


| Basic Information | |
|---|---|
| Family ID | F050266 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 145 |
| Average Sequence Length | 41 residues |
| Representative Sequence | PVDIVTEVINRAEHALATSLVQGPGKVVALGPALAAGAVA |
| Number of Associated Samples | 129 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.76 % |
| % of genes near scaffold ends (potentially truncated) | 97.24 % |
| % of genes from short scaffolds (< 2000 bps) | 90.34 % |
| Associated GOLD sequencing projects | 117 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.586 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.414 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.897 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.621 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.41% β-sheet: 0.00% Coil/Unstructured: 45.59% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF00108 | Thiolase_N | 43.45 |
| PF00903 | Glyoxalase | 13.10 |
| PF02803 | Thiolase_C | 10.34 |
| PF02737 | 3HCDH_N | 1.38 |
| PF05163 | DinB | 1.38 |
| PF12681 | Glyoxalase_2 | 1.38 |
| PF12762 | DDE_Tnp_IS1595 | 1.38 |
| PF02810 | SEC-C | 0.69 |
| PF00581 | Rhodanese | 0.69 |
| PF13643 | DUF4145 | 0.69 |
| PF01590 | GAF | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 53.79 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.38 |
| COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 1.38 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 1.38 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 1.38 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 1.38 |
| COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 1.38 |
| COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 1.38 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.38 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.59 % |
| Unclassified | root | N/A | 12.41 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001082|JGI12664J13189_1001205 | All Organisms → cellular organisms → Bacteria | 3274 | Open in IMG/M |
| 3300001166|JGI12694J13545_1022249 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300001471|JGI12712J15308_10051752 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1042 | Open in IMG/M |
| 3300001661|JGI12053J15887_10177046 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100495792 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300002907|JGI25613J43889_10118519 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300004080|Ga0062385_10122310 | All Organisms → cellular organisms → Bacteria | 1300 | Open in IMG/M |
| 3300004635|Ga0062388_100475464 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300005184|Ga0066671_10299749 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300005332|Ga0066388_105672841 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300005434|Ga0070709_11633336 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300005537|Ga0070730_10016099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 5941 | Open in IMG/M |
| 3300005541|Ga0070733_10478900 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300005542|Ga0070732_10698276 | Not Available | 617 | Open in IMG/M |
| 3300005564|Ga0070664_100691722 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300005568|Ga0066703_10680998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300005591|Ga0070761_10115068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1559 | Open in IMG/M |
| 3300005591|Ga0070761_10864927 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300005610|Ga0070763_10907044 | Not Available | 525 | Open in IMG/M |
| 3300005712|Ga0070764_11112007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300005764|Ga0066903_107599433 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300005921|Ga0070766_10168775 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1351 | Open in IMG/M |
| 3300005921|Ga0070766_10691181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| 3300006028|Ga0070717_11942002 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300006050|Ga0075028_100348247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 836 | Open in IMG/M |
| 3300006794|Ga0066658_10724600 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300006794|Ga0066658_10743371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300006800|Ga0066660_11203191 | Not Available | 595 | Open in IMG/M |
| 3300006893|Ga0073928_10574404 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300006954|Ga0079219_12055437 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300007982|Ga0102924_1202733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 858 | Open in IMG/M |
| 3300007982|Ga0102924_1222471 | Not Available | 800 | Open in IMG/M |
| 3300009012|Ga0066710_102470541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
| 3300009029|Ga0066793_10283171 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300009090|Ga0099827_11863660 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300009520|Ga0116214_1104522 | Not Available | 1042 | Open in IMG/M |
| 3300009624|Ga0116105_1042340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1023 | Open in IMG/M |
| 3300009635|Ga0116117_1150704 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300009645|Ga0116106_1120722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 844 | Open in IMG/M |
| 3300009683|Ga0116224_10435899 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300009759|Ga0116101_1195858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300009760|Ga0116131_1103906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 849 | Open in IMG/M |
| 3300009762|Ga0116130_1255102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300009824|Ga0116219_10779583 | Not Available | 521 | Open in IMG/M |
| 3300010043|Ga0126380_12181476 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300010046|Ga0126384_12147802 | Not Available | 536 | Open in IMG/M |
| 3300010048|Ga0126373_10456755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1313 | Open in IMG/M |
| 3300010379|Ga0136449_100420488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2361 | Open in IMG/M |
| 3300010398|Ga0126383_13190946 | Not Available | 535 | Open in IMG/M |
| 3300012205|Ga0137362_11072313 | Not Available | 685 | Open in IMG/M |
| 3300012927|Ga0137416_11828283 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300012971|Ga0126369_13223848 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300012988|Ga0164306_11514012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300014201|Ga0181537_10167804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1507 | Open in IMG/M |
| 3300014489|Ga0182018_10260704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 952 | Open in IMG/M |
| 3300014657|Ga0181522_10399858 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 821 | Open in IMG/M |
| 3300014838|Ga0182030_10536782 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300016294|Ga0182041_10944657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 777 | Open in IMG/M |
| 3300017927|Ga0187824_10170923 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300017955|Ga0187817_11100233 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300017970|Ga0187783_10608933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
| 3300017975|Ga0187782_10257661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1312 | Open in IMG/M |
| 3300017975|Ga0187782_11068307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300018007|Ga0187805_10027437 | All Organisms → cellular organisms → Bacteria | 2517 | Open in IMG/M |
| 3300018022|Ga0187864_10225185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 873 | Open in IMG/M |
| 3300018026|Ga0187857_10067066 | All Organisms → cellular organisms → Bacteria | 1795 | Open in IMG/M |
| 3300018038|Ga0187855_10177642 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
| 3300018038|Ga0187855_10836319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300018058|Ga0187766_11208699 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300018086|Ga0187769_10907045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300018086|Ga0187769_11039485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300018482|Ga0066669_11403591 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
| 3300019888|Ga0193751_1000667 | All Organisms → cellular organisms → Bacteria | 25212 | Open in IMG/M |
| 3300020579|Ga0210407_10628630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 836 | Open in IMG/M |
| 3300020579|Ga0210407_11294515 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300020580|Ga0210403_11098168 | Not Available | 618 | Open in IMG/M |
| 3300020582|Ga0210395_10964615 | Not Available | 632 | Open in IMG/M |
| 3300020582|Ga0210395_11444151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300021168|Ga0210406_10267527 | All Organisms → cellular organisms → Bacteria | 1398 | Open in IMG/M |
| 3300021168|Ga0210406_10803639 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
| 3300021181|Ga0210388_11524945 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300021401|Ga0210393_10235872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1482 | Open in IMG/M |
| 3300021405|Ga0210387_11096442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300021407|Ga0210383_11464031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300021432|Ga0210384_10258659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1567 | Open in IMG/M |
| 3300021433|Ga0210391_10259179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1365 | Open in IMG/M |
| 3300021474|Ga0210390_11649847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300021478|Ga0210402_10971950 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| 3300023255|Ga0224547_1012697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1067 | Open in IMG/M |
| 3300025414|Ga0208935_1016103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1000 | Open in IMG/M |
| 3300025442|Ga0208034_1041999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1005 | Open in IMG/M |
| 3300025906|Ga0207699_10962739 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300025914|Ga0207671_10805791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300025939|Ga0207665_10570491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
| 3300025945|Ga0207679_10804172 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300026320|Ga0209131_1047727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2428 | Open in IMG/M |
| 3300026551|Ga0209648_10113182 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2203 | Open in IMG/M |
| 3300027559|Ga0209222_1067574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 688 | Open in IMG/M |
| 3300027609|Ga0209221_1094652 | Not Available | 771 | Open in IMG/M |
| 3300027652|Ga0209007_1025015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1537 | Open in IMG/M |
| 3300027684|Ga0209626_1215143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300027745|Ga0209908_10014429 | All Organisms → cellular organisms → Bacteria | 1404 | Open in IMG/M |
| 3300027745|Ga0209908_10084343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 763 | Open in IMG/M |
| 3300027867|Ga0209167_10310648 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 853 | Open in IMG/M |
| 3300027879|Ga0209169_10495315 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300027879|Ga0209169_10608706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 570 | Open in IMG/M |
| 3300027882|Ga0209590_10580009 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300028047|Ga0209526_10989891 | Not Available | 503 | Open in IMG/M |
| 3300028536|Ga0137415_11489375 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300028759|Ga0302224_10373096 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300028806|Ga0302221_10063098 | Not Available | 1678 | Open in IMG/M |
| 3300028906|Ga0308309_10656449 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 911 | Open in IMG/M |
| 3300029945|Ga0311330_10527767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 944 | Open in IMG/M |
| 3300029952|Ga0311346_10842671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 766 | Open in IMG/M |
| 3300029999|Ga0311339_11569923 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300030524|Ga0311357_10608221 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1004 | Open in IMG/M |
| 3300030688|Ga0311345_11155937 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300030760|Ga0265762_1017020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1321 | Open in IMG/M |
| 3300030879|Ga0265765_1068935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300030991|Ga0073994_10011878 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300031057|Ga0170834_113702062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300031234|Ga0302325_10681998 | Not Available | 1486 | Open in IMG/M |
| 3300031234|Ga0302325_12703864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 585 | Open in IMG/M |
| 3300031236|Ga0302324_100310115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2413 | Open in IMG/M |
| 3300031249|Ga0265339_10114468 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1392 | Open in IMG/M |
| 3300031525|Ga0302326_10330477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2413 | Open in IMG/M |
| 3300031708|Ga0310686_117148146 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300031718|Ga0307474_10440180 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300031754|Ga0307475_10803526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
| 3300031823|Ga0307478_10099023 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2255 | Open in IMG/M |
| 3300031823|Ga0307478_11542499 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300031894|Ga0318522_10309108 | Not Available | 599 | Open in IMG/M |
| 3300031947|Ga0310909_10493339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1027 | Open in IMG/M |
| 3300031962|Ga0307479_10541929 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1146 | Open in IMG/M |
| 3300032160|Ga0311301_10338299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2367 | Open in IMG/M |
| 3300032160|Ga0311301_13054186 | Not Available | 501 | Open in IMG/M |
| 3300032205|Ga0307472_101015389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300032782|Ga0335082_11387933 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300032783|Ga0335079_10234988 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2021 | Open in IMG/M |
| 3300032892|Ga0335081_10298906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2134 | Open in IMG/M |
| 3300032892|Ga0335081_12361189 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300032954|Ga0335083_10018915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8009 | Open in IMG/M |
| 3300033004|Ga0335084_12146105 | Not Available | 542 | Open in IMG/M |
| 3300033545|Ga0316214_1044180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300033826|Ga0334847_031279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.41% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.21% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 5.52% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.52% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.14% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.14% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.14% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.45% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.45% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.76% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.76% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.07% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.07% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.07% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.38% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.38% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 1.38% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.38% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.38% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.38% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.69% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.69% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.69% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.69% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.69% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.69% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.69% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001082 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 | Environmental | Open in IMG/M |
| 3300001166 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009760 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100 | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300023255 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 10-14 | Environmental | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025442 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027559 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030688 | II_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Host-Associated | Open in IMG/M |
| 3300033826 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 1-5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12664J13189_10012056 | 3300001082 | Forest Soil | YDAVDVVTEVINRAEQALALSQAQGSGKAVVLGPALAAGAVA* |
| JGI12694J13545_10222492 | 3300001166 | Forest Soil | SYDPVDIVTEVINRAEFALATSVAQGPGKVVALGAALAAGAVA* |
| JGI12712J15308_100517522 | 3300001471 | Forest Soil | RAEYDPADVVTEVINRAEHALGQAMAQGPGKIVALGQALAAGAVA* |
| JGI12053J15887_101770462 | 3300001661 | Forest Soil | QEYDPVDIVTEVINRAEHALATSVVQGPGKVVALGPALAAGAVA* |
| JGIcombinedJ26739_1004957921 | 3300002245 | Forest Soil | EVINRAEHALHTSLGQGHGKIVALGAARAAGAVA* |
| JGI25613J43889_101185192 | 3300002907 | Grasslands Soil | SYDPVDIVTEVINRAEHALATSLVQGPGKVVALAAALAAGAVA* |
| Ga0062385_101223103 | 3300004080 | Bog Forest Soil | IRAEYDPADVVTEVINRAEHALSQAMAQGPGKIVALGQAMAAGAVA* |
| Ga0062388_1004754641 | 3300004635 | Bog Forest Soil | AVVKESYDPVDIVTEVINRAEHALASSLAQGHGKVVALGAALAAGAVA* |
| Ga0066671_102997491 | 3300005184 | Soil | SYDPVDIVTEVINRVEHALATSLVQGPGKVVALGAALAAGAVA* |
| Ga0066388_1056728412 | 3300005332 | Tropical Forest Soil | RTEFDPVDVVTEVINRVEHALGQATGQGLGHVVALGPTALAAGAVA* |
| Ga0070709_116333361 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | DPIDVVTEVINRAEHALQQAVAQGPGKVVALGPAALAAGAVA* |
| Ga0070730_100160997 | 3300005537 | Surface Soil | EVINRVEHALAQAMAKGPGHVVAQGPAALAEGAVA* |
| Ga0070733_104789001 | 3300005541 | Surface Soil | YDPIDVVTEVINRAEHALQQAMAQGPGKVVALGPAALAAGAVA* |
| Ga0070732_106982762 | 3300005542 | Surface Soil | HTDYDPLDVVTEVINRAEHALVQAMAQGPGKIVALGPALATGAVA* |
| Ga0070664_1006917221 | 3300005564 | Corn Rhizosphere | DPIDVVTEIINRVEYALSQAVAQGPAKVVALEPAALAAGAVA* |
| Ga0066703_106809984 | 3300005568 | Soil | EVINRAEHALAVALTQGTGKVTALGAALAAGAVA* |
| Ga0070761_101150681 | 3300005591 | Soil | DSIDIVTEVINRAEHALASSLAQGPGKIVALGAALATGAVA* |
| Ga0070761_108649271 | 3300005591 | Soil | AEAVIKESYDPVDIVTEVINRAEHALATSLAHGLGKVVVLVAALAAGAVA* |
| Ga0070763_109070441 | 3300005610 | Soil | TEVINRAEHALAQSLTQGPGKVVALSAALAAGAVA* |
| Ga0070764_111120071 | 3300005712 | Soil | IVTEVINRAEHALTTSLAHGLGKVVVLVAALAAGAVA* |
| Ga0066903_1075994332 | 3300005764 | Tropical Forest Soil | RSEYDPADIVTEVINRVEHALGQAMGQGLGHVVALGPTALASGAVA* |
| Ga0070766_101687751 | 3300005921 | Soil | IVTEVINRAEHALATSLGQGPGKVVALGPALAAGAVA* |
| Ga0070766_106911811 | 3300005921 | Soil | PIDVVTEIINRAEHALSQAMAQGPGKVVALGPAALAATAVA* |
| Ga0070717_119420021 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VRENYDPVDIVTEVINRAEHALAVALTQGPGKVTALGAALAAGAVA* |
| Ga0075028_1003482472 | 3300006050 | Watersheds | DPVDIVTEVINRAEYALSQAMAQGPGKVVALGPTALAEGAVA* |
| Ga0066658_107246003 | 3300006794 | Soil | EYDPLDVVTEIINRAEQALAQAMAQGPGRVVALGPAALAAGAVA* |
| Ga0066658_107433712 | 3300006794 | Soil | VIRAEYDPIDVVTEIINRVEYALSQAVAQGPAKVVALEPAALAAGAVA* |
| Ga0066660_112031912 | 3300006800 | Soil | DIVTEVINRAEHALATSLVQGPGKVVALGAALAAGAVA* |
| Ga0073928_105744041 | 3300006893 | Iron-Sulfur Acid Spring | YDPVDIVTEVINRAEHALATSLVQGPGKVVALGAALAAGAVA* |
| Ga0079219_120554372 | 3300006954 | Agricultural Soil | VVKQDYDPVDIVTEVINRAEHALATSLVQGPGKIVALAPTLAAGAVA* |
| Ga0102924_12027331 | 3300007982 | Iron-Sulfur Acid Spring | EYDPVDVVTEVINRGSQALAQAMARGPGHIVAQGAASLAECAVA* |
| Ga0102924_12224713 | 3300007982 | Iron-Sulfur Acid Spring | VVTEVINRAEHALAQGMAQGPGKVVALGPALAAGAVA* |
| Ga0066710_1024705411 | 3300009012 | Grasslands Soil | NYDPVDIVTEVINRAEHALSVALTHGPGKVTALGAALAAGAVA |
| Ga0066793_102831712 | 3300009029 | Prmafrost Soil | TEYDPVDVVTEVINRAEHALGQAMAQGIGKVVALGPALAAGAVA* |
| Ga0099827_118636601 | 3300009090 | Vadose Zone Soil | IDIVTEVINRAEHALATSLVQGPGKVVVLGAALAAGAVA* |
| Ga0116214_11045222 | 3300009520 | Peatlands Soil | VDVVTEVINRAEHALSQAMAQGPGKIVALAPALAAGAVA* |
| Ga0116105_10423402 | 3300009624 | Peatland | PVDIVTEVINRAEHALAQSLAQGPGKVVALSAALAAGAVA* |
| Ga0116117_11507042 | 3300009635 | Peatland | ESYDPVDIVTEVINRAEFALAASTVQGPGKVVALGAALVAGAVA* |
| Ga0116106_11207221 | 3300009645 | Peatland | DIVTEVINRAEFALAASLGQGPGKVMALGAALAAGAVA* |
| Ga0116224_104358992 | 3300009683 | Peatlands Soil | VIRSEYDPVDVVTEVINRAEYALAQAMAQGQGKIVALGPAAMAAGAVA* |
| Ga0116101_11958582 | 3300009759 | Peatland | RESYDPLDIVTEVINRAEFALATSLAQGHGKVVALGAALAAGAVA* |
| Ga0116131_11039063 | 3300009760 | Peatland | EVINRAEHALATSLVQGPGKVVALGAALAAGAVA* |
| Ga0116130_12551021 | 3300009762 | Peatland | IVTEVINRAEFALAASLGQGPGKVMALGAALAAGAVA* |
| Ga0116219_107795831 | 3300009824 | Peatlands Soil | VTEVINRAEHALSQAMSQGPGKIIALSAALAAGAVA* |
| Ga0126380_121814761 | 3300010043 | Tropical Forest Soil | TEVINRVEHALGQAMGQGLGHVVALGPTALAAGAVA* |
| Ga0126384_121478021 | 3300010046 | Tropical Forest Soil | TEVINRAEHALEKSVDEGPGKAVALPAALAAAAVA* |
| Ga0126373_104567552 | 3300010048 | Tropical Forest Soil | IRAEYDPVDVVTEIINRAEHALAQAVAQGPGKVVALGPAAMASGAVA* |
| Ga0136449_1004204884 | 3300010379 | Peatlands Soil | TEVINRAEHALSQAMSQGPGKIVALGPALASGAVA* |
| Ga0126383_131909462 | 3300010398 | Tropical Forest Soil | EFDPVDVVTEVINRVEHALSQSMTQGLGKVVALGPALAAGAVA* |
| Ga0137362_110723133 | 3300012205 | Vadose Zone Soil | PVDIVTEVINRAEHALATSVVQGPGKVVALGAALAAGAVA* |
| Ga0137416_118282831 | 3300012927 | Vadose Zone Soil | YDPVDIVTEVINRAEHALAVALTQGPGKVTALGAALAAGAVA* |
| Ga0126369_132238482 | 3300012971 | Tropical Forest Soil | DVVTEVINRAEHALGQAMGQGLGHVVALGPTALAAGAVA* |
| Ga0164306_115140121 | 3300012988 | Soil | IDVVTEIINRVEHALSQAVAQGPAKVVALGPAALAAGAVA* |
| Ga0181537_101678042 | 3300014201 | Bog | NRPEYDPIDIVTEVINRAEHALTQAVNHGPGKIIALGPALAAGAVA* |
| Ga0182018_102607043 | 3300014489 | Palsa | EVINRADRTLATSFVQGPGEAVALGAALATGAVA* |
| Ga0181522_103998581 | 3300014657 | Bog | EVINRAEHALAQSLTQGPGKVVALSAALSAGAVA* |
| Ga0182030_105367821 | 3300014838 | Bog | AVVRESYDPVDIVTEVINRAEFALAASTVQGPGKVVALGAALVTGAVA* |
| Ga0182041_109446571 | 3300016294 | Soil | PVDVVTEVINRAEHALGQAMGQGLGHVVALGPTALAAGAVA |
| Ga0187824_101709232 | 3300017927 | Freshwater Sediment | TEIINRVEYALSQAVAQGPGKVVALEPAALAAGAVA |
| Ga0187817_111002332 | 3300017955 | Freshwater Sediment | EAVIRTEYDPVDVVTEVINRAERALSQAMAQGPGKIVVLGPASAGAVA |
| Ga0187783_106089331 | 3300017970 | Tropical Peatland | DIVTEVINRAEHALATSLAHGLGKVVALGAALAAGAVA |
| Ga0187782_102576612 | 3300017975 | Tropical Peatland | YDPVDVVTEIINRAEHALAQAVAQGPGKVVALGPAAMASGAVA |
| Ga0187782_110683071 | 3300017975 | Tropical Peatland | DVVTEVINRAEHALHKAMAQGLGKIVAEGPAALASGAVA |
| Ga0187805_100274371 | 3300018007 | Freshwater Sediment | VVTEVINRAEHALSQAMVQGLGKVMALGPAAMASGAVA |
| Ga0187864_102251852 | 3300018022 | Peatland | ESYDPVDIVTEVINRAEHALATSLVQGPGKVVALGAAMATGAVA |
| Ga0187857_100670663 | 3300018026 | Peatland | VDIVTEVINRAEFALAASLGQGPGKVMALGAALAAGAVA |
| Ga0187855_101776423 | 3300018038 | Peatland | VTEVINRAEHALAQAMAQGPGKIIALGPALAAGAVA |
| Ga0187855_108363192 | 3300018038 | Peatland | AVVKESYDPVDIVTEVINRAEHALATSLGQGHGKVVALGAAKAAGAVA |
| Ga0187766_112086991 | 3300018058 | Tropical Peatland | TEVINRAEQALSQAMTQGLGKIVALAPGLAAGAVA |
| Ga0187769_109070452 | 3300018086 | Tropical Peatland | VTEVINRAEFALSQAVAEGLGKIAALGPAAMAEGAVA |
| Ga0187769_110394852 | 3300018086 | Tropical Peatland | DPADVVTEVINRAEHALAQAMAQGPGKIVAEGPAPLAAGAVA |
| Ga0066669_114035913 | 3300018482 | Grasslands Soil | VTEIINRAEHALVQATAQGPGRVVALAPATLAAGAVA |
| Ga0193751_10006671 | 3300019888 | Soil | YDPVDVVTEVINRAEHALGQAMAQGPGKVVALGPALAAGAVA |
| Ga0210407_106286303 | 3300020579 | Soil | DIVTEVINRAEHALHTSLGQGHGKIVALGAARAAGAVA |
| Ga0210407_112945151 | 3300020579 | Soil | RESYDPVDIVTEVINRAEHALATSLVQGPGKVVALGAALAAGAVA |
| Ga0210403_110981682 | 3300020580 | Soil | TEVINRAEHALAQAMAQGPGKVVALGPAALAAGAVA |
| Ga0210395_109646151 | 3300020582 | Soil | DPIDVVTEVINRAEHALAQGMAQGPGHVVALGPALAAGAVA |
| Ga0210395_114441512 | 3300020582 | Soil | DPVDVVTEVINRAEHALAQAMAQGPGKIIALGPALAAGAVA |
| Ga0210406_102675271 | 3300021168 | Soil | VTEVINRAEQALALSLAQGPGKIVALGPALAAGAVA |
| Ga0210406_108036391 | 3300021168 | Soil | VTEVINRAEHALATSLVQGPGKVVALGAALAAGAVA |
| Ga0210388_115249451 | 3300021181 | Soil | IRTEFDPIDVVTEVINRVEHALGQAMSQGLGHVVALGPTVLAAGAVA |
| Ga0210393_102358722 | 3300021401 | Soil | SVTEVINRAEHALHTSLGQGHGKIVALGAARAAGAVA |
| Ga0210387_110964421 | 3300021405 | Soil | YDPVDIVTEVINRAEHALAQSLAQGPGKVVALSAALAAGAVA |
| Ga0210383_114640312 | 3300021407 | Soil | TEYDPADVVTEVINRAEHALAQAMAQGPGKIVALGPSTLVAGAVA |
| Ga0210384_102586592 | 3300021432 | Soil | VVRESYDPVDIVTEVINRAEHALATSLVQGPGKVVALGAALAAGAVA |
| Ga0210391_102591791 | 3300021433 | Soil | RTEYDPVDVVTEVINRAEHALSQAITQGPGKIVALGPALAAGAVA |
| Ga0210390_116498472 | 3300021474 | Soil | IVTEVINRAEHALHTSLGQGHGKIVALAAARAAGAVA |
| Ga0210402_109719502 | 3300021478 | Soil | PVDIVTEVINRAEHALATSLVQGPGKVVALGPALAAGAVA |
| Ga0224547_10126971 | 3300023255 | Soil | SYDPVDIVTEVINRAEHALATSLAQGPGKVVALGAALAAGAVA |
| Ga0208935_10161031 | 3300025414 | Peatland | IVTEVINRAEFALAASTVQGPGKVVALGAALVAGAVA |
| Ga0208034_10419992 | 3300025442 | Peatland | VTEVINRAEHALGQAMAQGPGKVVALGPALAAGAVA |
| Ga0207699_109627391 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | DPIDVVTEVINRAEHALQQAVAQGPGKVVALGPAALAAGAVA |
| Ga0207671_108057912 | 3300025914 | Corn Rhizosphere | VVTEIINRVEHALSQAVAQGPAKVVALGPAALAAGAVA |
| Ga0207665_105704912 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | DPVDVVTEVINRAEHALAQAMAQGPGKVVALGAAMAAGAVA |
| Ga0207679_108041723 | 3300025945 | Corn Rhizosphere | DVVTEIINRVEYALSQAVAQGPAKVVALEPAALAAGAVA |
| Ga0209131_10477274 | 3300026320 | Grasslands Soil | DPVDIVTEVINRAEHALATSLVQGPGKVVALAAALAAGAVA |
| Ga0209648_101131823 | 3300026551 | Grasslands Soil | VVRENYDPVDIVTEVINRAEHALAMALTQGPGKVTALGAALAAGAVA |
| Ga0209222_10675742 | 3300027559 | Forest Soil | VTEVINRAEFALATSVVQGPGKVVALGAALAAGAVA |
| Ga0209221_10946521 | 3300027609 | Forest Soil | VDIVTEVINRAEHALAQSLAQGPGKVVALSAALAAGAVA |
| Ga0209007_10250152 | 3300027652 | Forest Soil | DVVTEVINRAEHALSQAMAQGLGKVVTLGPAALAASAIA |
| Ga0209626_12151431 | 3300027684 | Forest Soil | VIRAEYDAADVVTEVINRAEHALGQAMAQGPGKIVALGAALAASAVA |
| Ga0209908_100144293 | 3300027745 | Thawing Permafrost | LQMCIRDRSYDPVDIVTEVINRAEHALATSMAQGPGKVVALGAALAAGAVA |
| Ga0209908_100843432 | 3300027745 | Thawing Permafrost | SYDPVDIVTEVINRAEFALATSVVQGPGKVVALGAALAAGAVA |
| Ga0209167_103106481 | 3300027867 | Surface Soil | YDPIDVVTEVINRAEHALQQAMAQGPGKVVALGPAALAAGAVA |
| Ga0209169_104953152 | 3300027879 | Soil | DIVTEVINRAEHALTTSLAHGLGKVVVLVAALAAGAVA |
| Ga0209169_106087061 | 3300027879 | Soil | VTEVINRAEHALASSLAQGHGKVVALGAALAAGAVA |
| Ga0209590_105800091 | 3300027882 | Vadose Zone Soil | VKDSYDPIDIVTEVINRAEHALATSLVQGPGKVVVLGAALAAGAVA |
| Ga0209526_109898911 | 3300028047 | Forest Soil | DIVTEVMNRAEHALAVALTNGPGKVTALGAALAAGAVA |
| Ga0137415_114893752 | 3300028536 | Vadose Zone Soil | PVDIVTEVINRVEHALATSVVQGPGKVVALGPALAAGAVA |
| Ga0302224_103730962 | 3300028759 | Palsa | AVVKESYDPLDIVTEVINRAEHALATSLVQGSGKVVALGAALAAVAVA |
| Ga0302221_100630982 | 3300028806 | Palsa | VIRTEYDPVDVVTEVINRAEHALSQAMVQGPGKIVALGQALAAGAVA |
| Ga0308309_106564492 | 3300028906 | Soil | AVVKQEYDPVDIVTEVINRAEHALAQSLVQGPGKVVALSAALAAGAVA |
| Ga0311330_105277671 | 3300029945 | Bog | VRESYDPVDIVTEVINRAEFALAASTVQGPGKVVALGAALAAGAVA |
| Ga0311346_108426712 | 3300029952 | Bog | VDIVTEVINRAEFALAASTVQGPGKIVALGAALVAGAVA |
| Ga0311339_115699232 | 3300029999 | Palsa | SYDPVDIVTEVINRAEHALATSLAHGLGKVVVLVAALAAGAVA |
| Ga0311357_106082213 | 3300030524 | Palsa | VVKQEYDPVDIVTEVINRAEHALAQSLAQGPGKVVALSAALAAGAVA |
| Ga0311345_111559371 | 3300030688 | Bog | TEVINRAEHALATSLGQGPGKVVALSPALAAGAVA |
| Ga0265762_10170201 | 3300030760 | Soil | QEYDPVDIVTEVINRAEHALAQSLTQGPGKVVALSAALATGAVA |
| Ga0265765_10689351 | 3300030879 | Soil | PIDIVTEVINRAEHALGSSLAQGPGKVVALGAALAAGAVA |
| Ga0073994_100118783 | 3300030991 | Soil | DVVTEVINRAEHALGQAMAQGPGKVVALGPALAAGAVA |
| Ga0170834_1137020621 | 3300031057 | Forest Soil | YDPIDVVTEIINRAEHALGQAMAQGPGKVVALEPAALAAGAVA |
| Ga0302325_106819981 | 3300031234 | Palsa | PLDIVTEVINRAEHALATSLAQGHGKIVALGAALAAGAVA |
| Ga0302325_127038641 | 3300031234 | Palsa | AVVKESYDPVDIVTEVINRAEQALTNSLAQGPGKVVALGAALAAGAVA |
| Ga0302324_1003101153 | 3300031236 | Palsa | IVTEVINRAEHALATSLAHGLGKVVVLVAALAAGAVA |
| Ga0265339_101144682 | 3300031249 | Rhizosphere | VTEVINRAEHALSQAMAQGPGKVVALGAALAAGAVA |
| Ga0302326_103304773 | 3300031525 | Palsa | DIVTEVINRAEHALATSLAHGLGKVVVLVAALAAGAVA |
| Ga0310686_1171481462 | 3300031708 | Soil | DIVTEVINRAEHALASSLAQGHGKVVALGAALAAGAGA |
| Ga0307474_104401801 | 3300031718 | Hardwood Forest Soil | SYDPVDIVTEVINRAEHALHTSLGQGHGKIVALGAARAAGAVA |
| Ga0307475_108035261 | 3300031754 | Hardwood Forest Soil | VVTEVINRVEHALGQAMSQGLGHVVALGPTVLAAGAVA |
| Ga0307478_100990231 | 3300031823 | Hardwood Forest Soil | DVVTEVINRVEHALAQAMGQGPGKIVALGPAVVAASAVA |
| Ga0307478_115424991 | 3300031823 | Hardwood Forest Soil | DPIDIVTEVINRAEHALATSLVQGPGKVVALSAAMAAAAVA |
| Ga0318522_103091082 | 3300031894 | Soil | DVVTEVINRVEHAVGQAMGQGLGHVVALGPTKAAGAAA |
| Ga0310909_104933391 | 3300031947 | Soil | TEFDPVDVVTEVINRAEHALGQAMGQGLGHVVALGPTALAAGAVA |
| Ga0307479_105419291 | 3300031962 | Hardwood Forest Soil | DPLDIVTEIINRVEHALAVALVQGPGKVVAMPAGLAAGAVA |
| Ga0311301_103382991 | 3300032160 | Peatlands Soil | VTEVINRAEHALSQAMSQGPGKIVALGPALASGAVA |
| Ga0311301_130541861 | 3300032160 | Peatlands Soil | VTEVINRAEHALAQAMAQGPGKVVALGPALAAGAVA |
| Ga0307472_1010153891 | 3300032205 | Hardwood Forest Soil | DPVDVVTEVINRVEHALAQAMAQGPGKVVALGPALAAGAVA |
| Ga0335082_113879332 | 3300032782 | Soil | EYDPVDIVTEVINRVEHALGQAMGQGLGHVVALGPTALAAGAVA |
| Ga0335079_102349883 | 3300032783 | Soil | VDVVTEVINRAEHALSQAMGQGPGKVVALGPAALAAGAVA |
| Ga0335081_102989063 | 3300032892 | Soil | VVTEVINRAEHALSQAMGQGPGKVVALGPAALAAGAVA |
| Ga0335081_123611891 | 3300032892 | Soil | VVTEVINRAEHALSQAMSQGPGKIVALGPTALAAGAVA |
| Ga0335083_100189156 | 3300032954 | Soil | VIRTEYDPIDVVTEVINRAEHALAQAMAQGPGKVVALGAALAAGAVA |
| Ga0335084_121461052 | 3300033004 | Soil | IVTEVINRVEHALGQAMGQGLGHVVALGPTALAAGAVA |
| Ga0316214_10441801 | 3300033545 | Roots | ESYDPIDIVTEVINRAEHALATSLVQGPGKVVALGAALAAGAVA |
| Ga0334847_031279_2_136 | 3300033826 | Soil | EYDPIDVVTEVINRAEHALGQAMAQGPGKVVALGPAVLAAGAVA |
| ⦗Top⦘ |