| Basic Information | |
|---|---|
| Family ID | F050363 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 145 |
| Average Sequence Length | 42 residues |
| Representative Sequence | QTGGVGMDGISASPYRMGYQLINRVRGLIQPYSSPNSLVG |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 94.48 % |
| % of genes from short scaffolds (< 2000 bps) | 84.14 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.345 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (30.345 % of family members) |
| Environment Ontology (ENVO) | Unclassified (75.862 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (75.172 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.00% β-sheet: 0.00% Coil/Unstructured: 75.00% | Feature Viewer |