


| Basic Information | |
|---|---|
| Family ID | F050307 |
| Family Type | Metagenome |
| Number of Sequences | 145 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MNKDLKKRIKEFNKIKYPNDNSKRIIIASLKGTVTTAPKNK |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 11.03 % |
| % of genes near scaffold ends (potentially truncated) | 26.21 % |
| % of genes from short scaffolds (< 2000 bps) | 68.97 % |
| Associated GOLD sequencing projects | 72 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (57.931 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (35.862 % of family members) |
| Environment Ontology (ENVO) | Unclassified (91.034 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (93.793 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.29% β-sheet: 0.00% Coil/Unstructured: 79.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF01068 | DNA_ligase_A_M | 12.41 |
| PF04545 | Sigma70_r4 | 10.34 |
| PF04404 | ERF | 10.34 |
| PF08279 | HTH_11 | 6.90 |
| PF14743 | DNA_ligase_OB_2 | 4.14 |
| PF12684 | DUF3799 | 2.07 |
| PF04542 | Sigma70_r2 | 2.07 |
| PF02562 | PhoH | 1.38 |
| PF13662 | Toprim_4 | 1.38 |
| PF13481 | AAA_25 | 0.69 |
| PF03819 | MazG | 0.69 |
| PF00303 | Thymidylat_synt | 0.69 |
| PF03013 | Pyr_excise | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 12.41 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 12.41 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 2.07 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 2.07 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 2.07 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 2.07 |
| COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 1.38 |
| COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 1.38 |
| COG0207 | Thymidylate synthase | Nucleotide transport and metabolism [F] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 57.93 % |
| All Organisms | root | All Organisms | 42.07 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 35.86% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 14.48% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 12.41% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 12.41% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 6.90% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 4.14% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 3.45% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 2.76% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.38% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 1.38% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.69% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.69% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.69% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.69% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.69% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.69% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001963 | Marine microbial communities from Nags Head, North Carolina, USA - GS013 | Environmental | Open in IMG/M |
| 3300002482 | Marine viral communities from the Pacific Ocean - ETNP_2_30 | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005346 | Saline sediment microbial community from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
| 3300005613 | Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300008219 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 | Environmental | Open in IMG/M |
| 3300008220 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 | Environmental | Open in IMG/M |
| 3300009413 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 | Environmental | Open in IMG/M |
| 3300009414 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009602 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 | Environmental | Open in IMG/M |
| 3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020246 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX555934-ERR599105) | Environmental | Open in IMG/M |
| 3300020365 | Marine microbial communities from Tara Oceans - TARA_B100000034 (ERX555943-ERR599143) | Environmental | Open in IMG/M |
| 3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
| 3300020403 | Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
| 3300022067 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3) | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025251 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 (SPAdes) | Environmental | Open in IMG/M |
| 3300025264 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025270 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025830 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 (SPAdes) | Environmental | Open in IMG/M |
| 3300025879 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300029309 | Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440 | Environmental | Open in IMG/M |
| 3300029318 | Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289 | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100590541 | 3300000101 | Marine | YMSEDLKKRIKDFNKIKYPNDNSKRIIVATLKAKTVTQGSKVKE* |
| DelMOSum2011_100873832 | 3300000115 | Marine | MNKKLKNRIKEFNKIKYPNDNSKRIIIASLKPAVTAASKNK* |
| DelMOSum2011_101946042 | 3300000115 | Marine | MKKDLKKRIRQFNEIKFAKDKSKRIIIASLKPTGTVTTAPKNN* |
| DelMOSpr2010_101610872 | 3300000116 | Marine | MKKDLKQRIKEFNKIKYPNDNSKRIIIASLKGTVTTAPKNK* |
| DelMOWin2010_100366814 | 3300000117 | Marine | MNKKLKQRIKEFNKIKYPNDESNRIIIASLRPVGTVTTAPNNK* |
| DelMOWin2010_102318682 | 3300000117 | Marine | MNKKLKQRVKEFNKIKFPNDDSKRIIIASLKGTVTTAPNNK* |
| BBAY92_100239591 | 3300000947 | Macroalgal Surface | RYMNNDLKKRIKEFNKIKYPKDNSKRIIIASLKPTVTQGYKDTE* |
| JGI24003J15210_100036117 | 3300001460 | Marine | MNKDLKQRVKEFNEIKYPNDNSKRIIVASLKGTVTTAPKNK* |
| JGI24003J15210_100062103 | 3300001460 | Marine | MSEDLKKRIKDFNKIKYPNDNSKRIIVATLKAKTVTQGSKDKE* |
| GOS2229_10274844 | 3300001963 | Marine | KQRIKEFNKIKYPNDNSKRIIIASLKPAVTAASKNK* |
| JGI25127J35165_100074214 | 3300002482 | Marine | MNKDLKKRIKEFNKIKYPNDNSKRIIIASLKPAVTAAPKNK* |
| JGI25127J35165_10436162 | 3300002482 | Marine | MNKKLKQRIEEFNKIKYPNDSSKRIIIASLKGTVTTAPKI* |
| Ga0055584_1006528791 | 3300004097 | Pelagic Marine | MNKKLKQRVKEFNKIKFPNDDSKRIIIASLKGTVTIAPNNK* |
| Ga0073579_11912968 | 3300005239 | Marine | MSEDLKKRIKDFNKIKYPNDNSKRIIVATLKAKTVTQGSKVKE* |
| Ga0074242_113316822 | 3300005346 | Saline Water And Sediment | MSDKLKQRIKEFNKIKNPNDNSKRIIVASLKTVTKGYTRD* |
| Ga0074649_10078737 | 3300005613 | Saline Water And Sediment | MSDKLKQRIKEFNKIKYPNDNSKRIIVASLKTVTKGYTRD* |
| Ga0075466_10239292 | 3300006029 | Aqueous | MNNDLKKRIKEFNKIKYPNDNSKRIIVASLKGTVTTAPKNIE* |
| Ga0098038_10049957 | 3300006735 | Marine | MNKKLKQRIKEFNKIKYPNNKSNRIIIASLKPVGPVTTAPKNK* |
| Ga0098038_10103268 | 3300006735 | Marine | MKKDLKQRIKEFNKIKYPNDNSRRIIIASLKPAVTAASKNK* |
| Ga0098038_10163242 | 3300006735 | Marine | MNKKLKQRIKEFNKIKYPNDNSKRIIIASLKGTVTTAPNNK* |
| Ga0098038_10200694 | 3300006735 | Marine | MKNDLKKRIDEFNKIKYPNDNSKRIIIATLKTKTVTQGYKVKE* |
| Ga0098038_10336141 | 3300006735 | Marine | MNKKLKQRIKEFNKIKYPNDKSNRIIIASLKPVGTVTTAPNNK* |
| Ga0098038_11088563 | 3300006735 | Marine | MKKDLKQRIKEFNKIKYPNDNSKRIIIASLKPAVTAASKDK* |
| Ga0098038_11700402 | 3300006735 | Marine | MNKKLKQRIKEFNKIKYPNDNSKRIIIASLKPAVTAASKDK* |
| Ga0098037_10409624 | 3300006737 | Marine | LKQRIKEFNKIKYPNDKSNRIIIASLKPVGTVTTAPNNK* |
| Ga0098037_10816362 | 3300006737 | Marine | MNKRLKQRIKEFNKIKYPNDKSNRIIIASLKGTVTTALKNK* |
| Ga0098042_10060521 | 3300006749 | Marine | IHYLKQYVIMNKKLKNRIKEFNKIKYPNDKSNRIIIASLKPAVTQASNNK* |
| Ga0098042_10266804 | 3300006749 | Marine | DLKKRIEEFNKIKYPNDNSKRIIIASLKGTVTTAPKDK* |
| Ga0098042_10741542 | 3300006749 | Marine | MNKKLENRIKEFNKIKYPNDKSNRIIIASLKPAGTVT |
| Ga0098042_11379382 | 3300006749 | Marine | MNKKLKQRIKEFNKIKYPNDKSNRIIIASLKPVGTVTTAPKNK* |
| Ga0098048_10362432 | 3300006752 | Marine | MNKDLKKRIKEFNKIKYPNDNSKRIIVASLKGTVTTALNNK* |
| Ga0098048_10583622 | 3300006752 | Marine | MSNDLKQRIDEFNKIKYPNDNSKRIIVATLKAKTVTKGSKVKE* |
| Ga0070749_101667593 | 3300006802 | Aqueous | MSNDLKKLIKKFNKIKYNDDNSKRIIVASLKPTVTQGCKDKE* |
| Ga0070754_100194958 | 3300006810 | Aqueous | MNSDLKKRIKEFNKIKYPNDNSKRIIVASLKGTVTIASKNK* |
| Ga0070746_101170022 | 3300006919 | Aqueous | MSEDLKKRIKDFNKIKYPNNNSKRIIVATLKAKTVTQGSKVKE* |
| Ga0070748_10469902 | 3300006920 | Aqueous | MNKDLKQRIKEFNKIKYPNDNSKRIIVASLSVNTKRKWGVTTAPKDKE* |
| Ga0070748_12246002 | 3300006920 | Aqueous | MNKKLKQRIKEFNKIKYPNDESNRIIIASLRPVGTVTTA |
| Ga0098060_10342442 | 3300006921 | Marine | MNKDLKKRIKEFNKIKYPKDNSKRIIVASLKGTVTTAHNNK* |
| Ga0098060_10548484 | 3300006921 | Marine | MKKDLKKRIRQFNEIKFANDKSKRIIIASLKPMRTVTTASKNN |
| Ga0098060_10729031 | 3300006921 | Marine | MNKDLKKRIKEFNKIKYPKDNSKRIIVASLKGTVTTAPKYK* |
| Ga0098041_10342661 | 3300006928 | Marine | LKKRIEEFNKIKYPNDNSKRIIVASLKGTVTTAPKDK* |
| Ga0098036_10391382 | 3300006929 | Marine | MNKKLKQRIKEFNKIKYPNDESNRIIIASLKPLGTVTTAPKDK* |
| Ga0098036_11252742 | 3300006929 | Marine | MNKRLKQRIKEFNKIKYPNDKSNRIIIASLKPVGTVTTAPNNK* |
| Ga0099847_10119699 | 3300007540 | Aqueous | MNNDLKKRIKEFNKIKYLKDDSKRIIVASLKGTVRTAPKNIVYQANGT |
| Ga0099847_10819751 | 3300007540 | Aqueous | NNDLKKRIKEFNKIKYPNDNSKRIIVASLKGTVTTAPKNIE* |
| Ga0099847_12477491 | 3300007540 | Aqueous | DLKKRIKEFNKIKYPNDNSKRIIVASLKGTVTIASKNK* |
| Ga0114905_10139151 | 3300008219 | Deep Ocean | LKQRIKEFNKIKYPNDNSKRIIIASLKPAVTAASKNK* |
| Ga0114910_11227912 | 3300008220 | Deep Ocean | MSDKLINRINQFNEIKYPNNNSKRIIVASLKTVTQGYKDTE* |
| Ga0114902_10615011 | 3300009413 | Deep Ocean | KKDLKQRIKEFNKIKYPNDNSKRIIIASLKPAVTAASKNK* |
| Ga0114909_10644001 | 3300009414 | Deep Ocean | MSDKLFKLINQFNQIKYPKDNSKRIIVASLKTVTQRYKDTV* |
| Ga0114932_103163822 | 3300009481 | Deep Subsurface | MNKKLKQRIKEFNKIKYPNDKSNRIIIAKLKPIGTVTTAPNNK* |
| Ga0114932_105654012 | 3300009481 | Deep Subsurface | MNKNLKKRIKEFNKIKYPNDNSKRIIIASLKGTVTTAPKNNE* |
| Ga0114900_10734561 | 3300009602 | Deep Ocean | MNKDLKKRIKEFNKIKYPKDNSKRIIVASLKGTVTTA |
| Ga0114906_12042422 | 3300009605 | Deep Ocean | MKKDLKQRIKEFNKIKYPNSNEKRIIIASLKPAVTAAS |
| Ga0115012_102685942 | 3300009790 | Marine | MKKCLKKRISEFNKIKYPNDNSKRIIIASLKPAVTAASKDK* |
| Ga0115012_120181482 | 3300009790 | Marine | MNKKLKQRIKEFNKIKYPNDKSNRIIIAKLKPIGTVTTAPN |
| Ga0098043_10058541 | 3300010148 | Marine | RIKEFNKIKYPNDKSNRIIIASLKPAVTQASNNK* |
| Ga0098043_10108174 | 3300010148 | Marine | MSDKLKQTIKVFNKIKTKDNSKRIIIATLSPTVTQGSK* |
| Ga0098043_11053442 | 3300010148 | Marine | MNKKLKNRIKEFNKIKYPNDKSNRIIIASLKPAVTQASNNK* |
| Ga0160423_101264073 | 3300012920 | Surface Seawater | MNKRLKQRIKEFNKIKYPNDKSNRIIIARLKPVGTVTTAPNNK* |
| Ga0160423_101367134 | 3300012920 | Surface Seawater | MRDQLKQRIKEFNKIKFNSNNEKRIIVASLKPSNGGVTTAPNNK* |
| Ga0160423_107599242 | 3300012920 | Surface Seawater | MNKKLKQRIKEFNKIKYPNNKSNRIIIASLKPTGTVTTAPSNK* |
| Ga0163110_100773986 | 3300012928 | Surface Seawater | MNKRLKQRIKEFNEIKYPNDKSNRIIIASLKPVGTVTTAPKNK |
| Ga0163110_102713052 | 3300012928 | Surface Seawater | MNKRLKQRIKEFNKIKYPNDKLNRIIIARLKPVGTVTTAPNNK* |
| Ga0181369_11068862 | 3300017708 | Marine | MKKDLKQRIKEFNKIKYPNDNSKRIIIASLKGTVTTAPNNK |
| Ga0181387_10019231 | 3300017709 | Seawater | KPKHYMKEDLKQRIKEFNKIKYPNDNSKRIIIASLKPAVTAAPKNK |
| Ga0181387_10257952 | 3300017709 | Seawater | MSEDLKKRIKQFNKIKFANDKGKRIIIASLKPAVTQASKNK |
| Ga0181387_10459951 | 3300017709 | Seawater | MKEDLKQRIKEFNKIKYPNDNSKRIIIASLKPAVT |
| Ga0181387_11192211 | 3300017709 | Seawater | KPKHYMKEDLKQRIKEFNKIKYPNDNSKRIIIASLKPAVTVAPKNKK |
| Ga0181383_10521422 | 3300017720 | Seawater | MKKDLKQRIKEFNKIKFPNDNSKRIIIASLKPAVTAASKNK |
| Ga0181383_11407432 | 3300017720 | Seawater | MNKKLKNRIKKFNKIKYPNDNSKRIIIASLKPAVTAASKDK |
| Ga0181419_10053582 | 3300017728 | Seawater | MSNDLKKRIKQFNKIKFANDKGKRIIIASLKPTVTQASKNK |
| Ga0181417_10419483 | 3300017730 | Seawater | MKKDLKQRIKEFNKIKYPNDNSKRIIIASLKPAVTAAPKNK |
| Ga0181426_10015754 | 3300017733 | Seawater | MNKKLKNRIKEFNKIKYPNDNSNRIIIASLKPAVTAASKNK |
| Ga0181397_10378504 | 3300017744 | Seawater | MKEDLKQRIKEFNKIKYPNDNSKRIIVATLKAKTVTQGSKVKE |
| Ga0181392_10290254 | 3300017749 | Seawater | MKKDLKQRIKEFNKIKFPNDNSKRIIIASLKPAVTAAPKNK |
| Ga0181405_10467713 | 3300017750 | Seawater | MSDDLKKRIKDFNKIKYPNDNSKRIIVATLKAKTVTQGSKDKE |
| Ga0181420_10536312 | 3300017757 | Seawater | MSNDLKKRIKQFNKIKFANDKGKRIIIASLKPAVTAAPKNK |
| Ga0181413_10068319 | 3300017765 | Seawater | MNKKLKNRIKEFNKIKYPNDNSKRIIIASLNPAVTAASKNK |
| Ga0187221_10504163 | 3300017769 | Seawater | MNKKLKQRIKEFNKIKYPNDNSKRIIIASLKGTVTTAP |
| Ga0187217_11488422 | 3300017770 | Seawater | MKKDLKQRIKEFNKIKYPNDNSKRIIVASLKGTVTTAPKNKE |
| Ga0181386_10992343 | 3300017773 | Seawater | KTRIKQFNEIKYPNDNSKRIIVATLKAKTVTQGSKDKE |
| Ga0181386_11262111 | 3300017773 | Seawater | LKQRIKEFNKIKYPNDNSKRIIIASLKPAVTAASKNK |
| Ga0181553_101213033 | 3300018416 | Salt Marsh | MNNDLKKRIKEFNKIKYPKDNSKRIIIASLKPTVTQGYKDTE |
| Ga0211707_10569352 | 3300020246 | Marine | MNKRLKQRIKEFNKIKYPNGKSNRIIIASLKPVGTVTTAPNNK |
| Ga0211506_11932571 | 3300020365 | Marine | DIHYLKQYVIMNKKLKQRIKEFNKIKYPNDKSNRIIIAKLKPTGTVTTAPNNK |
| Ga0211677_101765812 | 3300020385 | Marine | MSEDLKQRIKDFNKIKYPNDNSKRIIVATLKAKTVTQGSKVKE |
| Ga0211532_100819792 | 3300020403 | Marine | MNKDLKKRIKEFNKIKYPNDDSKRIIIASLKGTVTTAPKNK |
| Ga0211532_102003691 | 3300020403 | Marine | IPKHYMNKDLKKRIKEFNKIKYPNDNSKRIIIASLKGTVTTAPKNK |
| Ga0211708_100441392 | 3300020436 | Marine | MNKRLKQRIKEFNKIKYPNDKSNRIIIASLKPVGTVTTAPNNK |
| Ga0211708_103733882 | 3300020436 | Marine | MNKRLKQRIKEFNKIKYPNDKSNRIIIAKLKPMGTVTTAPKNK |
| Ga0211576_100784944 | 3300020438 | Marine | MSEDLKKRIKDFNKIKYPNDNSKRIIVATLKAKTVTQGYKVKE |
| Ga0211676_100548806 | 3300020463 | Marine | MNKKLKNRIKEFNKIKYPNDKSNRIIIASLKPAVTAAPKNK |
| Ga0211577_105117562 | 3300020469 | Marine | MKKDLKQRIKEFNKIKYPNDNSKRIIIASLKPAVTAASKNK |
| Ga0213865_100142252 | 3300021373 | Seawater | MSNDLKKRIKQFNKIKFANDKGKRIIIASLRPAVTQASKNK |
| Ga0212023_10309101 | 3300022061 | Aqueous | MNNDLKKRIKEFNKIKYPNDNSKRIIVASLKGTVTTAPKNIE |
| Ga0212023_10483052 | 3300022061 | Aqueous | MSEDLKKRIKDFNKIKYPNDNSKRIIVATLKAKTVTQGSKVKE |
| Ga0196895_10009554 | 3300022067 | Aqueous | MNKKLKNRIKEFNKIKYPNDNSKRIIIASLKPAVTAASKNK |
| Ga0196889_10032931 | 3300022072 | Aqueous | RKRIRLIMNKKLKQRVKEFNKIKFPNDDSKRIIIASLKGTVTIAPNNK |
| Ga0224906_10053743 | 3300022074 | Seawater | MSDKLKQTIKVFNKIKTKDNSKRIIVATLSPTVTQGSK |
| Ga0224906_10183473 | 3300022074 | Seawater | MNKKLKNRIKEFNKIKYPNDESNRIIIASLKPAVTAASKNK |
| Ga0224906_10308271 | 3300022074 | Seawater | MNKKLKNRIKEFNKIKYPNDKSNRIIIASLKPAVTAASKNK |
| Ga0196891_10013053 | 3300022183 | Aqueous | MSNDLKKLIKKFNKIKYNDDNSKRIIVASLKPTVTQGCKDKE |
| Ga0196891_10383982 | 3300022183 | Aqueous | MNKKLKQRIKEFNKIKYPNDESNRIIIASLRPVGTVTTAPNNK |
| (restricted) Ga0233432_101316962 | 3300023109 | Seawater | MNNDLKKRIKEFNKIKYPNDNSKRIIVASLKGTVTTAPKNK |
| Ga0209992_100397185 | 3300024344 | Deep Subsurface | MSDKLKQRIKEFNKIKYPNDNSKRIIVASLKTVTKGYTRD |
| Ga0209992_102649942 | 3300024344 | Deep Subsurface | MNRDLKKRIKEFNKIKYPNDKSNRIIIAKLKPMGTVTTAPNNK |
| Ga0208667_10311992 | 3300025070 | Marine | MSNDLKQRIDEFNKIKYPNDNSKRIIVATLKAKTVTKGSKVKE |
| Ga0208157_10074104 | 3300025086 | Marine | MKNDLKKRIDEFNKIKYPNDNSKRIIIATLKTKTVTQGYKVKE |
| Ga0208157_10099398 | 3300025086 | Marine | MKKDLKQRIKEFNKIKYPNDNSKRIIIASLKPAVTAASKDK |
| Ga0208157_10143372 | 3300025086 | Marine | MNKKLKQRIKEFNKIKYPNNKSNRIIIASLKPVGPVTTAPKNK |
| Ga0208157_10389863 | 3300025086 | Marine | MNKKLKQRIKEFNKIKYPNDNSKRIIIASLKPAVTAASKDK |
| Ga0208157_10540471 | 3300025086 | Marine | LKQRIKEFNKIKYPNDNSKRIIIASLKGTVTTAPNNK |
| Ga0208159_10047378 | 3300025101 | Marine | IMNKKLKNRIKEFNKIKYPNDKSNRIIIASLKPAVTQASNNK |
| Ga0208159_10214001 | 3300025101 | Marine | TLKPKLCMNKDLKKRIEEFNKIKYPNDNSKRIIVASLKGTVTTAPKDK |
| Ga0208159_10567921 | 3300025101 | Marine | MNKKLENRIKEFNKIKYPNDKSNRIIIASLKPAVTAAPKNK |
| Ga0208159_10634632 | 3300025101 | Marine | MNKKLKQRIKEFNKIKYPNDKSNRIIIASLKPVGTVTTAPKNK |
| Ga0208666_10329132 | 3300025102 | Marine | MNKKLKQRIKEFNKIKYPNDNSKRIIIASLKGTVTTAPNNK |
| Ga0208666_10335702 | 3300025102 | Marine | MNKRLKQRIKEFNKIKYPNDKSNRIIIAKLKPVGTVTTAPKNK |
| Ga0208158_10458451 | 3300025110 | Marine | MNKDLKKRIEEFNKIKYPNDNSKRIIIASLKGTVTTAPKDK |
| Ga0208158_10633433 | 3300025110 | Marine | KLCMNKDLKKRIEEFNKIKYPNDNSKRIIIASLKGTVTTAPNNK |
| Ga0208158_11097231 | 3300025110 | Marine | MNKKLKQRIKEFNKIKYPNDESNRIIIASLKPLGTVTTAPKDK |
| Ga0209535_100228714 | 3300025120 | Marine | MNKDLKQRVKEFNEIKYPNDNSKRIIVASLKGTVTTAPKNK |
| Ga0209348_100011839 | 3300025127 | Marine | LQTLIPKNYMNKDLKKRIKEFNKIKYPNDNSKRIIIASLKPAVTAAPKNK |
| Ga0209348_10118926 | 3300025127 | Marine | MNKKLKQRIEEFNKIKYPNDSSKRIIIASLKGTVTTAPKI |
| Ga0208919_10283202 | 3300025128 | Marine | MNKKLKQRIKEFNKIKYPNDKSNRIIIASLKPVGTVTTAPNNK |
| Ga0208919_11961782 | 3300025128 | Marine | LKQRSYMNKDLKKRIKEFNKIKYPKDNSKRIIVASLKGTVTTAHNNK |
| Ga0209232_10363542 | 3300025132 | Marine | MKEDLKQRIKEFNKIKYPNDNSKRIIIASLKPAVTAAPKNK |
| Ga0208182_10757461 | 3300025251 | Deep Ocean | QRIKEFNKIKYPNDNSKRIIIASLKPAVTAASKNK |
| Ga0208029_10980102 | 3300025264 | Deep Ocean | KKDLKQRIKEFNKIKYPNDNSKRIIIASLKPAVTAASKNK |
| Ga0208813_10875912 | 3300025270 | Deep Ocean | MSDKLINRINQFNEIKYPNNNSKRIIVASLKTVTQGYKDTE |
| Ga0208813_11226871 | 3300025270 | Deep Ocean | QYVIMSDKLKQRIKEFNKIKYPNDNSKRIIVASLKTVTKGYTRD |
| Ga0208643_10911952 | 3300025645 | Aqueous | MNKKLKQRVKEFNKIKFPNDDSKRIIIASLKGTVTTAPNNK |
| Ga0208134_10419581 | 3300025652 | Aqueous | MKKDLKQRIKDFNKIKYPNDNSKRIIVATLKAKTVTQGSKVKE |
| Ga0209832_10658173 | 3300025830 | Pelagic Marine | RHYMSEDLKKRIKDFNKIKYPNDNSKRIIVATLKAKTVTQGSKVKE |
| Ga0209555_101792862 | 3300025879 | Marine | MSNDLKKRIKQFNKIKFANDKGKRIIIASLKPAVTQASKNK |
| Ga0183683_10082145 | 3300029309 | Marine | MNKDLKKRIKEFNKIKYPNDNSKRIIIASLKGTVTTAPKNK |
| Ga0185543_10082943 | 3300029318 | Marine | MNKKLKNRINKFNKIKYPNDNSKRIIIASLKPAVTAASKNK |
| Ga0183748_100217915 | 3300029319 | Marine | MNKKLKNRIKEFNKIKYPNNSSKRIIIASLSVKPKRRWGVTTAPKNKE |
| Ga0183748_10449711 | 3300029319 | Marine | IMNKKLKQRIKEFNKIKYPNDKSNRIIIAKLKPMGTVTTAPKNKE |
| Ga0183757_10022988 | 3300029787 | Marine | MNKKLKNRIKEFNKIKYPNGNSKRIIIASLKPAVTAASKNK |
| Ga0183757_100310210 | 3300029787 | Marine | MKKDLKQRIKEFNKIKYPNSNEKRIIIASLKPAVTAASKNK |
| Ga0183757_10048668 | 3300029787 | Marine | MNNDLKKRIKEFNKIKYPNDSSKRIIVASLKGTVTTAPKNKE |
| Ga0183757_10059476 | 3300029787 | Marine | MNKKLKNRIKEFNKIKYSNDNSNRIIIASLKPAVTAASKNK |
| Ga0348336_017997_1573_1698 | 3300034375 | Aqueous | MNSDLKKRIKEFNKIKYPNDNSKRIIVASLKGTVTIASKNK |
| ⦗Top⦘ |