


| Basic Information | |
|---|---|
| Family ID | F050190 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 145 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MFNFSANHLFLLSRTEYRSCAVLLMQDRDTQRVYRL |
| Number of Associated Samples | 131 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 6.34 % |
| % of genes near scaffold ends (potentially truncated) | 93.79 % |
| % of genes from short scaffolds (< 2000 bps) | 85.52 % |
| Associated GOLD sequencing projects | 129 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.862 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (8.966 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.207 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 28.12% Coil/Unstructured: 71.88% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF01695 | IstB_IS21 | 73.10 |
| PF00665 | rve | 4.14 |
| PF00589 | Phage_integrase | 2.07 |
| PF13495 | Phage_int_SAM_4 | 0.69 |
| PF14319 | Zn_Tnp_IS91 | 0.69 |
| PF00027 | cNMP_binding | 0.69 |
| PF00364 | Biotin_lipoyl | 0.69 |
| PF02371 | Transposase_20 | 0.69 |
| PF02899 | Phage_int_SAM_1 | 0.69 |
| PF00474 | SSF | 0.69 |
| PF13542 | HTH_Tnp_ISL3 | 0.69 |
| PF05147 | LANC_like | 0.69 |
| PF07366 | SnoaL | 0.69 |
| PF00903 | Glyoxalase | 0.69 |
| PF13683 | rve_3 | 0.69 |
| PF01850 | PIN | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 73.10 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 4.14 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 4.14 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 4.14 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 4.14 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.69 |
| COG4403 | Lantibiotic modifying enzyme | Defense mechanisms [V] | 0.69 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.69 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.86 % |
| Unclassified | root | N/A | 4.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459004|F62QY1Z02GX6KP | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300005186|Ga0066676_10448640 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300005833|Ga0074472_11243794 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300006028|Ga0070717_11664736 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300006880|Ga0075429_101624107 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300006893|Ga0073928_10003689 | All Organisms → cellular organisms → Bacteria | 23738 | Open in IMG/M |
| 3300009081|Ga0105098_10426997 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300009089|Ga0099828_10053436 | All Organisms → cellular organisms → Bacteria | 3362 | Open in IMG/M |
| 3300009131|Ga0115027_10007964 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3800 | Open in IMG/M |
| 3300009137|Ga0066709_104350624 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300009168|Ga0105104_10370104 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300009174|Ga0105241_10944839 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300009176|Ga0105242_10420011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1253 | Open in IMG/M |
| 3300009525|Ga0116220_10386250 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300009628|Ga0116125_1109618 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300009636|Ga0116112_1120256 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300009646|Ga0116132_1260708 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300009665|Ga0116135_1074762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini | 1200 | Open in IMG/M |
| 3300009698|Ga0116216_10305262 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300009700|Ga0116217_10462563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 800 | Open in IMG/M |
| 3300009762|Ga0116130_1067996 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300009824|Ga0116219_10416806 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300010046|Ga0126384_10919084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 791 | Open in IMG/M |
| 3300010046|Ga0126384_11106560 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300010046|Ga0126384_11269857 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300010339|Ga0074046_10114379 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1735 | Open in IMG/M |
| 3300010361|Ga0126378_12231747 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300010379|Ga0136449_101376161 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300010379|Ga0136449_103601043 | Not Available | 588 | Open in IMG/M |
| 3300011432|Ga0137428_1210186 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300012210|Ga0137378_11841720 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300012285|Ga0137370_10631001 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300012356|Ga0137371_10682818 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300012363|Ga0137390_10200626 | All Organisms → cellular organisms → Bacteria | 1982 | Open in IMG/M |
| 3300012927|Ga0137416_11161768 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300012930|Ga0137407_10319102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1424 | Open in IMG/M |
| 3300012971|Ga0126369_11970392 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300013297|Ga0157378_10716670 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300014151|Ga0181539_1226051 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300014153|Ga0181527_1146239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1040 | Open in IMG/M |
| 3300014169|Ga0181531_10880774 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300014311|Ga0075322_1190368 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300014488|Ga0182001_10524938 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300014494|Ga0182017_10173825 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1386 | Open in IMG/M |
| 3300014496|Ga0182011_10249830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1191 | Open in IMG/M |
| 3300014501|Ga0182024_10220208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 2573 | Open in IMG/M |
| 3300014745|Ga0157377_10638375 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300015242|Ga0137412_10184512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Rhizocola → Rhizocola hellebori | 1672 | Open in IMG/M |
| 3300015372|Ga0132256_103288039 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300017941|Ga0187850_10060321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini | 1924 | Open in IMG/M |
| 3300017961|Ga0187778_10463318 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300017972|Ga0187781_10038577 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3292 | Open in IMG/M |
| 3300017995|Ga0187816_10539581 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300018004|Ga0187865_1064579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1420 | Open in IMG/M |
| 3300018009|Ga0187884_10057952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1784 | Open in IMG/M |
| 3300018012|Ga0187810_10087992 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1209 | Open in IMG/M |
| 3300018013|Ga0187873_1221355 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300018013|Ga0187873_1339645 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300018019|Ga0187874_10080415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1447 | Open in IMG/M |
| 3300018034|Ga0187863_10537714 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300018040|Ga0187862_10029558 | All Organisms → cellular organisms → Bacteria | 4158 | Open in IMG/M |
| 3300018043|Ga0187887_10612888 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300018088|Ga0187771_10370226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 1206 | Open in IMG/M |
| 3300018433|Ga0066667_11325483 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300018468|Ga0066662_12459586 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300018482|Ga0066669_10925706 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300019458|Ga0187892_10029053 | All Organisms → cellular organisms → Bacteria | 4618 | Open in IMG/M |
| 3300019788|Ga0182028_1214467 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300019789|Ga0137408_1139947 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300020199|Ga0179592_10080057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1498 | Open in IMG/M |
| 3300020200|Ga0194121_10408714 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300020221|Ga0194127_10303397 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300021404|Ga0210389_11061927 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300021432|Ga0210384_10450306 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
| 3300021474|Ga0210390_11383902 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300021560|Ga0126371_10070832 | All Organisms → cellular organisms → Bacteria | 3391 | Open in IMG/M |
| 3300023090|Ga0224558_1039014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 2062 | Open in IMG/M |
| 3300025496|Ga0208191_1016577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1864 | Open in IMG/M |
| 3300025915|Ga0207693_10988373 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300025927|Ga0207687_10780166 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300025941|Ga0207711_11315053 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300026142|Ga0207698_12588046 | Not Available | 517 | Open in IMG/M |
| 3300026328|Ga0209802_1081597 | All Organisms → cellular organisms → Bacteria | 1499 | Open in IMG/M |
| 3300026497|Ga0257164_1076243 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300027003|Ga0207722_1028452 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300027313|Ga0207780_1075573 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300027643|Ga0209076_1219900 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300027650|Ga0256866_1036033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1293 | Open in IMG/M |
| 3300027768|Ga0209772_10101580 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 884 | Open in IMG/M |
| 3300027773|Ga0209810_1022072 | All Organisms → cellular organisms → Bacteria | 4098 | Open in IMG/M |
| 3300027829|Ga0209773_10238985 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300027860|Ga0209611_10607080 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300027867|Ga0209167_10349938 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300027905|Ga0209415_10991488 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300028037|Ga0265349_1027846 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300028745|Ga0302267_10318383 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300028789|Ga0302232_10627298 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300028906|Ga0308309_10032903 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3576 | Open in IMG/M |
| 3300028906|Ga0308309_11896176 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300029636|Ga0222749_10647138 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300029636|Ga0222749_10685304 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300029883|Ga0311327_10645113 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300029889|Ga0246001_1073188 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300029939|Ga0311328_10046809 | All Organisms → cellular organisms → Bacteria | 3888 | Open in IMG/M |
| 3300029999|Ga0311339_11119312 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300029999|Ga0311339_11460017 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300030618|Ga0311354_11293031 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300031234|Ga0302325_10128361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 4628 | Open in IMG/M |
| 3300031234|Ga0302325_11013036 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1133 | Open in IMG/M |
| 3300031236|Ga0302324_101179903 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300031469|Ga0170819_12211979 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300031524|Ga0302320_10720836 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300031573|Ga0310915_10266472 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1207 | Open in IMG/M |
| 3300031573|Ga0310915_10305775 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300031616|Ga0307508_10491384 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300031679|Ga0318561_10501383 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300031708|Ga0310686_100613823 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300031708|Ga0310686_107489325 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3450 | Open in IMG/M |
| 3300031708|Ga0310686_108301083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini | 1179 | Open in IMG/M |
| 3300031744|Ga0306918_11131113 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300031796|Ga0318576_10101676 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1312 | Open in IMG/M |
| 3300031833|Ga0310917_10023278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3585 | Open in IMG/M |
| 3300031912|Ga0306921_11731215 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300031938|Ga0308175_102239628 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300031947|Ga0310909_11459799 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300031997|Ga0315278_11423801 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300032001|Ga0306922_10283603 | All Organisms → cellular organisms → Bacteria | 1779 | Open in IMG/M |
| 3300032068|Ga0318553_10315300 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300032160|Ga0311301_12840419 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300032782|Ga0335082_11417328 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300032783|Ga0335079_10766062 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300032828|Ga0335080_10954972 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300033402|Ga0326728_10567165 | Not Available | 897 | Open in IMG/M |
| 3300033405|Ga0326727_10111274 | All Organisms → cellular organisms → Bacteria | 3511 | Open in IMG/M |
| 3300033405|Ga0326727_11054698 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300033513|Ga0316628_100259206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 2135 | Open in IMG/M |
| 3300033828|Ga0334850_108964 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300033891|Ga0334811_088261 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300033977|Ga0314861_0002016 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 23280 | Open in IMG/M |
| 3300033977|Ga0314861_0191992 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300034091|Ga0326724_0297500 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300034091|Ga0326724_0520964 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.97% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.59% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 6.21% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.52% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.83% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.45% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 3.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.76% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.76% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.76% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.07% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 2.07% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.07% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.38% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.38% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.38% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.38% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.38% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.38% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.38% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.38% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.38% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.69% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.69% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.69% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.69% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.69% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.69% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.69% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.69% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.69% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.69% |
| Peat | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat | 0.69% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.69% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.69% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.69% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.69% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459004 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm (2) | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009636 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 | Environmental | Open in IMG/M |
| 3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011432 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2 | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014311 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
| 3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020200 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m | Environmental | Open in IMG/M |
| 3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
| 3300025496 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300027003 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 26 (SPAdes) | Environmental | Open in IMG/M |
| 3300027313 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 45 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027650 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeq | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027860 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028037 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 | Environmental | Open in IMG/M |
| 3300028745 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029889 | Peat microbial communities from Marcell Experimental Forest bog in Minnesota, USA - MG_T3F_30cm | Environmental | Open in IMG/M |
| 3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Host-Associated | Open in IMG/M |
| 3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033828 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P1 1-5 | Environmental | Open in IMG/M |
| 3300033891 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-D | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4B_01101160 | 2170459004 | Grass Soil | MFNFRANHLFLLSRTEYRKCAVFLLRDLDTQRVYRLYDFTKALL |
| Ga0066676_104486402 | 3300005186 | Soil | MFNFSANHLTLLSRTEYRSCAVFMVLDHSTHRVYRLHDFT |
| Ga0074472_112437941 | 3300005833 | Sediment (Intertidal) | MFNFSANHLFLISRTEYPSYAVFLMQDRDTQRVYR |
| Ga0070717_116647361 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MFNFSANHLFLLSRTEYSSCALLLMFDRDTRRVYRLFDF |
| Ga0075429_1016241072 | 3300006880 | Populus Rhizosphere | MFNFSANHLFLLSRTERLTCAVFLLRDLDTQRVYRL |
| Ga0073928_100036891 | 3300006893 | Iron-Sulfur Acid Spring | MFNFSANHLFLISRTEYASCAVLLMLDHDTRCVYRLLDFTKRLNLRSVD* |
| Ga0105098_104269972 | 3300009081 | Freshwater Sediment | MFNFSANNLTLLSRTECASCFVFVMKDHHTKRVYRLY |
| Ga0099828_100534361 | 3300009089 | Vadose Zone Soil | MFNFSANHLILLSRTECERCAVFVMKDDSTRRVYR |
| Ga0115027_100079645 | 3300009131 | Wetland | MFCFSASNLILLSKTEGRSCFVFVMKDRHTNRTYRL |
| Ga0066709_1043506242 | 3300009137 | Grasslands Soil | MFNFSANHLLLLSRMEYRSCVVFVMKDDSTRRVYRV* |
| Ga0105104_103701041 | 3300009168 | Freshwater Sediment | MFNFGANNLSLLSRTECRSCVVFLMKDLDTKRVYRLYD |
| Ga0105241_109448392 | 3300009174 | Corn Rhizosphere | MFNFTANHLLLLSRMEYRTYVVLLMRDDSTRRVYRLHDFTKLQMP |
| Ga0105242_104200111 | 3300009176 | Miscanthus Rhizosphere | MFNFSANHLLLLSRMEYRTCAVLLMRDDSTRRVYRL |
| Ga0116220_103862501 | 3300009525 | Peatlands Soil | MFNFSANHLFLLSRTEYPSCAVFLFKDLDTQHVYRLHDFTKAQ |
| Ga0116125_11096182 | 3300009628 | Peatland | MFNFSANHLFLLSRTEYRSCAVFALLDRDTQRVYRLL |
| Ga0116112_11202561 | 3300009636 | Peatland | MFNFSANHLFLLSRTEYRKCAVFLLRDLDTQRVYRLYD |
| Ga0116132_12607081 | 3300009646 | Peatland | MFNFSANHLFLLSRKEYRSCAVLWMLDRDTQRVYRLHDFTKSHHL |
| Ga0116135_10747623 | 3300009665 | Peatland | MFNFSANHLFLLSRTEYSSCAVFLLRDLDTQRVDRLHDFTKAKLI |
| Ga0116216_103052622 | 3300009698 | Peatlands Soil | MFNFSANHLILLSRTECRSCVVFVMKDDSTRRVYRLY |
| Ga0116217_104625632 | 3300009700 | Peatlands Soil | MFNFSANHLFLLKRTEHRSCAVFLMQDDFTRRVYRL |
| Ga0116130_10679962 | 3300009762 | Peatland | MFNFSANHLLLLSRMEYRTCAVLLMRDDSTRRVYRLH |
| Ga0116219_104168061 | 3300009824 | Peatlands Soil | MFNFSANHLLLLSRTEYRTCAVFLMQDDSTHRVYRL |
| Ga0126384_109190843 | 3300010046 | Tropical Forest Soil | MFNFSANHLVLLSRTECRRCVVFVMKDDSTRRVYRLYDF |
| Ga0126384_111065601 | 3300010046 | Tropical Forest Soil | MFNFSANHLHLLSRMEYRSCVVFLMQDHSTRRVYR |
| Ga0126384_112698572 | 3300010046 | Tropical Forest Soil | MFNFSANHLLLLSRKEYRTCAVLLMRDDSTRRVYRLHDFTKSHAP |
| Ga0074046_101143791 | 3300010339 | Bog Forest Soil | MFNFSANHLFLLSRTEYRSCAVLLLVDRDTQRVYRLHD |
| Ga0126378_122317472 | 3300010361 | Tropical Forest Soil | MFNFSANHLLLLSRMEYRRCVVFLMQDHSTRRVYRL |
| Ga0136449_1013761612 | 3300010379 | Peatlands Soil | MFNFSANHLLLLSRMEYRSCVVFLMQDHSTRRVYR |
| Ga0136449_1036010432 | 3300010379 | Peatlands Soil | MFNFSTNHLTLLSRTDLRFCAVFMVLDHSTHRVYRRHDLTKAHAMDPPNR* |
| Ga0137428_12101862 | 3300011432 | Soil | MFNFSANHLALISRTEYRSCAVFLMKDDSTHRVYR |
| Ga0137378_118417201 | 3300012210 | Vadose Zone Soil | MFNFSANHLFLLSRTEYRSYVVFVMQDHSTRRVYR |
| Ga0137370_106310011 | 3300012285 | Vadose Zone Soil | MFNFSANHLLLLSRMEYRSCVVFLMKDDSTRRVYRL |
| Ga0137371_106828182 | 3300012356 | Vadose Zone Soil | MFNFSANHLALISRTESRSCAVFLMRDDSTHRVYR |
| Ga0137390_102006261 | 3300012363 | Vadose Zone Soil | MFNFSANHLFLISRTEYASCAVLLMLDHDTRRVYRLLDFTKR |
| Ga0137416_111617681 | 3300012927 | Vadose Zone Soil | MFNFSANHLLLLSRMEYRTCVVFLMQDDSTRRVYRL |
| Ga0137407_103191021 | 3300012930 | Vadose Zone Soil | MFNVSANHLVLLSRTECRRCVVFVMKDDSTRRVYRLYDFTKSRIITPEKY |
| Ga0126369_119703922 | 3300012971 | Tropical Forest Soil | MFNFSANHLLLLSRTEYRSCVVFVMRDDTTRRVYRL |
| Ga0157378_107166702 | 3300013297 | Miscanthus Rhizosphere | MFNFSANHLFLLSRTEYPACAVFLLKDHDTKRVYRLYDF |
| Ga0181539_12260511 | 3300014151 | Bog | MFNFSANHLLLLSRTEYRSCAVFLMQDYSTRRVYRLY |
| Ga0181527_11462393 | 3300014153 | Bog | MFNFSANHLLLLSRMEYRTCVVFLMQDHSTRRVYR |
| Ga0181531_108807742 | 3300014169 | Bog | MFNFSANHLLLLSRTEYPSCAVFLLRDLDTQRVYRLHD |
| Ga0075322_11903682 | 3300014311 | Natural And Restored Wetlands | MFNFSANHLLLLSRTEYRKCAVFLLRDLDTQRVYRLHDFT |
| Ga0182001_105249381 | 3300014488 | Soil | MFNFSANHLLLLSRTECRSCAVFVLRDDSTRRVYRLYG |
| Ga0182017_101738253 | 3300014494 | Fen | MFNFSANHLLLLSRTEYPSYAVFLLRDLDTQRVYRLL* |
| Ga0182011_102498303 | 3300014496 | Fen | MFNFSANHLFLLSRTEYRSCAVLLMQDRDTQRVYR |
| Ga0182024_102202083 | 3300014501 | Permafrost | MFNFSANHLFLLSRTEYPSCAVFLLRDLDTKRVYRL |
| Ga0157377_106383752 | 3300014745 | Miscanthus Rhizosphere | MFNFSANHLFLLSRTEYRSCAVFLLRDGDTKRVYRL |
| Ga0137412_101845121 | 3300015242 | Vadose Zone Soil | MFNFSANHLFLISRTEHPSYAVLLMQDRDTKRVYRL |
| Ga0132256_1032880391 | 3300015372 | Arabidopsis Rhizosphere | MFNFSANHLFLISRTEYSSCAVLLMLDHDTRRVYRLFD |
| Ga0187850_100603213 | 3300017941 | Peatland | MFNFSANHLTLLSRTEYRSCAVFMVLDHSTHRVYRLHDFTK |
| Ga0187778_104633182 | 3300017961 | Tropical Peatland | MFNFSANHLRLLSRTEYRSCAVFLLQDDSTRRVYRL |
| Ga0187781_100385771 | 3300017972 | Tropical Peatland | MFNFSANHLTLLSRTEYRSCAVFMVLDHSTHRVYRLHD |
| Ga0187782_107960572 | 3300017975 | Tropical Peatland | MFNLSANHLFLLSRKEYRSCAVLMPVDGDTQRVYRLHDFTKTHHLVPGQAYCVAG |
| Ga0187816_105395812 | 3300017995 | Freshwater Sediment | MFNFSANHLFLLSRKEYRSCAVFLILDRDTQRVYRMHDF |
| Ga0187865_10645791 | 3300018004 | Peatland | MFNFSANHLLLLSRTEYQKCAVFLLQDLDTQRVYRLYD |
| Ga0187884_100579523 | 3300018009 | Peatland | MFNFSANHLFLLSRKEYRSCAVLLMLDRDTQRVYRLHDFT |
| Ga0187810_100879923 | 3300018012 | Freshwater Sediment | MFNFSANHLFLISRTEYPSCAVLLMLDRDTQRVYRLLD |
| Ga0187873_12213552 | 3300018013 | Peatland | MFNFSANHLILLSRTEYASCAVFVMLDLDTRRVYRLFDF |
| Ga0187873_13396451 | 3300018013 | Peatland | MFNFSANHLFLLSRKEYRSCAVLLLLDRDTQRVYR |
| Ga0187874_100804153 | 3300018019 | Peatland | MFNFSANHLLLLSRTEYQKCAVFLLRDLDTQRVYRL |
| Ga0187863_105377142 | 3300018034 | Peatland | MVNFSANHLFLISRTEYRKWAVFLLQDLDTQRVYRLYDFT |
| Ga0187862_100295588 | 3300018040 | Peatland | MFNFSANHLFLLSRKEPRSCPVLLLVDRDTQRVYRLHDFTKTHH |
| Ga0187887_106128882 | 3300018043 | Peatland | MFNLSANHLFLLSRTEYRKCAVFLLRDLDTQRVYRLYDFTKALLLRPGVA |
| Ga0187771_103702261 | 3300018088 | Tropical Peatland | MFNFSANHLCLLSRKEYRSCAVLLLIDRDTQRVYRL |
| Ga0066667_113254832 | 3300018433 | Grasslands Soil | MFNFSANHLFLLSRTEYRTCVVFIMQDHSTHRVYRL |
| Ga0066662_124595862 | 3300018468 | Grasslands Soil | MFNFSANHLLLFSRTEYRSCAVFLMQDHSTRRVYRL |
| Ga0066669_109257061 | 3300018482 | Grasslands Soil | MFNFSANHLFLLSRKEYRSCAVLLLLDHDTQRVYRL |
| Ga0187892_100290535 | 3300019458 | Bio-Ooze | MFNFSANHLLLLSRMEYPSCVVFLMRDDSTGRVYR |
| Ga0182028_12144672 | 3300019788 | Fen | MFNFSANHLFLLSRTEYQKCAVFLLRDLDTQRVYR |
| Ga0137408_11399471 | 3300019789 | Vadose Zone Soil | MFNFSANHLLLLSRTEYQKCAVFLLREDLDTQRVYR |
| Ga0179592_100800571 | 3300020199 | Vadose Zone Soil | MFNFSANHLLLLSRMEYRSCVVFLMKDDSTRQVYRLY |
| Ga0194121_104087141 | 3300020200 | Freshwater Lake | MFDFSANHLFLLQRTEYRTCAVFYVLDGDTKRVYR |
| Ga0194127_103033972 | 3300020221 | Freshwater Lake | MFNFSANHLLLISRTEYPSYAVLRMRDRDTQRVYRLYDP |
| Ga0210389_110619271 | 3300021404 | Soil | MFNFSANHLLLLSRKEYRTCAVLLMRDDSTRRVYRLHDFTK |
| Ga0210384_104503062 | 3300021432 | Soil | MFNFSANHLHLLSRTEYRSCVVFVMVDDSTRRCYRLYAFT |
| Ga0210390_113839021 | 3300021474 | Soil | MFNFSANHLFLLSRTEYPSCALFLLRDLDTQRVYRLH |
| Ga0126371_100708321 | 3300021560 | Tropical Forest Soil | MFNFSANHLLLLSRMEYRSCVVFLMQDHSTRRVYRL |
| Ga0224558_10390141 | 3300023090 | Soil | MFNFSANHLLLLSRMEYRTCVVFLMKDDSTRRVYR |
| Ga0208191_10165771 | 3300025496 | Peatland | MFNFSANHLILLSRTEYASCAVFVMLDLDTRRVYRLLDF |
| Ga0207693_109883732 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MFNFSANHLLLISRTEYPSYAVLLMQDRDTQRVYRLYD |
| Ga0207687_107801663 | 3300025927 | Miscanthus Rhizosphere | MFNFSANHLFLLSRTEYRSCVVFVMKDDSTRRCYRLY |
| Ga0207711_113150532 | 3300025941 | Switchgrass Rhizosphere | MFNFSANHLLLLSRMEYRTCAVLLMRDDSTHRVYRLHDF |
| Ga0207698_125880462 | 3300026142 | Corn Rhizosphere | MFNFSANNLFLLTRTEYPKYAVFLLQDRDTQRVYRL |
| Ga0209802_10815973 | 3300026328 | Soil | MFNFSANHLLLLSRTEYRTCVVFLMQDDSTRRVYRLYD |
| Ga0257164_10762432 | 3300026497 | Soil | MFNFSANHLFLISRTAYASCAVLVMLDHDTRRVYRLFDFTKCL |
| Ga0207722_10284521 | 3300027003 | Tropical Forest Soil | MFNFSANHLFLLLRTEYRSCAVFLMQDRDTQRVYRL |
| Ga0207780_10755731 | 3300027313 | Tropical Forest Soil | MFNFSANHLLLLSPTEYRTCTVLLMRDDSTRRVYRL |
| Ga0209076_12199001 | 3300027643 | Vadose Zone Soil | MFNFSANHLLLLSRTEYRTCVVFLMQDHSTRRVYRL |
| Ga0256866_10360331 | 3300027650 | Soil | MFNFSANHLLLLSRTEYPSCAVFLLRDLDTQRVYRL |
| Ga0209772_101015801 | 3300027768 | Bog Forest Soil | MFNFSANHLFLLSRTEYRKCAVFLLRDLDTQRVYR |
| Ga0209810_10220722 | 3300027773 | Surface Soil | MFNFSANHLFLLSRKEYRSWAVLLLLDRDTQRVYRLHDFAKTHHLGPG |
| Ga0209773_102389851 | 3300027829 | Bog Forest Soil | MFNFSANHLLLLSRTEYRSCVVFVMKDDSTHRVYRLHDF |
| Ga0209611_106070801 | 3300027860 | Host-Associated | MFNFSANHLFLISRTEYSSCALLLMLDHDTRRVYRLLDFTKRLRPLPG |
| Ga0209167_103499382 | 3300027867 | Surface Soil | MFNFSANHLVLLSRTECERCLVFVMKDDSTRRVYRLYDF |
| Ga0209415_109914881 | 3300027905 | Peatlands Soil | MFNFSANHLLLLSRTDYPSYAVFLLRDLDTQRVYRLYD |
| Ga0265349_10278461 | 3300028037 | Soil | MFNFSASHLRLLSRMEYRTCVVFLMQDDFTHRVYRLY |
| Ga0302267_103183832 | 3300028745 | Bog | MFNFSANHLLLLSRMECRSCVVFVMRDDSTRRVYRL |
| Ga0302232_106272981 | 3300028789 | Palsa | MFHCSANHLLLLSRMEYRTCAVLLMRDDSTRRVYRLHDFTKSQTPTPGQ |
| Ga0308309_100329031 | 3300028906 | Soil | MFNFSANHLFLLSRTEYSSCAVFLMLDHDTQRVYRPG |
| Ga0308309_118961761 | 3300028906 | Soil | MFNFSANHLLLLSRTEYPSCAVFLLRDLDTKRVYRLHDFTK |
| Ga0222749_106471382 | 3300029636 | Soil | MFNFSANHLLLLSRMEYRSCVVFLMKDDSTRRVYR |
| Ga0222749_106853042 | 3300029636 | Soil | MFNFSANHLFLISRTEYASCAVLVMLDHDTRRVYRLFDF |
| Ga0311327_106451131 | 3300029883 | Bog | MFNFSANHLFLLSRTEYPSCAVFLLRDLDTQRVYR |
| Ga0246001_10731882 | 3300029889 | Peat | MFNFSANHLFLLSRKEYRSCAVLLLLDRDTQRVYRL |
| Ga0311328_100468096 | 3300029939 | Bog | MFNFSANHLLLLSRTEYPSCAVFLLRDLDTQRVYR |
| Ga0311339_111193121 | 3300029999 | Palsa | MFNFSANHLILLSRTECRRCVVFVMKDDSTRRVYRLYD |
| Ga0311339_114600171 | 3300029999 | Palsa | MFNFSANHLFLLSRTEYQKCAVFVLRDLDTQRVYRLY |
| Ga0311354_112930311 | 3300030618 | Palsa | MFHCSANHLLLLSRMEYRTCAVLLMRDDSTRRVYR |
| Ga0302325_101283617 | 3300031234 | Palsa | MFHCSANHLLLLSRMEYRTCAVLLMRDDSTRRVYRLHD |
| Ga0302325_110130363 | 3300031234 | Palsa | MFNFSANHLLLLSRTEYPSCAVFLLRDLDTQRVYRHH |
| Ga0302324_1011799031 | 3300031236 | Palsa | MFNFSANHLLLLSRTEYQKCAVFLLRDLDTQRVYR |
| Ga0170819_122119792 | 3300031469 | Forest Soil | MFNFSANHLLLLSRMEYRTCVVFLMKDDSTRRVYRL |
| Ga0302320_107208362 | 3300031524 | Bog | MFNFSANHLFLLSRTEYPSCAVFLLRDLDTQRVYRLHD |
| Ga0310915_102664721 | 3300031573 | Soil | MFNFSANHLLLLSRREYPSCVVFLMQDHSTRRVYRLYD |
| Ga0310915_103057753 | 3300031573 | Soil | MFNFSANHLLLLSRMEYRTCAVLLMRDDSTRRVYR |
| Ga0307508_104913841 | 3300031616 | Ectomycorrhiza | MFNFSANHLLLLSRMEYRTCAVLLMRDDSTHRVYRL |
| Ga0307374_1000365924 | 3300031670 | Soil | MFNFSAKHLFLLSRKEYRSCAVLLLLDRGTQRVYRLHDFTKTHRLGSTGGPVHA |
| Ga0318561_105013831 | 3300031679 | Soil | MFNFSANHLVLISRTEYPSYAVLLMQDHDTRRVYR |
| Ga0310686_1006138231 | 3300031708 | Soil | MFNFSANHLFLLSRTEYRSCVVFVMKDDSTHRVYRLHD |
| Ga0310686_1074893251 | 3300031708 | Soil | MFNFSANHLFLLSRTEYRSCAVLLLLDRDTQRVYR |
| Ga0310686_1083010831 | 3300031708 | Soil | MFNFSANHLILLSRTECRRCVVFVMKDDSTRRVYRL |
| Ga0306918_111311132 | 3300031744 | Soil | MFNFSANHLLLLSRMEYRGCVVFLMQDHSTHRVYR |
| Ga0318576_101016761 | 3300031796 | Soil | MFNFSANHLVLISRTEYPSYAVLLMRDHDTRRVYRLYD |
| Ga0310917_100232786 | 3300031833 | Soil | MFNFSANHLLLLSRTEHRTCVVFLMQDDSTHRLYR |
| Ga0306921_117312151 | 3300031912 | Soil | MLMLRANPLLLLSPTEYPSCAVFLLRDLDTQRVYRLYDFT |
| Ga0308175_1022396281 | 3300031938 | Soil | MFNFSANHLFLLSRTEYPSCAVFLLQDRDTKRVYRLY |
| Ga0310909_114597991 | 3300031947 | Soil | MFNFSANHLFLLSRTEYCSCALLLMLDRDTRRVYRLFDFTKR |
| Ga0315278_114238011 | 3300031997 | Sediment | MFNFSANNLILLSRTECKSCVIFVMKDLHTKRLYRLY |
| Ga0306922_102836032 | 3300032001 | Soil | MFNFSANHLFLHSRTEYPSCVVFLLRDLDTQRVYRLYDFTK |
| Ga0318553_103153001 | 3300032068 | Soil | MFNFSANHLFLLSRTEYASCAVLVMLDHDTRRVYR |
| Ga0311301_128404191 | 3300032160 | Peatlands Soil | MFNFSANHLLLLSRTEYPSCAVFLLRDIDPQRVYR |
| Ga0335082_114173281 | 3300032782 | Soil | MFNFSANHLFLLSRTEYPSCAVFLFKDLDTQRVYRLHDFTK |
| Ga0335079_107660621 | 3300032783 | Soil | VFNFSANHLILISRTEYPSHAVLLMRDRDTQRVYRL |
| Ga0335080_109549723 | 3300032828 | Soil | MFNFSANHLFLLSRTEYSSCAVLLMLDHDTQRVYRLFDF |
| Ga0335077_102213171 | 3300033158 | Soil | MFNFSANHPFLLSRTEYASCAVLVMLDHDTQRVYRLFDFTKRLRLFAHKPSS |
| Ga0326728_105671651 | 3300033402 | Peat Soil | MFNFCANHLTLLSRTEYRPCAVFMVLHHSTHRVYRLHDFT |
| Ga0326727_101112741 | 3300033405 | Peat Soil | MFNFSANHLLLLSRKEYRSCAVLLLLDRDTQHVYRLHDFTGLTTR |
| Ga0326727_110546981 | 3300033405 | Peat Soil | MFNFSANHLALLSRTEYRSCAVFMVLDHSTHRVYRL |
| Ga0316628_1002592061 | 3300033513 | Soil | MFNFSANRLLLLSRMEYRTCAVLLMRDDSTRRVYR |
| Ga0334850_108964_1_114 | 3300033828 | Soil | MFNFSANHLLLLSRMEYRTCVVFLMKDDSTHRVYRLYD |
| Ga0334811_088261_3_110 | 3300033891 | Soil | MFNFSANHLFLLSRTEYRSCAVLLMQDRDTQRVYRL |
| Ga0314861_0002016_23168_23278 | 3300033977 | Peatland | MFNFSANHLFLLSRKEYRSCAVLLLVDRDTQRVYRLH |
| Ga0314861_0191992_3_131 | 3300033977 | Peatland | MFNFSANHLFLLSRKEYRSCAVLLLLDRDTQRVYRLHDFTQSH |
| Ga0326724_0297500_2_118 | 3300034091 | Peat Soil | MFNFSANHLFLLSRKEYRSCAVLLLLDRDTQRVYRLHDF |
| Ga0326724_0520964_470_604 | 3300034091 | Peat Soil | MFNFSANHLLLISRTEYPSYAVLPMQDCDTKRVFRLYDFSKAQLI |
| ⦗Top⦘ |