS_P_DiS | 1.38 |
| PF03992 | ABM | 1.38 |
| PF00528 | BPD_transp_1 | 1.38 |
| PF04879 | Molybdop_Fe4S4 | 1.38 |
| PF00266 | Aminotran_5 | 1.38 |
| PF01925 | TauE | 0.69 |
| PF00873 | ACR_tran | 0.69 |
| PF00850 | Hist_deacetyl | 0.69 |
| PF00549 | Ligase_CoA | 0.69 |
| PF02775 | TPP_enzyme_C | 0.69 |
| PF01636 | APH | 0.69 |
| PF06684 | AA_synth | 0.69 |
| PF02371 | Transposase_20 | 0.69 |
| PF01937 | ARMT1-like_dom | 0.69 |
| PF00675 | Peptidase_M16 | 0.69 |
| PF07702 | UTRA | 0.69 |
| PF05036 | SPOR | 0.69 |
| PF01256 | Carb_kinase | 0.69 |
| PF00591 | Glycos_transf_3 | 0.69 |
| PF11059 | DUF2860 | 0.69 |
| PF13502 | AsmA_2 | 0.69 |
| PF00724 | Oxidored_FMN | 0.69 |
| PF00474 | SSF | 0.69 |
| PF02597 | ThiS | 0.69 |
| PF01121 | CoaE | 0.69 |
| PF01869 | BcrAD_BadFG | 0.69 |
| PF01891 | CbiM | 0.69 |
| PF08544 | GHMP_kinases_C | 0.69 |
| PF06245 | DUF1015 | 0.69 |
| PF10589 | NADH_4Fe-4S | 0.69 |
| PF00571 | CBS | 0.69 |
| PF02347 | GDC-P | 0.69 |
| PF08545 | ACP_syn_III | 0.69 |
| PF00027 | cNMP_binding | 0.69 |
| PF13507 | GATase_5 | 0.69 |
| PF01558 | POR | 0.69 |
| PF00378 | ECH_1 | 0.69 |
| PF11136 | DUF2889 | 0.69 |
| PF02782 | FGGY_C | 0.69 |
| PF02575 | YbaB_DNA_bd | 0.69 |
| PF01799 | Fer2_2 | 0.69 |
| PF08352 | oligo_HPY | 0.69 |
| PF01252 | Peptidase_A8 | 0.69 |
| PF12704 | MacB_PCD | 0.69 |
| PF01855 | POR_N | 0.69 |
| PF00198 | 2-oxoacid_dh | 0.69 |
| PF02515 | CoA_transf_3 | 0.69 |
| PF07977 | FabA | 0.69 |
| PF00226 | DnaJ | 0.69 |
| PF06421 | LepA_C | 0.69 |
| PF01168 | Ala_racemase_N | 0.69 |
| PF02737 | 3HCDH_N | 0.69 |
| PF13462 | Thioredoxin_4 | 0.69 |
| PF03129 | HGTP_anticodon | 0.69 |
| PF02754 | CCG | 0.69 |
| PF01472 | PUA | 0.69 |
| PF00588 | SpoU_methylase | 0.69 |
| PF04560 | RNA_pol_Rpb2_7 | 0.69 |
| PF02954 | HTH_8 | 0.69 |
| PF00180 | Iso_dh | 0.69 |
| PF01565 | FAD_binding_4 | 0.69 |
| PF00342 | PGI | 0.69 |
| PF13187 | Fer4_9 | 0.69 |
| PF14574 | RACo_C_ter | 0.69 |
| PF00276 | Ribosomal_L23 | 0.69 |
| PF17147 | PFOR_II | 0.69 |
| PF01208 | URO-D | 0.69 |
| PF03717 | PBP_dimer | 0.69 |
| PF01070 | FMN_dh | 0.69 |
| PF13185 | GAF_2 | 0.69 |
| PF00817 | IMS | 0.69 |
| PF01676 | Metalloenzyme | 0.69 |
| PF13534 | Fer4_17 | 0.69 |
| PF01475 | FUR | 0.69 |
| PF01478 | Peptidase_A24 | 0.69 |
| PF00383 | dCMP_cyt_deam_1 | 0.69 |
| PF01554 | MatE | 0.69 |
| PF13192 | Thioredoxin_3 | 0.69 |
| PF04015 | DUF362 | 0.69 |
| PF01261 | AP_endonuc_2 | 0.69 |
| PF08534 | Redoxin | 0.69 |
| PF06253 | MTTB | 0.69 |
| PF02738 | MoCoBD_1 | 0.69 |
| PF01699 | Na_Ca_ex | 0.69 |
| PF03330 | DPBB_1 | 0.69 |
| PF12844 | HTH_19 | 0.69 |
| PF01039 | Carboxyl_trans | 0.69 |
| PF13173 | AAA_14 | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG1989 | Prepilin signal peptidase PulO (type II secretory pathway) or related peptidase | Cell motility [N] | 4.14 |
| COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.38 |
| COG0597 | Lipoprotein signal peptidase | Cell wall/membrane/envelope biogenesis [M] | 1.38 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 1.38 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| COG0045 | Succinyl-CoA synthetase, beta subunit | Energy production and conversion [C] | 0.69 |
| COG0063 | NAD(P)H-hydrate repair enzyme Nnr, NAD(P)H-hydrate dehydratase domain | Nucleotide transport and metabolism [F] | 0.69 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.69 |
| COG0074 | Succinyl-CoA synthetase, alpha subunit | Energy production and conversion [C] | 0.69 |
| COG0085 | DNA-directed RNA polymerase, beta subunit/140 kD subunit | Transcription [K] | 0.69 |
| COG0089 | Ribosomal protein L23 | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| COG0124 | Histidyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| COG0166 | Glucose-6-phosphate isomerase | Carbohydrate transport and metabolism [G] | 0.69 |
| COG0219 | tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| COG0237 | Dephospho-CoA kinase | Coenzyme transport and metabolism [H] | 0.69 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.69 |
| COG0247 | Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcF | Energy production and conversion [C] | 0.69 |
| COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 0.69 |
| COG0310 | ABC-type Co2+ transport system, permease component | Inorganic ion transport and metabolism [P] | 0.69 |
| COG0351 | Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase | Coenzyme transport and metabolism [H] | 0.69 |
| COG0387 | Cation (Ca2+/Na+/K+)/H+ antiporter ChaA | Inorganic ion transport and metabolism [P] | 0.69 |
| COG0389 | Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair | Replication, recombination and repair [L] | 0.69 |
| COG0403 | Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain | Amino acid transport and metabolism [E] | 0.69 |
| COG0407 | Uroporphyrinogen-III decarboxylase HemE | Coenzyme transport and metabolism [H] | 0.69 |
| COG0423 | Glycyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| COG0441 | Threonyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| COG0442 | Prolyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| COG0481 | Translation elongation factor EF-4, membrane-bound GTPase | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| COG0508 | Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component | Energy production and conversion [C] | 0.69 |
| COG0530 | Ca2+/Na+ antiporter | Inorganic ion transport and metabolism [P] | 0.69 |
| COG0565 | tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| COG0674 | Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, alpha subunit | Energy production and conversion [C] | 0.69 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
| COG0718 | DNA-binding nucleoid-associated protein YbaB/EfbC | Transcription [K] | 0.69 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.69 |
| COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 0.69 |
| COG0764 | 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratase | Lipid transport and metabolism [I] | 0.69 |
| COG0768 | Cell division protein FtsI, peptidoglycan transpeptidase (Penicillin-binding protein 2) | Cell cycle control, cell division, chromosome partitioning [D] | 0.69 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 0.69 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.69 |
| COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 0.69 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
| COG1014 | Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, gamma subunit | Energy production and conversion [C] | 0.69 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.69 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.69 |
| COG1578 | House-cleaning carbohydrate phosphatase, DUF89 family | Defense mechanisms [V] | 0.69 |
| COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 0.69 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.69 |
| COG1902 | 2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family | Energy production and conversion [C] | 0.69 |
| COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 0.69 |
| COG2006 | Uncharacterized conserved protein, DUF362 family | Function unknown [S] | 0.69 |
| COG2048 | Heterodisulfide reductase, subunit B | Energy production and conversion [C] | 0.69 |
| COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 0.69 |
| COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 0.69 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.69 |
| COG4198 | Uncharacterized conserved protein, DUF1015 family | Function unknown [S] | 0.69 |
| COG4231 | TPP-dependent indolepyruvate ferredoxin oxidoreductase, alpha subunit | Energy production and conversion [C] | 0.69 |
| COG4706 | Predicted 3-hydroxylacyl-ACP dehydratase, HotDog domain | Lipid transport and metabolism [I] | 0.69 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 0.69 |
| COG5598 | Trimethylamine:corrinoid methyltransferase | Coenzyme transport and metabolism [H] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 64.14 % |
| Unclassified | root | N/A | 35.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000242|TDF_OR_ARG05_123mDRAFT_1092162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 580 | Open in IMG/M |
| 3300001270|BBAY91_10193147 | Not Available | 522 | Open in IMG/M |
| 3300004023|Ga0055441_10157853 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300005588|Ga0070728_10124800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 1508 | Open in IMG/M |
| 3300005588|Ga0070728_10353718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 786 | Open in IMG/M |
| 3300005588|Ga0070728_10621382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 558 | Open in IMG/M |
| 3300005588|Ga0070728_10660307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 538 | Open in IMG/M |
| 3300005589|Ga0070729_10369995 | Not Available | 797 | Open in IMG/M |
| 3300005589|Ga0070729_10526020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 645 | Open in IMG/M |
| 3300005590|Ga0070727_10436232 | Not Available | 731 | Open in IMG/M |
| 3300005590|Ga0070727_10804820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 527 | Open in IMG/M |
| 3300005600|Ga0070726_10150389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 1200 | Open in IMG/M |
| 3300005600|Ga0070726_10217206 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300005600|Ga0070726_10640087 | Not Available | 536 | Open in IMG/M |
| 3300005612|Ga0070723_10589010 | Not Available | 557 | Open in IMG/M |
| 3300005826|Ga0074477_1681879 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300006467|Ga0099972_10040566 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1470 | Open in IMG/M |
| 3300006467|Ga0099972_10262522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → unclassified Syntrophobacter → Syntrophobacter sp. SbD1 | 586 | Open in IMG/M |
| 3300006467|Ga0099972_10817210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 812 | Open in IMG/M |
| 3300006467|Ga0099972_10876226 | Not Available | 564 | Open in IMG/M |
| 3300006467|Ga0099972_11739422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 598 | Open in IMG/M |
| 3300006467|Ga0099972_12517223 | Not Available | 581 | Open in IMG/M |
| 3300006467|Ga0099972_12519895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 677 | Open in IMG/M |
| 3300006467|Ga0099972_13299637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 669 | Open in IMG/M |
| 3300006467|Ga0099972_13367245 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300006467|Ga0099972_13544405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300007102|Ga0102541_1437233 | All Organisms → cellular organisms → Bacteria | 1752 | Open in IMG/M |
| 3300009027|Ga0102957_1265441 | Not Available | 623 | Open in IMG/M |
| 3300009035|Ga0102958_1261106 | Not Available | 592 | Open in IMG/M |
| 3300009035|Ga0102958_1328600 | Not Available | 537 | Open in IMG/M |
| 3300009145|Ga0102961_1102859 | Not Available | 729 | Open in IMG/M |
| 3300009145|Ga0102961_1182733 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 578 | Open in IMG/M |
| 3300009145|Ga0102961_1263411 | Not Available | 503 | Open in IMG/M |
| 3300009788|Ga0114923_10824822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 705 | Open in IMG/M |
| 3300010392|Ga0118731_101966601 | All Organisms → cellular organisms → Bacteria | 4653 | Open in IMG/M |
| 3300010392|Ga0118731_104205068 | Not Available | 684 | Open in IMG/M |
| 3300010392|Ga0118731_104371484 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300010392|Ga0118731_104843781 | All Organisms → cellular organisms → Bacteria | 1991 | Open in IMG/M |
| 3300010392|Ga0118731_104846165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 717 | Open in IMG/M |
| 3300010392|Ga0118731_105285113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1350 | Open in IMG/M |
| 3300010392|Ga0118731_106147781 | Not Available | 530 | Open in IMG/M |
| 3300010392|Ga0118731_106149102 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300010392|Ga0118731_107450997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 562 | Open in IMG/M |
| 3300010392|Ga0118731_107652173 | Not Available | 713 | Open in IMG/M |
| 3300010392|Ga0118731_108347426 | Not Available | 909 | Open in IMG/M |
| 3300010392|Ga0118731_109809925 | Not Available | 699 | Open in IMG/M |
| 3300010392|Ga0118731_109921575 | Not Available | 548 | Open in IMG/M |
| 3300010392|Ga0118731_112051294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-13 | 1202 | Open in IMG/M |
| 3300010392|Ga0118731_112676672 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300010392|Ga0118731_113352834 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
| 3300010392|Ga0118731_114429822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium 4572_89 | 579 | Open in IMG/M |
| 3300010392|Ga0118731_114950381 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2045 | Open in IMG/M |
| 3300010430|Ga0118733_101549925 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300010430|Ga0118733_101900692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1184 | Open in IMG/M |
| 3300010430|Ga0118733_102186123 | Not Available | 1098 | Open in IMG/M |
| 3300010430|Ga0118733_102216016 | Not Available | 1090 | Open in IMG/M |
| 3300010430|Ga0118733_103291769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 880 | Open in IMG/M |
| 3300010430|Ga0118733_103714118 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300010430|Ga0118733_104046392 | Not Available | 787 | Open in IMG/M |
| 3300010430|Ga0118733_105837327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
| 3300010430|Ga0118733_106849785 | Not Available | 593 | Open in IMG/M |
| 3300010430|Ga0118733_108888366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 518 | Open in IMG/M |
| 3300010430|Ga0118733_109470941 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300011262|Ga0151668_1007443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 2665 | Open in IMG/M |
| 3300011262|Ga0151668_1007495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 963 | Open in IMG/M |
| 3300011262|Ga0151668_1239489 | Not Available | 691 | Open in IMG/M |
| 3300013101|Ga0164313_10671501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 855 | Open in IMG/M |
| 3300013101|Ga0164313_11246448 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300019711|Ga0193993_1053636 | Not Available | 530 | Open in IMG/M |
| 3300019714|Ga0193975_1042584 | Not Available | 565 | Open in IMG/M |
| 3300019714|Ga0193975_1054533 | Not Available | 522 | Open in IMG/M |
| 3300019722|Ga0193971_1065006 | Not Available | 507 | Open in IMG/M |
| 3300019730|Ga0194001_1067088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 513 | Open in IMG/M |
| 3300021859|Ga0210334_10176640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium ADurb.Bin002 | 1560 | Open in IMG/M |
| 3300022202|Ga0224498_10022874 | All Organisms → cellular organisms → Bacteria | 1709 | Open in IMG/M |
| 3300022202|Ga0224498_10119772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 765 | Open in IMG/M |
| 3300022202|Ga0224498_10147175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacterium → environmental samples → uncultured Desulfobacterium sp. | 690 | Open in IMG/M |
| 3300022206|Ga0224499_10157348 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300022206|Ga0224499_10163046 | Not Available | 759 | Open in IMG/M |
| 3300022206|Ga0224499_10172450 | Not Available | 737 | Open in IMG/M |
| 3300022206|Ga0224499_10289267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacterium → environmental samples → uncultured Desulfobacterium sp. | 554 | Open in IMG/M |
| 3300022206|Ga0224499_10329547 | Not Available | 515 | Open in IMG/M |
| 3300022217|Ga0224514_10047515 | All Organisms → cellular organisms → Bacteria | 1432 | Open in IMG/M |
| 3300022217|Ga0224514_10068640 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
| 3300022217|Ga0224514_10145879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfococcus → Desulfococcus multivorans | 830 | Open in IMG/M |
| 3300022217|Ga0224514_10183353 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300022217|Ga0224514_10397425 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300022218|Ga0224502_10394805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis associated proteobacterium Delta 3 | 537 | Open in IMG/M |
| 3300022308|Ga0224504_10058188 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis | 1542 | Open in IMG/M |
| 3300022308|Ga0224504_10270981 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300022308|Ga0224504_10312230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 652 | Open in IMG/M |
| 3300022391|Ga0210374_1003781 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 1973 | Open in IMG/M |
| (restricted) 3300024528|Ga0255045_10249831 | Not Available | 704 | Open in IMG/M |
| 3300025557|Ga0210141_1061915 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300025883|Ga0209456_10005717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5561 | Open in IMG/M |
| 3300025883|Ga0209456_10253734 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300025895|Ga0209567_10179615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 995 | Open in IMG/M |
| 3300025895|Ga0209567_10205496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 929 | Open in IMG/M |
| 3300025991|Ga0210128_1016180 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
| 3300027820|Ga0209578_10086121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1563 | Open in IMG/M |
| 3300027828|Ga0209692_10284343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 733 | Open in IMG/M |
| (restricted) 3300027837|Ga0255041_10192852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 715 | Open in IMG/M |
| 3300027845|Ga0209271_10258153 | Not Available | 701 | Open in IMG/M |
| 3300027917|Ga0209536_100636581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1326 | Open in IMG/M |
| 3300027917|Ga0209536_101913152 | Not Available | 713 | Open in IMG/M |
| 3300027978|Ga0209165_10010117 | All Organisms → cellular organisms → Bacteria | 3263 | Open in IMG/M |
| 3300027978|Ga0209165_10032239 | Not Available | 1863 | Open in IMG/M |
| 3300027980|Ga0209475_10160022 | Not Available | 1038 | Open in IMG/M |
| 3300028598|Ga0265306_10355926 | Not Available | 793 | Open in IMG/M |
| 3300028599|Ga0265309_11316312 | Not Available | 505 | Open in IMG/M |
| 3300031727|Ga0316576_11353635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 500 | Open in IMG/M |
| 3300032136|Ga0316201_10383389 | Not Available | 1212 | Open in IMG/M |
| 3300032136|Ga0316201_11679651 | Not Available | 524 | Open in IMG/M |
| 3300032231|Ga0316187_10907270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 648 | Open in IMG/M |
| 3300032251|Ga0316198_10144706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1395 | Open in IMG/M |
| 3300032258|Ga0316191_10217072 | Not Available | 1395 | Open in IMG/M |
| 3300032258|Ga0316191_10360970 | Not Available | 1057 | Open in IMG/M |
| 3300032258|Ga0316191_10479135 | Not Available | 905 | Open in IMG/M |
| 3300032258|Ga0316191_11425005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 500 | Open in IMG/M |
| 3300032259|Ga0316190_10367674 | Not Available | 979 | Open in IMG/M |
| 3300032259|Ga0316190_10513511 | Not Available | 806 | Open in IMG/M |
| 3300032259|Ga0316190_11155311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300032260|Ga0316192_10113676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 1896 | Open in IMG/M |
| 3300032260|Ga0316192_10216961 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1326 | Open in IMG/M |
| 3300032260|Ga0316192_10568178 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 769 | Open in IMG/M |
| 3300032262|Ga0316194_10040076 | All Organisms → cellular organisms → Bacteria | 3083 | Open in IMG/M |
| 3300032262|Ga0316194_10148238 | Not Available | 1509 | Open in IMG/M |
| 3300032262|Ga0316194_10401573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 866 | Open in IMG/M |
| 3300032262|Ga0316194_10507663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 760 | Open in IMG/M |
| 3300032262|Ga0316194_10929763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 547 | Open in IMG/M |
| 3300032272|Ga0316189_10096494 | All Organisms → cellular organisms → Bacteria | 2418 | Open in IMG/M |
| 3300032272|Ga0316189_10489888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 946 | Open in IMG/M |
| 3300032272|Ga0316189_10490750 | Not Available | 945 | Open in IMG/M |
| 3300032272|Ga0316189_10613762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae → Halodesulfovibrio → Halodesulfovibrio aestuarii | 832 | Open in IMG/M |
| 3300032272|Ga0316189_10681151 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300032272|Ga0316189_10819711 | Not Available | 707 | Open in IMG/M |
| 3300032276|Ga0316188_10292294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 839 | Open in IMG/M |
| 3300033429|Ga0316193_10093521 | Not Available | 2349 | Open in IMG/M |
| 3300033429|Ga0316193_10515542 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300033429|Ga0316193_10598786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 878 | Open in IMG/M |
| 3300033429|Ga0316193_10688566 | Not Available | 814 | Open in IMG/M |
| 3300033429|Ga0316193_11392289 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 20.00% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 19.31% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 14.48% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 12.41% |
| Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 7.59% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.45% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.76% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 2.07% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.07% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 2.07% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 1.38% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.38% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 1.38% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 1.38% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.69% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine | 0.69% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.69% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.69% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.69% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.69% |
| Marine Sediment | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Marine Sediment | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000242 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego: Site OR sample ARG 05_12.3m | Environmental | Open in IMG/M |
| 3300001270 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY91 | Host-Associated | Open in IMG/M |
| 3300004023 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordA_D2 | Environmental | Open in IMG/M |
| 3300005588 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1 | Environmental | Open in IMG/M |
| 3300005589 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 | Environmental | Open in IMG/M |
| 3300005590 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 | Environmental | Open in IMG/M |
| 3300005600 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 | Environmental | Open in IMG/M |
| 3300005612 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 | Environmental | Open in IMG/M |
| 3300005826 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.186_BBA | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300007102 | Combined Assembly of Marine Sediment Inoculum and Enrichments | Engineered | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009035 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D1_MG | Environmental | Open in IMG/M |
| 3300009145 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_D1_MG | Environmental | Open in IMG/M |
| 3300009788 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00157 metaG | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300011262 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_5, total | Environmental | Open in IMG/M |
| 3300013101 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cm | Environmental | Open in IMG/M |
| 3300019711 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLC_4-5_MG | Environmental | Open in IMG/M |
| 3300019714 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRT_2-3_MG | Environmental | Open in IMG/M |
| 3300019722 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_7-8_MG | Environmental | Open in IMG/M |
| 3300019730 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_7-8_MG | Environmental | Open in IMG/M |
| 3300021859 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.306 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022202 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022206 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022217 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022218 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13 | Environmental | Open in IMG/M |
| 3300022306 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022308 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022391 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.765 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300024528 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23 | Environmental | Open in IMG/M |
| 3300025557 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025883 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300025895 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025991 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027820 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027828 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027837 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3 | Environmental | Open in IMG/M |
| 3300027845 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027978 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027980 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028598 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160420 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300028599 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160524 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Host-Associated | Open in IMG/M |
| 3300032136 | Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow | Environmental | Open in IMG/M |
| 3300032231 | Coastal sediment microbial communities from Maine, United States - Cross River worm burrow 1 | Environmental | Open in IMG/M |
| 3300032251 | Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A anoxic | Environmental | Open in IMG/M |
| 3300032258 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cm | Environmental | Open in IMG/M |
| 3300032259 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 | Environmental | Open in IMG/M |
| 3300032260 | Coastal sediment microbial communities from Maine, United States - Merrow Island worm burrow | Environmental | Open in IMG/M |
| 3300032262 | Coastal sediment microbial communities from Maine, United States - Cross River sediment 1 | Environmental | Open in IMG/M |
| 3300032272 | Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrow | Environmental | Open in IMG/M |
| 3300032276 | Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1 | Environmental | Open in IMG/M |
| 3300033429 | Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TDF_OR_ARG05_123mDRAFT_10921621 | 3300000242 | Marine | LNSNIKNSNKIKNQLFGILNFGHCDLFGICDLLFEIFYC* |
| BBAY91_101931472 | 3300001270 | Macroalgal Surface | NYNIQISNEIKRQLFGFLNFCHCDLFGICDLLFEFFNC* |
| Ga0055441_101578531 | 3300004023 | Natural And Restored Wetlands | IPNYNIQISNKIKNQLFGFLNFNHCDLFGIWVLLFEISYLLTPET* |
| Ga0070728_101248002 | 3300005588 | Marine Sediment | STKLQINYNIQISNKIKNQLFGILNFGDCDLFGICILLFEIF* |
| Ga0070728_103537181 | 3300005588 | Marine Sediment | NIQISNKIKNQLFGILNFGHCDLFGICVLLFVNC* |
| Ga0070728_106213822 | 3300005588 | Marine Sediment | IQISNKIKNQLFGILNFGHCDLFGICDLLFEIFNC* |
| Ga0070728_106603072 | 3300005588 | Marine Sediment | LNIKISNKIKNQLFGILNFCHCDLFVICVLLFEIFYH* |
| Ga0070729_103699953 | 3300005589 | Marine Sediment | KFQISNKIKSQLFGILNFGHCYLFVICVLLFEIFITET* |
| Ga0070729_105260202 | 3300005589 | Marine Sediment | IQISNKIKNQLFGILNFGHCDLFGICVLSFEICSLLKPERRNL* |
| Ga0070727_104362321 | 3300005590 | Marine Sediment | NYNIQISNKIKNQLFGILNFGHCDLFGIWYLLFEIF* |
| Ga0070727_108048202 | 3300005590 | Marine Sediment | SNKIKSQLFGILNFGHCYLFVICVLLFEIFITET* |
| Ga0070726_101503891 | 3300005600 | Marine Sediment | NIQISNKIKSQLFGILNFSHCDLFGIYDLLFVIF* |
| Ga0070726_102172062 | 3300005600 | Marine Sediment | NSNIQISNKIKSQLFGILNFGHCDLFSICDLVFVIF* |
| Ga0070726_106400871 | 3300005600 | Marine Sediment | NKFQISNKIKSQLFGILNFGHCYLFVICVLLFEIFITET* |
| Ga0070723_105890102 | 3300005612 | Marine Sediment | YNIQISNKIKNQLFGILNFGHCDLFGICVLLFEIF* |
| Ga0074477_16818792 | 3300005826 | Sediment (Intertidal) | KHQISNNIKILLFGILNFGHCDLFGSCDLLFEIY* |
| Ga0099972_100405663 | 3300006467 | Marine | QKIPNYNIQISNKIKRQLFGILNFDHCDLFGICDLLFEIF* |
| Ga0099972_102625222 | 3300006467 | Marine | IQISNKIKSQLFGILNFGHCDLFGICDLLFEIYYY* |
| Ga0099972_108172101 | 3300006467 | Marine | IPNYNIQISNKIKRQLFGLRRAQPCRILNFGYCDLFGICVLLFEIFYY* |
| Ga0099972_108762262 | 3300006467 | Marine | NYNIQISNKIKNQLFGILNFGHCDLFGVCVLLFDIF* |
| Ga0099972_117394222 | 3300006467 | Marine | SNIQISNKIKNQLFGILNFGHCDLFVICVLLFEIF* |
| Ga0099972_125172231 | 3300006467 | Marine | DNFQISNKIKSQLFGILNFGHCDLFGTCVLLFENF* |
| Ga0099972_125198951 | 3300006467 | Marine | YNIEISNKIKSQLFGILNFGHYDLFGIWYLLFEIFNC* |
| Ga0099972_132996371 | 3300006467 | Marine | IPNCNIQISNKIKRQLFGILNFVHCDLFDICVLLFEIC* |
| Ga0099972_133672451 | 3300006467 | Marine | IPNLNIKISNKIKSQLFGILNFGHCDLFGICVLLFEFFYY* |
| Ga0099972_135444051 | 3300006467 | Marine | IPNYNIQISNKIKRQLFGILNLGHCDLFGICDLLFEIF* |
| Ga0102541_14372331 | 3300007102 | Marine Sediment | NIQISNKIKSQLFGILNFGHYDLFGICVLLFEIVNC* |
| Ga0102957_12654411 | 3300009027 | Pond Water | IPNNNIQISNKVKRKLFGISNFGHCGLFVICDLKFFKC* |
| Ga0102958_12611061 | 3300009035 | Soil | IQILNKIKNHLFGLLKFGHCDLFGHCVLLLEIFYLLNPDT* |
| Ga0102958_13286001 | 3300009035 | Soil | NYNIQISNKIKRQLFGILNLGHCDLFGIYDLLFEIF* |
| Ga0102961_11028592 | 3300009145 | Soil | NSQISNKIKSQVFGILNFGHCDLFGICYLVLEIF* |
| Ga0102961_11827331 | 3300009145 | Soil | KLQVPNFNIQISNKIKNQLFRILNFGYCDLCFDI* |
| Ga0102961_12634112 | 3300009145 | Soil | PNYNIQISNKIKRQLFGILNLGHCDLFGICYLLFENF* |
| Ga0114923_108248222 | 3300009788 | Deep Subsurface | NIQISNKIKSQVFGILNFSHCDLFDICDLLFEIFYLLKPEH* |
| Ga0118731_1019666011 | 3300010392 | Marine | NIQISNKIKSQLFGILNFGHCDLFGICDLLFEIFYY* |
| Ga0118731_1042050682 | 3300010392 | Marine | FQISNKIKSQLFGILNFGHCYLFVICVLLFEIFITET* |
| Ga0118731_1043714841 | 3300010392 | Marine | NIQISNKIKSQLFGILNFGHCDLFGICVLLFEILITDT* |
| Ga0118731_1048437811 | 3300010392 | Marine | NYNIQISNNIKSQVFGILNFSHCDLFGICDLLFEIF* |
| Ga0118731_1048461652 | 3300010392 | Marine | NYNIQISNKIESQLFGILNFGHCDLFGICDLLFEIFIADT* |
| Ga0118731_1052851132 | 3300010392 | Marine | IPNLNIKISTKFKRQLFGILNFGHCDLFGICDLLFEFFF* |
| Ga0118731_1061477812 | 3300010392 | Marine | NIKISNKIKSQLFGILNFGHCDLIGICVLLFEIFYY* |
| Ga0118731_1061491021 | 3300010392 | Marine | NIKISNKIKSQLFGILNFGHCVLFGICVLLFEIFYY* |
| Ga0118731_1074509971 | 3300010392 | Marine | ISNKIKSQLFGILNFGHCDLFGICVLLFEISITDI* |
| Ga0118731_1076521731 | 3300010392 | Marine | NYNIQISNMIKGQLFGILNLGHCDLFGICDLLFEIFNC* |
| Ga0118731_1083474261 | 3300010392 | Marine | QITNKFQISNKIKSQLFGILNFGHCYLFVICDLLFEIFYY* |
| Ga0118731_1098099251 | 3300010392 | Marine | QISNKTNRQLFGILNFGHCDLFGICVLLFETLIAET* |
| Ga0118731_1099215751 | 3300010392 | Marine | IQISNKIKRQLFGILNFGHCYLFVICVLLFEIFITET* |
| Ga0118731_1120512942 | 3300010392 | Marine | YNVQISNKIKRQSFEILNLGHCGLFGICYLLFEIFKY* |
| Ga0118731_1126766721 | 3300010392 | Marine | IQISNKIKSQLFGILNFGHCDLFGICVLLFEIFLLLKPER* |
| Ga0118731_1133528341 | 3300010392 | Marine | NTNIQISNKIKSQSFGILNFGHCDLFGFCDLLFEIFYY* |
| Ga0118731_1144298221 | 3300010392 | Marine | NIQISNKIKRQLFEILNLGHCDLIGICDLLFEIFNC* |
| Ga0118731_1149503812 | 3300010392 | Marine | VFDKFQISNKIKSQLFGILNFGHCDLFGICILLFEIFYY* |
| Ga0118733_1015499251 | 3300010430 | Marine Sediment | ISNKIKSQLFGILNFGHCYLFVICVLLFEIFITET* |
| Ga0118733_1019006921 | 3300010430 | Marine Sediment | SNKIKRQLFGILNFGHCDLFGICVLLFEIFLLLKPEH* |
| Ga0118733_1021861231 | 3300010430 | Marine Sediment | NIQISNKIKSQLFGVLNFGHCDLFGICDLIFEIFYY* |
| Ga0118733_1022160161 | 3300010430 | Marine Sediment | NIQISNKIKSQLFGIFNFGHCDLFGICDLLFEIFLIAET* |
| Ga0118733_1032917692 | 3300010430 | Marine Sediment | NIQISNKIKNQLFGILKFGHCYLFVICVLLFEIF* |
| Ga0118733_1037141181 | 3300010430 | Marine Sediment | QISNKIKRQLFGILKFGHCDLFGICDLLFEIFLLKPEH* |
| Ga0118733_1040463921 | 3300010430 | Marine Sediment | NIQISNKIKSQLFGILNFGHCDLFGICVLLFEIF* |
| Ga0118733_1058373271 | 3300010430 | Marine Sediment | YNIQISNKIKRQLFGILNLGHCDLFGICDLLFEIY* |
| Ga0118733_1068497851 | 3300010430 | Marine Sediment | QISNKIKRQLFGILNFSHCDLFGICDLLFEIFYY* |
| Ga0118733_1088883662 | 3300010430 | Marine Sediment | NIQISNKIKNQLFGILNFGHCDLFGICVLLFEIF* |
| Ga0118733_1094709411 | 3300010430 | Marine Sediment | IPNSNIQISNKIKNQLFGILNFSHCDLFGICVLLFEIFVHYPLSR* |
| Ga0151668_10074431 | 3300011262 | Marine | NIQISIKINHQLFGILNFGHCNLFGICDLLFEIY* |
| Ga0151668_10074952 | 3300011262 | Marine | LQAPNYKLIPNFNIQISSKIKRQLFGILNFGFCDLLFEIFLIA* |
| Ga0151668_12394892 | 3300011262 | Marine | TNLNIQISNKFKNQLFGILSFSHCDLFGHCDLLFGIF* |
| Ga0164313_106715012 | 3300013101 | Marine Sediment | HQNTNNFQISKKIKTQLFGILNFGHCDLFGICELLFDIF* |
| Ga0164313_112464481 | 3300013101 | Marine Sediment | INEECPNYNIQISNKIKRQLFGILNFGHCDLFDICDLLFEIF* |
| Ga0193993_10536361 | 3300019711 | Sediment | KLRSYTNPSNKIERQLFGILNFGHCDLFGFCDLWFDIFSY |
| Ga0193975_10425842 | 3300019714 | Sediment | KSQIRSKSQLFGILNFGHCDLFGICDLLFEILIVKT |
| Ga0193975_10545331 | 3300019714 | Sediment | NLDIKNPKSQAPNYKKIPNLNIKISNKIKSQLFGICVLLFEIFYY |
| Ga0193971_10650061 | 3300019722 | Sediment | INYKNSETLNYNIQISNKIKSQLFEILNFGHCDLFGICVLLLAIF |
| Ga0194001_10670882 | 3300019730 | Sediment | LNIQISNNVKSQLFGIFNFGHCDLFGICFLLFEIFCY |
| Ga0210334_101766402 | 3300021859 | Estuarine | QNLNIQITNKIKSQLFGILNLVHCDLFGICVLLFEIFYY |
| Ga0224498_100228742 | 3300022202 | Sediment | INYNIQISNKIKSELFGILNFGHCYLFVICVLLFEIFITET |
| Ga0224498_101197722 | 3300022202 | Sediment | NYNIQISNKIKRQLFGILDFGHYNLFGICVLLFGIFFIAET |
| Ga0224498_101471752 | 3300022202 | Sediment | QIYNIQISNKIKSQLFGILNFGHCDLFGFWFLLFEIFLLLKS |
| Ga0224499_101573481 | 3300022206 | Sediment | ITNYKHQITNKIKNQLFGILNFGHCDLFGICDLLFEIF |
| Ga0224499_101630461 | 3300022206 | Sediment | YNIQILNKIKNQLFVILNFGHCDLFGICVLLFEIFIDT |
| Ga0224499_101724501 | 3300022206 | Sediment | STKLQINSNIQISNKIKRQLFRILNFGHCDLFGICGLLFEIFNC |
| Ga0224499_102892671 | 3300022206 | Sediment | IYNIQISNKIKSQLFGILNFGHCDLFGFWFLLFEIFLLLKS |
| Ga0224499_103295471 | 3300022206 | Sediment | MSNKTKSQLFGILNFGHCDLFGIWYLLFVIFLIAETP |
| Ga0224514_100475151 | 3300022217 | Sediment | LIALNYNIQISNKIKSQLFEILNFGHCDLFGICVLLFAIF |
| Ga0224514_100686403 | 3300022217 | Sediment | NYNIQISNKLKRQLFGILNFGHCDFFGVCVLLFEIF |
| Ga0224514_101458791 | 3300022217 | Sediment | NIKISNKIKRQLFGILNFGHCDLFVICDLLFEIFYY |
| Ga0224514_101833531 | 3300022217 | Sediment | HNIQISNKIKRQLFGILNLGHCDLFGICDLFFEIF |
| Ga0224514_103974252 | 3300022217 | Sediment | TNYNIQISNKIERQLFGILNFGDCDLFVICVLLFEIF |
| Ga0224502_103948052 | 3300022218 | Sediment | DQINSNIQISNKIKRQLFGILNLGHCDLFGICDLFFEIFYCT |
| Ga0224509_100588393 | 3300022306 | Sediment | GNNKLQAPNYNIQISNKIKRQLFGILNFGHCDLFGICFLKFFNC |
| Ga0224504_100581881 | 3300022308 | Sediment | NYNIQISNKIKRQLFGILNFGYCDLFGICYLLFEIC |
| Ga0224504_102709811 | 3300022308 | Sediment | LQAANYKKIPNCNVQISNKIKNQLFGILNFGHCDLFGICVLLIEIF |
| Ga0224504_103122301 | 3300022308 | Sediment | NLNIKISNKIISQLFAILNFGHCDLFGICFLLFEIF |
| Ga0210374_10037814 | 3300022391 | Estuarine | EITNRKHQISNNIKILLFGILNFGHCDLSGICDLLFEIY |
| (restricted) Ga0255046_103244041 | 3300024519 | Seawater | YKHQITNKFQISNKIKRQLFGILKFGICDLLFEIFLLKPEH |
| (restricted) Ga0255045_102498311 | 3300024528 | Seawater | MGSCEKSTNKNDKDRFGILNFGHCDLFVLCDLLFGI |
| Ga0210141_10619151 | 3300025557 | Natural And Restored Wetlands | QISNKIKNQLFRILNFGYCDLFVLCVLIFEFLFAET |
| Ga0209456_100057175 | 3300025883 | Pelagic Marine | QLFGILNFGHCDLFGICVLLFEILITETRIRRRNT |
| Ga0209456_102537341 | 3300025883 | Pelagic Marine | NNKLQINYSIQISSKINSQLFGILNFGHCDLPFDLAQGG |
| Ga0209567_101796151 | 3300025895 | Pelagic Marine | PFTNPSNKFKSQLFGILNFGHCDLFGICDLLFEIF |
| Ga0209567_102054962 | 3300025895 | Pelagic Marine | LQAPNYNIQISNKIKRQLFGILNLGHCDLFGICDLLFEIFNC |
| Ga0210128_10161802 | 3300025991 | Natural And Restored Wetlands | ETLNYNIQISNKIKSQLFEILNFGHCDLFGICVLLFAIF |
| Ga0209578_100861213 | 3300027820 | Marine Sediment | IQISNKIKRQLFGILNFGHCDLFGFCDLLFEIFYC |
| Ga0209692_102843431 | 3300027828 | Marine Sediment | NSNIQISNKIKNQSFGVLNFGHCDLFVICVLLFEISLIDET |
| (restricted) Ga0255041_101928521 | 3300027837 | Seawater | SNKIKSQIFGILNFGHCDLFGICFLLFGIFLTEIRT |
| Ga0209271_102581531 | 3300027845 | Marine Sediment | PNYNIQISNKIKNQLFGIWNFGHCDLFGICVLLFEIF |
| Ga0209536_1006365813 | 3300027917 | Marine Sediment | PNDNIQISNKIKNQSFGISNFGLCDLFFICDLEFFTET |
| Ga0209536_1019131522 | 3300027917 | Marine Sediment | DSIQISNKIKSQLFGILNFGHCDLLGICDLLFEIFYY |
| Ga0209165_100101174 | 3300027978 | Marine Sediment | PNYNIQISNKIKIQLFGILNFGHCDLFGICILLFENFYC |
| Ga0209165_100322391 | 3300027978 | Marine Sediment | IQISNKIKRQLFGILNFSHCDLFGIWYLFFEVFYY |
| Ga0209475_101600221 | 3300027980 | Marine Sediment | INSNSQISNKINSHMFGIFFNFGHCYLFGIYVLLFEILNY |
| Ga0265306_103559261 | 3300028598 | Sediment | NIQISNKTNRHLFGILNFGHCDLFGICVLLFETLIAET |
| Ga0265309_113163121 | 3300028599 | Sediment | NYNIQISNKIKNQLFGILNFGHCDLFGICGLLFEIF |
| Ga0316576_113536351 | 3300031727 | Rhizosphere | NIQIRQWRVKRKRFGILNFGNCNLFGICDLLFEIFCY |
| Ga0316201_103833892 | 3300032136 | Worm Burrow | IPNLNIKISNKVKSQLFGILNFGHCDLFGIYVLLFEIF |
| Ga0316201_116796512 | 3300032136 | Worm Burrow | APNENIQILNKIKRQLFGFLNFGHCDLLFEISYLLKPEH |
| Ga0316187_109072702 | 3300032231 | Worm Burrow | NIQISIKVKSQLFGILNFGHCDLFGICVLLFEILIAEI |
| Ga0316198_101447061 | 3300032251 | Sediment | ISNKIKSQLFGILNFGHCDLFGICDLLFEISITDI |
| Ga0316191_102170721 | 3300032258 | Worm Burrow | PNPNIQISNKIKRQLFGILNFGHCDLFGICVLLFEILITDT |
| Ga0316191_103609701 | 3300032258 | Worm Burrow | IQISNKIKNQLFGILNFGHCDLFGICVLLFEIFVYYPLSR |
| Ga0316191_104791351 | 3300032258 | Worm Burrow | SLYTNKIKHQLFGILNFGHCKLFGVYDLLFEIFYY |
| Ga0316191_114250051 | 3300032258 | Worm Burrow | QYFKYPNKIKRRLFRILNFGHCDLFGICNLLFEIF |
| Ga0316190_103676741 | 3300032259 | Worm Burrow | YNIQISNKIKNQLFGILNFGNCDLFDICDLLFGIFNY |
| Ga0316190_105135111 | 3300032259 | Worm Burrow | YKHQITNKIKRQLFGILNFGHCDLFGICDLLFEIF |
| Ga0316190_111553111 | 3300032259 | Worm Burrow | RTIKSQISNKIKNQLLGILNFGHCDLFGICVLLFEIY |
| Ga0316192_101136761 | 3300032260 | Worm Burrow | ENYKKIPNCNVQISNKIKNQLFGILNFGHCDLFGICVLLIEIF |
| Ga0316192_102169611 | 3300032260 | Worm Burrow | TTIQISNKIKRRLFGILNFGHCDLFGFCDLLFEIFYY |
| Ga0316192_102970962 | 3300032260 | Worm Burrow | MQNPAELLLNPKLQEPNYNIQISNKIKNQLFAILNFGHCDLFGICDLLFEIFNC |
| Ga0316192_105681783 | 3300032260 | Worm Burrow | NYNIQISNKIKSQLFGILNFGHYDLLLEFFLLKPEH |
| Ga0316194_100400761 | 3300032262 | Sediment | NHNIQISNKIKSQLFGILNFGHCDLFGICDLLFFITET |
| Ga0316194_101482382 | 3300032262 | Sediment | MFNIQISNKVKRQLFGILNFGHCDLFIICVLLFEIL |
| Ga0316194_104015731 | 3300032262 | Sediment | QAPNYNIQISNKTKSQLFGILNFDHCDLFGICVLLFEIF |
| Ga0316194_105076631 | 3300032262 | Sediment | YNIQNSNNIKNQLFGILNFGHCDLFGICVLLFEIF |
| Ga0316194_109297631 | 3300032262 | Sediment | PNYNIQISNKIKRRLFGILNLGHCDLFDICDLLFEIF |
| Ga0316189_100964944 | 3300032272 | Worm Burrow | QISNKLKRQLFGILNFGHCDLFGICVLLFEFFITWLTIIT |
| Ga0316189_104898881 | 3300032272 | Worm Burrow | ITSTKLQINSNIQISNKIKSQLFGILNLGHCDLLFEIF |
| Ga0316189_104907501 | 3300032272 | Worm Burrow | YNIQTRQRRIKSQLFGILNFGHFDLFDICDLLFEIFYY |
| Ga0316189_106137623 | 3300032272 | Worm Burrow | QIKNKIKNQLFGILNFGNCDLFGICVLLFKNFFNC |
| Ga0316189_106811511 | 3300032272 | Worm Burrow | IPNCNIQISNKIKRQLFGILNLGHCDLFGIYDLLFEIF |
| Ga0316189_108197112 | 3300032272 | Worm Burrow | IANYNIQISNKIKRQLFGILNFGHCDLFGICFLVFEIF |
| Ga0316188_102922942 | 3300032276 | Worm Burrow | NDNIQISNNFKRQLFGILNFGHCDLFGICVLLFEIFDY |
| Ga0316193_100935213 | 3300033429 | Sediment | IPNYNIQISNKIKRQLFGILSFGYCDLFVICVLLFEIF |
| Ga0316193_105155422 | 3300033429 | Sediment | IQISNKVKIQLFRILNFSHCDLFGICDLLFEIFIADT |
| Ga0316193_105987861 | 3300033429 | Sediment | PNYNIQISNKDKSQLFGILNFGHCDLFVICVLLFEIF |
| Ga0316193_106885661 | 3300033429 | Sediment | YNIQISNKIKRQLFVILNFGFCDFFGICYLKFFNY |
| Ga0316193_113922891 | 3300033429 | Sediment | NNNLQAPNYNIQISNRIKNPLFGILNFGHCDLFGICDLLFEIF |
| ⦗Top⦘ |