


| Basic Information | |
|---|---|
| Family ID | F050294 |
| Family Type | Metagenome |
| Number of Sequences | 145 |
| Average Sequence Length | 40 residues |
| Representative Sequence | GNKMKHVPALYLATAMALQGMTKQELEALKLRIEEKRV |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 4.26 % |
| % of genes near scaffold ends (potentially truncated) | 86.90 % |
| % of genes from short scaffolds (< 2000 bps) | 80.00 % |
| Associated GOLD sequencing projects | 75 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (64.138 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (66.207 % of family members) |
| Environment Ontology (ENVO) | Unclassified (60.690 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (66.207 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 37.88% β-sheet: 0.00% Coil/Unstructured: 62.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF07238 | PilZ | 6.21 |
| PF00313 | CSD | 5.52 |
| PF12844 | HTH_19 | 4.14 |
| PF01381 | HTH_3 | 3.45 |
| PF14022 | DUF4238 | 1.38 |
| PF04015 | DUF362 | 1.38 |
| PF02517 | Rce1-like | 1.38 |
| PF00990 | GGDEF | 1.38 |
| PF13083 | KH_4 | 1.38 |
| PF00072 | Response_reg | 0.69 |
| PF13338 | AbiEi_4 | 0.69 |
| PF07689 | KaiB | 0.69 |
| PF00534 | Glycos_transf_1 | 0.69 |
| PF07228 | SpoIIE | 0.69 |
| PF04542 | Sigma70_r2 | 0.69 |
| PF16576 | HlyD_D23 | 0.69 |
| PF13545 | HTH_Crp_2 | 0.69 |
| PF00011 | HSP20 | 0.69 |
| PF04986 | Y2_Tnp | 0.69 |
| PF02371 | Transposase_20 | 0.69 |
| PF01740 | STAS | 0.69 |
| PF02310 | B12-binding | 0.69 |
| PF01022 | HTH_5 | 0.69 |
| PF13683 | rve_3 | 0.69 |
| PF12704 | MacB_PCD | 0.69 |
| PF04326 | AlbA_2 | 0.69 |
| PF00202 | Aminotran_3 | 0.69 |
| PF04366 | Ysc84 | 0.69 |
| PF13538 | UvrD_C_2 | 0.69 |
| PF01527 | HTH_Tnp_1 | 0.69 |
| PF13419 | HAD_2 | 0.69 |
| PF13490 | zf-HC2 | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 1.38 |
| COG2006 | Uncharacterized conserved protein, DUF362 family | Function unknown [S] | 1.38 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 1.38 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.69 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.69 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.69 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.69 |
| COG2865 | Predicted transcriptional regulator, contains HTH domain | Transcription [K] | 0.69 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.69 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.69 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 64.14 % |
| Unclassified | root | N/A | 35.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002562|JGI25382J37095_10136209 | Not Available | 818 | Open in IMG/M |
| 3300002914|JGI25617J43924_10024706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2104 | Open in IMG/M |
| 3300002914|JGI25617J43924_10116761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 943 | Open in IMG/M |
| 3300002917|JGI25616J43925_10405251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300005568|Ga0066703_10406214 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300005569|Ga0066705_10487344 | Not Available | 772 | Open in IMG/M |
| 3300005598|Ga0066706_10128899 | All Organisms → cellular organisms → Bacteria | 1877 | Open in IMG/M |
| 3300006032|Ga0066696_10443526 | Not Available | 850 | Open in IMG/M |
| 3300006755|Ga0079222_10226169 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1152 | Open in IMG/M |
| 3300006796|Ga0066665_10059116 | All Organisms → cellular organisms → Bacteria | 2675 | Open in IMG/M |
| 3300006796|Ga0066665_11264540 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300006893|Ga0073928_10322574 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300007255|Ga0099791_10240640 | Not Available | 857 | Open in IMG/M |
| 3300007255|Ga0099791_10577770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300007258|Ga0099793_10589842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300007265|Ga0099794_10008449 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4277 | Open in IMG/M |
| 3300007265|Ga0099794_10114306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1354 | Open in IMG/M |
| 3300007265|Ga0099794_10466606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_17 | 663 | Open in IMG/M |
| 3300009012|Ga0066710_100837139 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1413 | Open in IMG/M |
| 3300009012|Ga0066710_102974925 | Not Available | 661 | Open in IMG/M |
| 3300009038|Ga0099829_10055523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2950 | Open in IMG/M |
| 3300009038|Ga0099829_10977064 | Not Available | 702 | Open in IMG/M |
| 3300009038|Ga0099829_11637429 | Not Available | 531 | Open in IMG/M |
| 3300009088|Ga0099830_10436864 | Not Available | 1062 | Open in IMG/M |
| 3300009088|Ga0099830_10686246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 843 | Open in IMG/M |
| 3300009088|Ga0099830_10908286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300009088|Ga0099830_11568294 | Not Available | 549 | Open in IMG/M |
| 3300009089|Ga0099828_10037352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3957 | Open in IMG/M |
| 3300009089|Ga0099828_10167557 | Not Available | 1950 | Open in IMG/M |
| 3300009089|Ga0099828_10253510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Candidatus Melainabacteria → unclassified Candidatus Melainabacteria → Candidatus Melainabacteria bacterium RIFCSPHIGHO2_02_FULL_34_12 | 1578 | Open in IMG/M |
| 3300009089|Ga0099828_10577727 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1012 | Open in IMG/M |
| 3300009089|Ga0099828_10578775 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1011 | Open in IMG/M |
| 3300009089|Ga0099828_10763807 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
| 3300009089|Ga0099828_10968870 | Not Available | 758 | Open in IMG/M |
| 3300009089|Ga0099828_11128742 | Not Available | 696 | Open in IMG/M |
| 3300009089|Ga0099828_11377411 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300009143|Ga0099792_10446152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 800 | Open in IMG/M |
| 3300010326|Ga0134065_10173209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 767 | Open in IMG/M |
| 3300011269|Ga0137392_10217673 | All Organisms → cellular organisms → Bacteria | 1566 | Open in IMG/M |
| 3300011269|Ga0137392_10369601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1189 | Open in IMG/M |
| 3300011269|Ga0137392_11378879 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300011270|Ga0137391_10026014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4872 | Open in IMG/M |
| 3300011270|Ga0137391_10054547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3413 | Open in IMG/M |
| 3300011270|Ga0137391_10505340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1023 | Open in IMG/M |
| 3300012096|Ga0137389_10097233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2333 | Open in IMG/M |
| 3300012096|Ga0137389_10113584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2172 | Open in IMG/M |
| 3300012096|Ga0137389_10197637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1673 | Open in IMG/M |
| 3300012096|Ga0137389_10812948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_17 | 803 | Open in IMG/M |
| 3300012189|Ga0137388_10021752 | All Organisms → cellular organisms → Bacteria | 4839 | Open in IMG/M |
| 3300012189|Ga0137388_10090912 | Not Available | 2599 | Open in IMG/M |
| 3300012189|Ga0137388_10599896 | Not Available | 1024 | Open in IMG/M |
| 3300012189|Ga0137388_11792778 | Not Available | 546 | Open in IMG/M |
| 3300012198|Ga0137364_11022306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300012200|Ga0137382_10000279 | All Organisms → cellular organisms → Bacteria | 20950 | Open in IMG/M |
| 3300012202|Ga0137363_11561984 | Not Available | 552 | Open in IMG/M |
| 3300012202|Ga0137363_11785751 | Not Available | 508 | Open in IMG/M |
| 3300012205|Ga0137362_10190406 | Not Available | 1764 | Open in IMG/M |
| 3300012205|Ga0137362_11356809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Tahibacter → Tahibacter aquaticus | 597 | Open in IMG/M |
| 3300012207|Ga0137381_10920531 | Not Available | 756 | Open in IMG/M |
| 3300012210|Ga0137378_10638654 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 975 | Open in IMG/M |
| 3300012211|Ga0137377_11394116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300012359|Ga0137385_10569337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 954 | Open in IMG/M |
| 3300012359|Ga0137385_11570166 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300012361|Ga0137360_10074513 | Not Available | 2524 | Open in IMG/M |
| 3300012361|Ga0137360_10166433 | All Organisms → cellular organisms → Bacteria | 1762 | Open in IMG/M |
| 3300012361|Ga0137360_10818994 | Not Available | 801 | Open in IMG/M |
| 3300012361|Ga0137360_11282834 | Not Available | 633 | Open in IMG/M |
| 3300012361|Ga0137360_11452219 | Not Available | 590 | Open in IMG/M |
| 3300012362|Ga0137361_10620694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 990 | Open in IMG/M |
| 3300012363|Ga0137390_10246839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1771 | Open in IMG/M |
| 3300012363|Ga0137390_10316632 | All Organisms → cellular organisms → Bacteria | 1542 | Open in IMG/M |
| 3300012363|Ga0137390_11274316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
| 3300012582|Ga0137358_10664757 | Not Available | 697 | Open in IMG/M |
| 3300012683|Ga0137398_10460296 | Not Available | 871 | Open in IMG/M |
| 3300012683|Ga0137398_11212100 | Not Available | 515 | Open in IMG/M |
| 3300012683|Ga0137398_11236797 | Not Available | 508 | Open in IMG/M |
| 3300012685|Ga0137397_11160954 | Not Available | 559 | Open in IMG/M |
| 3300012918|Ga0137396_10289354 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
| 3300012918|Ga0137396_10554367 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 851 | Open in IMG/M |
| 3300012922|Ga0137394_10142904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter acidisoli | 2034 | Open in IMG/M |
| 3300012922|Ga0137394_10522669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1007 | Open in IMG/M |
| 3300012923|Ga0137359_10005084 | All Organisms → cellular organisms → Bacteria | 10817 | Open in IMG/M |
| 3300012923|Ga0137359_10654194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Tahibacter → Tahibacter aquaticus | 918 | Open in IMG/M |
| 3300012923|Ga0137359_11162576 | Not Available | 659 | Open in IMG/M |
| 3300012925|Ga0137419_10591885 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300012925|Ga0137419_11735844 | Not Available | 533 | Open in IMG/M |
| 3300012927|Ga0137416_10037506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3295 | Open in IMG/M |
| 3300012927|Ga0137416_10496313 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300012929|Ga0137404_11226286 | Not Available | 690 | Open in IMG/M |
| 3300012929|Ga0137404_11940842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300012930|Ga0137407_11607752 | Not Available | 619 | Open in IMG/M |
| 3300014199|Ga0181535_10818352 | Not Available | 527 | Open in IMG/M |
| 3300015052|Ga0137411_1158222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1015 | Open in IMG/M |
| 3300015054|Ga0137420_1396249 | All Organisms → cellular organisms → Bacteria | 4905 | Open in IMG/M |
| 3300015241|Ga0137418_10423124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Tahibacter → Tahibacter aquaticus | 1082 | Open in IMG/M |
| 3300015245|Ga0137409_11101276 | Not Available | 633 | Open in IMG/M |
| 3300018431|Ga0066655_10076518 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1810 | Open in IMG/M |
| 3300020140|Ga0179590_1105832 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300020140|Ga0179590_1154386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
| 3300021086|Ga0179596_10436983 | Not Available | 662 | Open in IMG/M |
| 3300021479|Ga0210410_10494439 | Not Available | 1092 | Open in IMG/M |
| 3300024288|Ga0179589_10519125 | Not Available | 554 | Open in IMG/M |
| 3300024330|Ga0137417_1126621 | Not Available | 877 | Open in IMG/M |
| 3300026285|Ga0209438_1152670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300026313|Ga0209761_1050447 | All Organisms → cellular organisms → Bacteria | 2334 | Open in IMG/M |
| 3300026313|Ga0209761_1101771 | All Organisms → cellular organisms → Bacteria | 1434 | Open in IMG/M |
| 3300026318|Ga0209471_1000188 | All Organisms → cellular organisms → Bacteria | 45668 | Open in IMG/M |
| 3300026320|Ga0209131_1276467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
| 3300026323|Ga0209472_1156200 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300026325|Ga0209152_10249831 | Not Available | 659 | Open in IMG/M |
| 3300026332|Ga0209803_1069812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1494 | Open in IMG/M |
| 3300026334|Ga0209377_1224462 | Not Available | 619 | Open in IMG/M |
| 3300026360|Ga0257173_1023175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
| 3300026481|Ga0257155_1074862 | Not Available | 547 | Open in IMG/M |
| 3300026499|Ga0257181_1048616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300026529|Ga0209806_1171483 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300026529|Ga0209806_1214666 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300026532|Ga0209160_1103664 | All Organisms → cellular organisms → Bacteria | 1435 | Open in IMG/M |
| 3300026551|Ga0209648_10017979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 6172 | Open in IMG/M |
| 3300026557|Ga0179587_10133629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1534 | Open in IMG/M |
| 3300027643|Ga0209076_1082116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 917 | Open in IMG/M |
| 3300027671|Ga0209588_1003306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4460 | Open in IMG/M |
| 3300027674|Ga0209118_1036583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1488 | Open in IMG/M |
| 3300027674|Ga0209118_1195960 | Not Available | 546 | Open in IMG/M |
| 3300027783|Ga0209448_10147757 | Not Available | 785 | Open in IMG/M |
| 3300027862|Ga0209701_10083650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2009 | Open in IMG/M |
| 3300027875|Ga0209283_10057060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2498 | Open in IMG/M |
| 3300027875|Ga0209283_10728067 | Not Available | 617 | Open in IMG/M |
| 3300027882|Ga0209590_10181113 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1324 | Open in IMG/M |
| 3300027903|Ga0209488_10293597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_17 | 1214 | Open in IMG/M |
| 3300027903|Ga0209488_10426711 | Not Available | 979 | Open in IMG/M |
| 3300027908|Ga0209006_10467166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1055 | Open in IMG/M |
| 3300028536|Ga0137415_10484240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1044 | Open in IMG/M |
| 3300028536|Ga0137415_11498996 | Not Available | 500 | Open in IMG/M |
| 3300031819|Ga0318568_10771260 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300031962|Ga0307479_10447976 | Not Available | 1275 | Open in IMG/M |
| 3300032160|Ga0311301_10947387 | Not Available | 1150 | Open in IMG/M |
| 3300032160|Ga0311301_11514013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 825 | Open in IMG/M |
| 3300032205|Ga0307472_100026256 | All Organisms → cellular organisms → Bacteria | 3294 | Open in IMG/M |
| 3300032205|Ga0307472_100511613 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300033289|Ga0310914_10014998 | All Organisms → cellular organisms → Bacteria | 5872 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 66.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.66% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 8.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.52% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.76% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.07% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.07% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.69% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.69% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.69% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.69% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
| 3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25382J37095_101362092 | 3300002562 | Grasslands Soil | QKLRRKVVRGNQMKHVPALYLATAMALQGMTKQELEALKLRIEEKRV* |
| JGI25617J43924_100247061 | 3300002914 | Grasslands Soil | EHGDKMKHVPALYLATAMALQGMTKHELEALKLRIEEKATIP* |
| JGI25617J43924_101167611 | 3300002914 | Grasslands Soil | MKHVPALYLATAMALQGMTKQELEALKLRIEEKRVIPKH* |
| JGI25616J43925_104052511 | 3300002917 | Grasslands Soil | RGNKMKHVPALYLATAMALQGMTKQELEALKLRIEEKRV* |
| Ga0066703_104062143 | 3300005568 | Soil | VELGNKMKHVPALHLATAMALQGMTKEELEALKLRIEKKGV* |
| Ga0066705_104873441 | 3300005569 | Soil | NKMKHVPALHLATAMALQGMTKQELEALKLRIEKK* |
| Ga0066706_101288991 | 3300005598 | Soil | LRRKVEHGNKMKHVPALHLATAMALQGMTKQELEALKLRIEKKRV* |
| Ga0066696_104435262 | 3300006032 | Soil | MKHVPALHLATAMALQGMTTQELEALKLRIEKKRV* |
| Ga0079222_102261693 | 3300006755 | Agricultural Soil | KHVPALYLATAMALQGMTKQEIEALRLRIKEKRV* |
| Ga0066665_100591161 | 3300006796 | Soil | EKLRRNLERGNKMKHVPALYLATAMALQGMTKQELEALKLRIEEKRV* |
| Ga0066665_112645401 | 3300006796 | Soil | NKMKQVPALHLATAMALQGMKKQELEALKLRIEENRV* |
| Ga0073928_103225741 | 3300006893 | Iron-Sulfur Acid Spring | GNKMKHVPALYLATAMALQGMTKQELESLKLRIEEKRACAP* |
| Ga0099791_102406402 | 3300007255 | Vadose Zone Soil | ARGNKMKHVPALYLATAMALQGMTKQELEALKLRIEEKRV* |
| Ga0099791_105777701 | 3300007255 | Vadose Zone Soil | KMKHVPALYLATAMALQGMTKQELEALKLRMEEKRG* |
| Ga0099793_105898421 | 3300007258 | Vadose Zone Soil | VHGSKMKHVPALHLATAMALQSMTKQELEALKLRIDEKRV* |
| Ga0099794_100084498 | 3300007265 | Vadose Zone Soil | RKVARGNKMKHVPALYLATAMALQGMTKQELEALKLRIEEKRVK* |
| Ga0099794_101143061 | 3300007265 | Vadose Zone Soil | RKVARGNKMKHVPALYLATAMALQGMTKQELEALKLRIEEK* |
| Ga0099794_104666062 | 3300007265 | Vadose Zone Soil | EHGNRMKHVPALYLATAMALQGMTKQELEALKLRIEEKRV* |
| Ga0066710_1008371391 | 3300009012 | Grasslands Soil | VELGNKMKHVPALHLATAMALQGMTKQELEALKLRIEKK |
| Ga0066710_1029749251 | 3300009012 | Grasslands Soil | NKMKHVPALHLATAMALQGMTKQELEALKLRIEKK |
| Ga0099829_100555231 | 3300009038 | Vadose Zone Soil | NKMKHVPALYLATAMALQGMTKRELEALKLRIEEK* |
| Ga0099829_109770641 | 3300009038 | Vadose Zone Soil | HGNKMKHVPALYLATAMALQGMTKQELEALKLRIEEKRI* |
| Ga0099829_116374291 | 3300009038 | Vadose Zone Soil | KHVPALYLATAMALQGMTKQELEALKLRIEEKRV* |
| Ga0099830_104368641 | 3300009088 | Vadose Zone Soil | VARGNKMKHVPALYLATAMALQGMTKQELEALKLRSEEKRG* |
| Ga0099830_106862461 | 3300009088 | Vadose Zone Soil | RKVARGNKMKHVPALYLATAMALQGMTKQELEALKLRIEEKRV* |
| Ga0099830_109082861 | 3300009088 | Vadose Zone Soil | VAHGNRMKHVPALYLATAMALQGMTKQELEALKLRIEEERV* |
| Ga0099830_115682941 | 3300009088 | Vadose Zone Soil | GNKMKHVPALYLATAMALQGMTKQELEALKLRIEEK* |
| Ga0099828_100373521 | 3300009089 | Vadose Zone Soil | MKHVPALYLATAMALQGMTKQELEALKLRTEEKRVW* |
| Ga0099828_101675575 | 3300009089 | Vadose Zone Soil | VARGNKMKHVPALYLATAMALQGMTKQELEALKLRLEEKQV* |
| Ga0099828_102535101 | 3300009089 | Vadose Zone Soil | KMKHVPALYLATAMALQGMTKQELEALKLRIEKKRVW* |
| Ga0099828_105777271 | 3300009089 | Vadose Zone Soil | VQKLRRKVAHGNRIKHVPALYLATAMALQGMTKRELEALKLRIEKKRV* |
| Ga0099828_105787751 | 3300009089 | Vadose Zone Soil | AHGNKMKHVPALYLATAMALQGMTKQELEALKSRIEEKAAIP* |
| Ga0099828_107638071 | 3300009089 | Vadose Zone Soil | RMKHVPALYLATAMALQGMTKQELEALKLRIEKKRL* |
| Ga0099828_109688701 | 3300009089 | Vadose Zone Soil | MKHVPALYLAIAMALQGMTKQELEALKLRLEEKRV* |
| Ga0099828_111287422 | 3300009089 | Vadose Zone Soil | RRKVARGNKMKHVPALYLATAMALQGMTKQELEALKLRIEEKRV* |
| Ga0099828_113774113 | 3300009089 | Vadose Zone Soil | QKLRRKVEHGNKMKHVPALYLATAMALQGMTKQELEALKLRI* |
| Ga0099792_104461521 | 3300009143 | Vadose Zone Soil | KMKHVPALYLATAMALQGMTKQELEALKLRIEEKRI* |
| Ga0134065_101732091 | 3300010326 | Grasslands Soil | KLRRKVELGNKMKHVPALHLATAMALQGMTKQELEALKLRIEKK* |
| Ga0136449_1037731721 | 3300010379 | Peatlands Soil | NKMKHVPALYLATAMALQGMTKQELEALKLRIKSRRELP* |
| Ga0137392_102176731 | 3300011269 | Vadose Zone Soil | KVARGNKMKHVPALYLATAMALQGMTKQELEALKLRIEEKRV* |
| Ga0137392_103696011 | 3300011269 | Vadose Zone Soil | NKMKHVPALYLATAMALQGMTKQELKALKLRIEKKRVW* |
| Ga0137392_113788791 | 3300011269 | Vadose Zone Soil | MKHVPALYLATAMALQGMTKQELEALKLRIEEKRG* |
| Ga0137391_100260145 | 3300011270 | Vadose Zone Soil | VARGSKMKHVPALYLAIAMALQGMTKQELEALKLRLEEKRV* |
| Ga0137391_100545471 | 3300011270 | Vadose Zone Soil | KVEHGNKMKHVPALHLATAMALQGMTKQELEALKLRMEEKRV* |
| Ga0137391_105053401 | 3300011270 | Vadose Zone Soil | KVARGNKMKHVPALYLATAMALQGMTKQELEALKLRIEEKRI* |
| Ga0137389_100972332 | 3300012096 | Vadose Zone Soil | MKHVPALYLATAMALQGMTKQDLEALKLRIEKKRV* |
| Ga0137389_101135841 | 3300012096 | Vadose Zone Soil | NKMKHVPALYLATAMALQGMTKQELEALKLRIEEKRG* |
| Ga0137389_101976371 | 3300012096 | Vadose Zone Soil | KMKHVPALYLATAMALQGMTKQELEALKLRIEEKRV* |
| Ga0137389_108129481 | 3300012096 | Vadose Zone Soil | KQVPALYLATAMALQGMTKQELEALKLRIKEKRV* |
| Ga0137388_100217521 | 3300012189 | Vadose Zone Soil | VAHGNRMKHVPALYLATAMALQGMTKQELEALKLRIKEKRV* |
| Ga0137388_100909125 | 3300012189 | Vadose Zone Soil | VQKLRRKVARGNKMKHVPALYLATAMALQGMTKQELEALKLRLEEKQV* |
| Ga0137388_105998961 | 3300012189 | Vadose Zone Soil | HRMKHVPALYLATAMALQGMTKQELEALKLRMEEKRV* |
| Ga0137388_117927781 | 3300012189 | Vadose Zone Soil | KMKHVPALYLATAMALQGMTKQELEALKLRIEES* |
| Ga0137364_110223061 | 3300012198 | Vadose Zone Soil | KHVPALHLATAMALQGMTTQELEALKLRIEKKRV* |
| Ga0137382_1000027933 | 3300012200 | Vadose Zone Soil | AHGHKMKHVPALYLATAMALQGMTKQELEALKLRIKEKRV* |
| Ga0137363_115619841 | 3300012202 | Vadose Zone Soil | RKVEHGNKMKHVPALYLATAMALQGMTKQELEALKLRMEEKQV* |
| Ga0137363_117857512 | 3300012202 | Vadose Zone Soil | MQHVPALYLATAMALQGMTKLELEALKLRIEEKRV* |
| Ga0137362_101904061 | 3300012205 | Vadose Zone Soil | KVARGNKMKHVPALYLATAMALQGMTKQELEALKLRIEEKRVK* |
| Ga0137362_113568091 | 3300012205 | Vadose Zone Soil | QIAHGSKMKHVPALYLATAMALQGMTKQELEALKLRMEES* |
| Ga0137381_109205311 | 3300012207 | Vadose Zone Soil | GNKMKHVPALYLATAMALQGMTKQELEALKLRMEEKQV* |
| Ga0137378_106386542 | 3300012210 | Vadose Zone Soil | GNKMKHVPALYLATAMALQGMTKQELEALKLRIEEKRV* |
| Ga0137377_113941161 | 3300012211 | Vadose Zone Soil | GNKMKHVPALYLATAMALQGMTKQELEALKLRIKEKRV* |
| Ga0137385_105693372 | 3300012359 | Vadose Zone Soil | VARGNKMKHVPALYLATAMALQGMTKQELEALKLRIEEKRVK* |
| Ga0137385_115701661 | 3300012359 | Vadose Zone Soil | HGNRMKHVPALHLATAMALQGMTKQELEALKLRIKEKRV* |
| Ga0137360_100745135 | 3300012361 | Vadose Zone Soil | IKHVPALYLATAMALQGMTKHELDALKLRIEKKAAIS* |
| Ga0137360_101664331 | 3300012361 | Vadose Zone Soil | VEHGSKIKHVPALYLATAMALQGMTKRELEALKLRIEKKRE* |
| Ga0137360_108189942 | 3300012361 | Vadose Zone Soil | VPALYLATAMALQGMTKQELEALKLRIEEKAAIP* |
| Ga0137360_112828341 | 3300012361 | Vadose Zone Soil | KMKHVPALYLATAMALQGMTKQELEALKLRIEEKRVK* |
| Ga0137360_114522191 | 3300012361 | Vadose Zone Soil | NKMKHVPALYLATAMALQGMTKPELDALKLRIGKKAVIS* |
| Ga0137361_106206942 | 3300012362 | Vadose Zone Soil | MKHVPALYLATAMALQGMTKQEIEALKLRIEEKRV* |
| Ga0137390_102468394 | 3300012363 | Vadose Zone Soil | KMKHVPALYLATAMALQGMTKQELEALKLRMEEKRV* |
| Ga0137390_103166324 | 3300012363 | Vadose Zone Soil | GNKMKHVPALYLATAMALQGMTKQELEALKLRIEEKRG* |
| Ga0137390_112743161 | 3300012363 | Vadose Zone Soil | KLRRKVEHGNKMKHVPALYLATAMALQGMTKRELEALKLRMEEKRV* |
| Ga0137358_106647571 | 3300012582 | Vadose Zone Soil | RRKVERGSKIKHVPALYLATAMALQGMTKHELEALKLRIEGK* |
| Ga0137398_104602962 | 3300012683 | Vadose Zone Soil | LRRKVARGNKMKHVPALYLATAMALQGMTKQELEALKLRIEEKRV* |
| Ga0137398_112121002 | 3300012683 | Vadose Zone Soil | MKHVPALYLATAMALQGMTKEELEALKLRMEEKRV* |
| Ga0137398_112367971 | 3300012683 | Vadose Zone Soil | RRKVARGNKMKHVPALYLATAMALQGMTKQELEALKLRIEEKGV* |
| Ga0137397_111609542 | 3300012685 | Vadose Zone Soil | KMKHVPALYLATAMALQGMTKQELEALKLRIEKK* |
| Ga0137396_102893541 | 3300012918 | Vadose Zone Soil | RRQIAHGSKMKHVPALYLATAMALQGMTKQELEALKLRIDEKRV* |
| Ga0137396_105543673 | 3300012918 | Vadose Zone Soil | IAHGSKMKHVPALYLATAMALQGMTKEELEALKLRMEEKRV* |
| Ga0137394_101429041 | 3300012922 | Vadose Zone Soil | VEKLRRKVARGNKMKHVPALYLATAMALQGMTKQELEALKLRIEEKRV* |
| Ga0137394_105226691 | 3300012922 | Vadose Zone Soil | EKLRRKVAHGNKMKHVPALYLATAMALQGMTKQELEALKLRIEKK* |
| Ga0137359_100050843 | 3300012923 | Vadose Zone Soil | MKHVPALYLDTAMALQGMTKQELEALKLRIQAKRG* |
| Ga0137359_106541941 | 3300012923 | Vadose Zone Soil | NKMKHVPALYLATAMALQGMTKQELEALKVRIEKRV* |
| Ga0137359_111625761 | 3300012923 | Vadose Zone Soil | HGSKIKHVPALYLATAMALQGMTKHELEALKLRIEDKAAIS* |
| Ga0137419_105918852 | 3300012925 | Vadose Zone Soil | VAHGNRIKHVPALYLATAMALQGMTKRELEALKLRIEKKRV* |
| Ga0137419_117358441 | 3300012925 | Vadose Zone Soil | MKHVPALYLATAMALQGMTKQELEALKLRMEEKQV* |
| Ga0137416_100375061 | 3300012927 | Vadose Zone Soil | NVAHGHKMKLVPALYLATAMALQGMTKQELEALKLRIEKKRE* |
| Ga0137416_104963132 | 3300012927 | Vadose Zone Soil | MKHVPALYLATAMALQGMTKQELEALKLRMEEKRV* |
| Ga0137404_112262862 | 3300012929 | Vadose Zone Soil | GNRMKHVPALYLATAMALQGMTKQELEALKLRIEEKGV* |
| Ga0137404_119408421 | 3300012929 | Vadose Zone Soil | KMKHVPALYLATAMALQGMTKQEIEALKLRIQAKRG* |
| Ga0137407_116077521 | 3300012930 | Vadose Zone Soil | KHVPALYLATAMALQGMTKHELDALKLRIEKKAAIS* |
| Ga0181535_108183521 | 3300014199 | Bog | GNKMKHVPALYLATAMALQDMTKQELEALKLRIEEKQA* |
| Ga0137411_11582223 | 3300015052 | Vadose Zone Soil | VAPGNKMKHVPALYLATAMALQGMTKQELEALKLRIEEKRV* |
| Ga0137420_13962494 | 3300015054 | Vadose Zone Soil | MKHVPALYLATAMALQGMTKQELEALKLRIEEKRV* |
| Ga0137418_104231243 | 3300015241 | Vadose Zone Soil | KMKHVPALYLATAMALQGMTKQELEALRLRIEEKRV* |
| Ga0137409_111012763 | 3300015245 | Vadose Zone Soil | ERGSKIKHVPALYLATAMALQGMTKPELDALKLRIEKKAAIS* |
| Ga0066655_100765184 | 3300018431 | Grasslands Soil | RKVELGNKMKHVPALHLATAMALQGMTKQELEALKLRIEKKRV |
| Ga0179590_11058321 | 3300020140 | Vadose Zone Soil | KIKHVPALYLATAMALQGMTKQELDALKLRIEKKAAIS |
| Ga0179590_11543862 | 3300020140 | Vadose Zone Soil | MKHVPALYLATAMALQGMTKQELDALKLRIEKKAAIS |
| Ga0179596_104369831 | 3300021086 | Vadose Zone Soil | RKVARGNKMKHVPALYLATAMALQGMTKQELEALKLRIEEK |
| Ga0210405_100577371 | 3300021171 | Soil | KLKHIPALYLATAMALQGMTEQELNALKFRIKEKRETF |
| Ga0210410_104944392 | 3300021479 | Soil | RRKVERGNKMKHVPALYLATAMALQGMTKQELESLKLRIEEKRA |
| Ga0179589_105191251 | 3300024288 | Vadose Zone Soil | RRKVERGSKIKHVPALYLATAMALQGMTKHELDALKLRIEKKAVIS |
| Ga0137417_11266212 | 3300024330 | Vadose Zone Soil | HGDQMKHVPALYLATAMALQGMTKHELEALKLRIEEKPV |
| Ga0209438_11526702 | 3300026285 | Grasslands Soil | KVEHGNKMKHVPALHLATAMALQSMTKQELEALKLRIEKKRA |
| Ga0209761_10504471 | 3300026313 | Grasslands Soil | LRRKVARGNKMKHVPALYLATATALQDMTKQELEALKLRIEEKRV |
| Ga0209761_11017714 | 3300026313 | Grasslands Soil | EVQKLRRKVARGNKMKHVPALYLATAMALQGMTKQELEALKLRIEEKRV |
| Ga0209471_100018828 | 3300026318 | Soil | MKHVPALYLATAMALQGMTKQELEALKLRIEEKRV |
| Ga0209131_12764672 | 3300026320 | Grasslands Soil | ERGSKIKHVPALYLATAMALQGMTKQELDALKVRIEKKAAIS |
| Ga0209472_11562001 | 3300026323 | Soil | MKHVPALHLATAMALQGMTTQELEALKLRIEKKRV |
| Ga0209152_102498312 | 3300026325 | Soil | EKLRRNLERGNKMKHVPALYLATAMALQGMTKQELEALKLRIEKMRV |
| Ga0209803_10698121 | 3300026332 | Soil | KMKHVPALHLATALALQGMTKEELEALKLRIEKKGV |
| Ga0209377_12244622 | 3300026334 | Soil | KMKHVPALYLATAMALQGMTKQELEALKLRIKEKRV |
| Ga0257163_10395462 | 3300026359 | Soil | MKHVPALYLATAMALQGMTEQELEGLKLRIEEKEV |
| Ga0257173_10231751 | 3300026360 | Soil | EHGNRMKHVPALYLATAMALQGMTKQELEALKLRIEEKRV |
| Ga0257155_10748622 | 3300026481 | Soil | KVEHGSKIKHVPALYLATAMALQGMTKHELDALKLRIEKKAAIS |
| Ga0257181_10486163 | 3300026499 | Soil | KMKHVPALYLATAMALQGMTKQELEALKLRIEEKRV |
| Ga0209806_11714831 | 3300026529 | Soil | RKVELGNKMKHVPALHLATAMALQGMTKEELEALKLRIEKKGV |
| Ga0209806_12146661 | 3300026529 | Soil | NKMKHVPALHLATAMALQGMTKQELEALKLRIEKKRV |
| Ga0209160_11036641 | 3300026532 | Soil | NKMKHVPALYLATAMALQGMTKQELEALKLRMEEKRE |
| Ga0209648_100179791 | 3300026551 | Grasslands Soil | EHGDKMKHVPALYLATAMALQGMTKHELEALKLRIEEKATIP |
| Ga0179587_101336293 | 3300026557 | Vadose Zone Soil | MKHVPALYLATAMALQGMTKQELEGLKLRIEEKRV |
| Ga0209076_10821163 | 3300027643 | Vadose Zone Soil | REVAPGNKMKHVPALYLATAMALQGMTKQELEALKLRIEEKRI |
| Ga0209736_11115862 | 3300027660 | Forest Soil | HVPALYLATAMALQGMTKQELESLKLRIGREASMSAPC |
| Ga0209588_10033068 | 3300027671 | Vadose Zone Soil | NKMKHVPALYLATAMALQGMTKQELEALKLRIEEKRVK |
| Ga0209118_10365831 | 3300027674 | Forest Soil | VERGNKMKHVPALYLATAMALQGMTKQELEALKLRIEEKRV |
| Ga0209118_11959601 | 3300027674 | Forest Soil | LRRKVAHGNKMKHVPALYLATAMALQGMTKRELEALKLRIAEKRV |
| Ga0209448_101477571 | 3300027783 | Bog Forest Soil | RRKIASGNRLKYVPALYLATAMALQGMTKQELEALKLRIEEKRACSP |
| Ga0209701_100836501 | 3300027862 | Vadose Zone Soil | HVPALYLATAMALQGMTKQELEALKLRIEEKRVIPKH |
| Ga0209283_100570601 | 3300027875 | Vadose Zone Soil | KLRRKVERGNKIKHVPALYLATAMALQGMTKQELEALKLRIEEKRV |
| Ga0209283_107280671 | 3300027875 | Vadose Zone Soil | VARGSKMKHVPALYLAIAMALQGMTKQELEALKLRIEEKRV |
| Ga0209590_101811131 | 3300027882 | Vadose Zone Soil | QIAHGSKMKHVPALYLATAMALQGMTKKELEALKLRMEEKRV |
| Ga0209488_102935972 | 3300027903 | Vadose Zone Soil | AHGHKMKHVPALYLATAMALQGMTKQELEALKLRMEEKRV |
| Ga0209488_104267113 | 3300027903 | Vadose Zone Soil | VEKLRRKVAHGDKIKHVPALYLATAMALQGMTKHELEALKLRIEKKAAIS |
| Ga0209006_104671661 | 3300027908 | Forest Soil | RRKVEHGDKMKHVPALYLATAMALQGMTKQELESLKLRIEGKRA |
| Ga0137415_104842403 | 3300028536 | Vadose Zone Soil | GSKMKHVPALYLATAMALQGMTKQELEALKLRIEEKRV |
| Ga0137415_114989961 | 3300028536 | Vadose Zone Soil | RGNKMKHVPALYLVTAMALQGMTKQELQALKLRIEEKRV |
| Ga0318568_107712601 | 3300031819 | Soil | DKMKHVPALYLATAMALQGMTKQELGALKLRMKEKRV |
| Ga0307479_104479761 | 3300031962 | Hardwood Forest Soil | MKHVPALFMATAMALQGMTQQELDALKLRIQVRPAP |
| Ga0311301_109473873 | 3300032160 | Peatlands Soil | AHGNKMKHVPALYLATAMALQRMTKQELEALKVRIEKKITTA |
| Ga0311301_115140132 | 3300032160 | Peatlands Soil | LRRKVARGNKMKHVPALYLATAMALQGMTKQELEALKLRIEAKAAIP |
| Ga0307472_1000262561 | 3300032205 | Hardwood Forest Soil | VPALYLATAMALQGMTKQELDDLKLRIGKTQARRSFVE |
| Ga0307472_1005116131 | 3300032205 | Hardwood Forest Soil | EHGNKMKHVPALYLATAMALQGMTKQEIDALKLRIEEKRV |
| Ga0310914_100149981 | 3300033289 | Soil | RGDKMKHVPALYLATAMALQGMTKQELEALKLRMKEKRV |
| ⦗Top⦘ |