


| Basic Information | |
|---|---|
| Family ID | F050000 |
| Family Type | Metagenome |
| Number of Sequences | 146 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MKNKKPNRDRTNKGEKVFQMKGTFDEVWKEYMKLNEQLKNN |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 146 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 17.12 % |
| % of genes near scaffold ends (potentially truncated) | 23.97 % |
| % of genes from short scaffolds (< 2000 bps) | 84.93 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (55.479 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (20.548 % of family members) |
| Environment Ontology (ENVO) | Unclassified (78.082 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (82.877 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.64% β-sheet: 0.00% Coil/Unstructured: 75.36% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 146 Family Scaffolds |
|---|---|---|
| PF08800 | VirE_N | 1.37 |
| PF08299 | Bac_DnaA_C | 1.37 |
| PF00118 | Cpn60_TCP1 | 0.68 |
| PF12684 | DUF3799 | 0.68 |
| PF00133 | tRNA-synt_1 | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 146 Family Scaffolds |
|---|---|---|---|
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 1.37 |
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.68 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 55.48 % |
| All Organisms | root | All Organisms | 44.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10038849 | All Organisms → Viruses → Predicted Viral | 2511 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10262960 | Not Available | 535 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10100643 | Not Available | 948 | Open in IMG/M |
| 3300000949|BBAY94_10168037 | Not Available | 593 | Open in IMG/M |
| 3300001355|JGI20158J14315_10028703 | All Organisms → Viruses → Predicted Viral | 2661 | Open in IMG/M |
| 3300001355|JGI20158J14315_10076959 | All Organisms → Viruses → Predicted Viral | 1242 | Open in IMG/M |
| 3300001450|JGI24006J15134_10085370 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium LiPW_30 | 1169 | Open in IMG/M |
| 3300001450|JGI24006J15134_10105911 | Not Available | 1000 | Open in IMG/M |
| 3300001460|JGI24003J15210_10145395 | Not Available | 614 | Open in IMG/M |
| 3300001460|JGI24003J15210_10150952 | Not Available | 595 | Open in IMG/M |
| 3300001460|JGI24003J15210_10157033 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium LiPW_30 | 575 | Open in IMG/M |
| 3300003543|FS898DNA_10918200 | Not Available | 656 | Open in IMG/M |
| 3300004097|Ga0055584_100811895 | Not Available | 979 | Open in IMG/M |
| 3300004461|Ga0066223_1063358 | All Organisms → Viruses → Predicted Viral | 1489 | Open in IMG/M |
| 3300005512|Ga0074648_1005777 | All Organisms → cellular organisms → Bacteria | 9391 | Open in IMG/M |
| 3300005601|Ga0070722_10466375 | Not Available | 563 | Open in IMG/M |
| 3300005612|Ga0070723_10042708 | Not Available | 1769 | Open in IMG/M |
| 3300006029|Ga0075466_1179360 | Not Available | 533 | Open in IMG/M |
| 3300006735|Ga0098038_1218763 | Not Available | 610 | Open in IMG/M |
| 3300006737|Ga0098037_1034466 | Not Available | 1859 | Open in IMG/M |
| 3300006737|Ga0098037_1268122 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 544 | Open in IMG/M |
| 3300006752|Ga0098048_1016230 | All Organisms → Viruses → Predicted Viral | 2541 | Open in IMG/M |
| 3300006793|Ga0098055_1010539 | Not Available | 4168 | Open in IMG/M |
| 3300006793|Ga0098055_1078659 | All Organisms → Viruses → Predicted Viral | 1299 | Open in IMG/M |
| 3300006803|Ga0075467_10489907 | Not Available | 633 | Open in IMG/M |
| 3300006919|Ga0070746_10439338 | Not Available | 580 | Open in IMG/M |
| 3300006920|Ga0070748_1047164 | All Organisms → Viruses → Predicted Viral | 1721 | Open in IMG/M |
| 3300006921|Ga0098060_1054555 | All Organisms → Viruses → Predicted Viral | 1177 | Open in IMG/M |
| 3300007229|Ga0075468_10118130 | Not Available | 826 | Open in IMG/M |
| 3300007236|Ga0075463_10068154 | All Organisms → Viruses → Predicted Viral | 1149 | Open in IMG/M |
| 3300007276|Ga0070747_1043543 | All Organisms → Viruses → Predicted Viral | 1739 | Open in IMG/M |
| 3300007538|Ga0099851_1019233 | All Organisms → Viruses → Predicted Viral | 2762 | Open in IMG/M |
| 3300007539|Ga0099849_1087586 | All Organisms → Viruses → Predicted Viral | 1253 | Open in IMG/M |
| 3300007539|Ga0099849_1363562 | Not Available | 513 | Open in IMG/M |
| 3300009071|Ga0115566_10266744 | All Organisms → Viruses → Predicted Viral | 1020 | Open in IMG/M |
| 3300009071|Ga0115566_10282383 | Not Available | 984 | Open in IMG/M |
| 3300009071|Ga0115566_10336602 | Not Available | 882 | Open in IMG/M |
| 3300009074|Ga0115549_1125208 | Not Available | 847 | Open in IMG/M |
| 3300009149|Ga0114918_10018469 | Not Available | 5296 | Open in IMG/M |
| 3300009193|Ga0115551_1071039 | All Organisms → Viruses → Predicted Viral | 1667 | Open in IMG/M |
| 3300009193|Ga0115551_1465360 | Not Available | 540 | Open in IMG/M |
| 3300009476|Ga0115555_1028967 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 2668 | Open in IMG/M |
| 3300009488|Ga0114925_11205593 | Not Available | 556 | Open in IMG/M |
| 3300010148|Ga0098043_1041463 | All Organisms → Viruses → Predicted Viral | 1428 | Open in IMG/M |
| 3300010148|Ga0098043_1098990 | Not Available | 852 | Open in IMG/M |
| 3300010150|Ga0098056_1166449 | Not Available | 742 | Open in IMG/M |
| 3300010153|Ga0098059_1204588 | Not Available | 768 | Open in IMG/M |
| 3300010153|Ga0098059_1299655 | Not Available | 614 | Open in IMG/M |
| 3300010155|Ga0098047_10159061 | Not Available | 872 | Open in IMG/M |
| 3300010296|Ga0129348_1141570 | Not Available | 835 | Open in IMG/M |
| 3300010392|Ga0118731_105053402 | All Organisms → Viruses → Predicted Viral | 1022 | Open in IMG/M |
| 3300010392|Ga0118731_108208657 | Not Available | 1097 | Open in IMG/M |
| 3300010392|Ga0118731_109540925 | Not Available | 1005 | Open in IMG/M |
| 3300010430|Ga0118733_101642671 | Not Available | 1280 | Open in IMG/M |
| 3300011126|Ga0151654_1041102 | Not Available | 596 | Open in IMG/M |
| 3300011129|Ga0151672_154658 | Not Available | 572 | Open in IMG/M |
| 3300012920|Ga0160423_10204353 | All Organisms → Viruses → Predicted Viral | 1375 | Open in IMG/M |
| 3300012953|Ga0163179_10655765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Heyndrickxia → Heyndrickxia sporothermodurans | 886 | Open in IMG/M |
| 3300013101|Ga0164313_11093328 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 647 | Open in IMG/M |
| 3300013103|Ga0164318_10669326 | Not Available | 879 | Open in IMG/M |
| 3300017706|Ga0181377_1006133 | All Organisms → Viruses → Predicted Viral | 3155 | Open in IMG/M |
| 3300017710|Ga0181403_1000695 | Not Available | 8212 | Open in IMG/M |
| 3300017710|Ga0181403_1006916 | Not Available | 2468 | Open in IMG/M |
| 3300017713|Ga0181391_1021915 | All Organisms → Viruses → Predicted Viral | 1586 | Open in IMG/M |
| 3300017713|Ga0181391_1074833 | Not Available | 778 | Open in IMG/M |
| 3300017713|Ga0181391_1112120 | Not Available | 613 | Open in IMG/M |
| 3300017724|Ga0181388_1141960 | Not Available | 571 | Open in IMG/M |
| 3300017727|Ga0181401_1110716 | Not Available | 692 | Open in IMG/M |
| 3300017738|Ga0181428_1164520 | Not Available | 518 | Open in IMG/M |
| 3300017740|Ga0181418_1007716 | All Organisms → Viruses → Predicted Viral | 3000 | Open in IMG/M |
| 3300017740|Ga0181418_1018711 | All Organisms → Viruses → Predicted Viral | 1819 | Open in IMG/M |
| 3300017749|Ga0181392_1040208 | All Organisms → Viruses → Predicted Viral | 1452 | Open in IMG/M |
| 3300017751|Ga0187219_1147418 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 680 | Open in IMG/M |
| 3300017751|Ga0187219_1231319 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 502 | Open in IMG/M |
| 3300017757|Ga0181420_1143780 | Not Available | 714 | Open in IMG/M |
| 3300017758|Ga0181409_1164914 | Not Available | 645 | Open in IMG/M |
| 3300017767|Ga0181406_1166357 | Not Available | 660 | Open in IMG/M |
| 3300017786|Ga0181424_10121902 | Not Available | 1123 | Open in IMG/M |
| 3300017786|Ga0181424_10362988 | Not Available | 594 | Open in IMG/M |
| 3300018428|Ga0181568_11184711 | Not Available | 574 | Open in IMG/M |
| 3300020165|Ga0206125_10058654 | All Organisms → Viruses → Predicted Viral | 1813 | Open in IMG/M |
| 3300020175|Ga0206124_10091785 | Not Available | 1268 | Open in IMG/M |
| 3300020385|Ga0211677_10015608 | All Organisms → Viruses → Predicted Viral | 3949 | Open in IMG/M |
| 3300020385|Ga0211677_10069849 | Not Available | 1576 | Open in IMG/M |
| 3300020417|Ga0211528_10127567 | All Organisms → Viruses → Predicted Viral | 1012 | Open in IMG/M |
| 3300020428|Ga0211521_10030415 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2955 | Open in IMG/M |
| 3300020428|Ga0211521_10311890 | Not Available | 698 | Open in IMG/M |
| 3300020438|Ga0211576_10038688 | Not Available | 2779 | Open in IMG/M |
| 3300020439|Ga0211558_10442917 | Not Available | 598 | Open in IMG/M |
| 3300021375|Ga0213869_10108859 | All Organisms → Viruses → Predicted Viral | 1339 | Open in IMG/M |
| 3300021378|Ga0213861_10368716 | Not Available | 715 | Open in IMG/M |
| 3300021957|Ga0222717_10083262 | All Organisms → Viruses → Predicted Viral | 2020 | Open in IMG/M |
| 3300021957|Ga0222717_10154846 | All Organisms → Viruses → Predicted Viral | 1392 | Open in IMG/M |
| 3300021958|Ga0222718_10072271 | All Organisms → Viruses → Predicted Viral | 2105 | Open in IMG/M |
| 3300021959|Ga0222716_10162690 | All Organisms → Viruses → Predicted Viral | 1446 | Open in IMG/M |
| 3300021964|Ga0222719_10286676 | All Organisms → Viruses → Predicted Viral | 1075 | Open in IMG/M |
| 3300022178|Ga0196887_1036912 | Not Available | 1320 | Open in IMG/M |
| 3300022178|Ga0196887_1116750 | Not Available | 578 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10514103 | Not Available | 542 | Open in IMG/M |
| 3300024262|Ga0210003_1006228 | Not Available | 8921 | Open in IMG/M |
| 3300024322|Ga0228656_1051449 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium LiPW_30 | 918 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10180129 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium LiPW_30 | 951 | Open in IMG/M |
| 3300025070|Ga0208667_1024141 | All Organisms → Viruses → Predicted Viral | 1148 | Open in IMG/M |
| 3300025071|Ga0207896_1019171 | All Organisms → Viruses → Predicted Viral | 1192 | Open in IMG/M |
| 3300025079|Ga0207890_1056725 | Not Available | 652 | Open in IMG/M |
| 3300025098|Ga0208434_1022272 | All Organisms → Viruses → Predicted Viral | 1570 | Open in IMG/M |
| 3300025099|Ga0208669_1010386 | All Organisms → cellular organisms → Bacteria | 2615 | Open in IMG/M |
| 3300025101|Ga0208159_1014732 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1997 | Open in IMG/M |
| 3300025108|Ga0208793_1034019 | All Organisms → Viruses → Predicted Viral | 1673 | Open in IMG/M |
| 3300025108|Ga0208793_1128386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
| 3300025120|Ga0209535_1080987 | All Organisms → Viruses → Predicted Viral | 1232 | Open in IMG/M |
| 3300025120|Ga0209535_1189601 | Not Available | 593 | Open in IMG/M |
| 3300025151|Ga0209645_1031341 | All Organisms → Viruses → Predicted Viral | 1955 | Open in IMG/M |
| 3300025570|Ga0208660_1014630 | All Organisms → Viruses → Predicted Viral | 2450 | Open in IMG/M |
| 3300025577|Ga0209304_1115355 | Not Available | 590 | Open in IMG/M |
| 3300025645|Ga0208643_1110038 | Not Available | 743 | Open in IMG/M |
| 3300025655|Ga0208795_1085397 | Not Available | 867 | Open in IMG/M |
| 3300025674|Ga0208162_1058108 | All Organisms → Viruses → Predicted Viral | 1268 | Open in IMG/M |
| 3300025674|Ga0208162_1058180 | All Organisms → Viruses → Predicted Viral | 1267 | Open in IMG/M |
| 3300025699|Ga0209715_1130928 | Not Available | 874 | Open in IMG/M |
| 3300025809|Ga0209199_1247246 | Not Available | 586 | Open in IMG/M |
| 3300025849|Ga0209603_1012515 | Not Available | 5878 | Open in IMG/M |
| 3300025892|Ga0209630_10226477 | Not Available | 892 | Open in IMG/M |
| 3300025897|Ga0209425_10111376 | All Organisms → Viruses → Predicted Viral | 1601 | Open in IMG/M |
| 3300027852|Ga0209345_10370370 | Not Available | 851 | Open in IMG/M |
| (restricted) 3300027856|Ga0255054_10434588 | Not Available | 638 | Open in IMG/M |
| 3300027858|Ga0209013_10251172 | All Organisms → Viruses → Predicted Viral | 1037 | Open in IMG/M |
| (restricted) 3300027868|Ga0255053_10219768 | Not Available | 916 | Open in IMG/M |
| (restricted) 3300027881|Ga0255055_10036965 | All Organisms → Viruses → Predicted Viral | 2753 | Open in IMG/M |
| (restricted) 3300027881|Ga0255055_10100658 | Not Available | 1595 | Open in IMG/M |
| 3300028124|Ga0228621_1074177 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium LiPW_30 | 521 | Open in IMG/M |
| 3300028128|Ga0228645_1047387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 958 | Open in IMG/M |
| 3300028194|Ga0257106_1241206 | Not Available | 608 | Open in IMG/M |
| 3300029293|Ga0135211_1004420 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1072 | Open in IMG/M |
| 3300029293|Ga0135211_1028239 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 666 | Open in IMG/M |
| 3300029293|Ga0135211_1032953 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium LiPW_30 | 633 | Open in IMG/M |
| 3300029293|Ga0135211_1036424 | Not Available | 610 | Open in IMG/M |
| 3300029301|Ga0135222_1014789 | Not Available | 623 | Open in IMG/M |
| 3300029301|Ga0135222_1024236 | Not Available | 512 | Open in IMG/M |
| 3300029306|Ga0135212_1002970 | All Organisms → Viruses → Predicted Viral | 1093 | Open in IMG/M |
| 3300029309|Ga0183683_1030945 | Not Available | 937 | Open in IMG/M |
| 3300029345|Ga0135210_1025092 | Not Available | 629 | Open in IMG/M |
| 3300029753|Ga0135224_1001715 | All Organisms → Viruses → Predicted Viral | 1095 | Open in IMG/M |
| 3300032073|Ga0315315_10516893 | Not Available | 1106 | Open in IMG/M |
| 3300032274|Ga0316203_1036734 | Not Available | 1423 | Open in IMG/M |
| 3300032277|Ga0316202_10221277 | Not Available | 879 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 20.55% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 13.01% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 11.64% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 7.53% |
| Marine Harbor | Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor | 6.16% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 5.48% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 3.42% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 3.42% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.42% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 3.42% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 2.05% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 2.05% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 2.05% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.05% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 1.37% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.37% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 1.37% |
| Marine | Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine | 1.37% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.68% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.68% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.68% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.68% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.68% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.68% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.68% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.68% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.68% |
| Diffuse Hydrothermal Flow Volcanic Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent | 0.68% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.68% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300003543 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS898_N3Area_DNA | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005601 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 | Environmental | Open in IMG/M |
| 3300005612 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
| 3300009488 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300011126 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02 | Environmental | Open in IMG/M |
| 3300011129 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, 0.02 | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300013101 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cm | Environmental | Open in IMG/M |
| 3300013103 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay9, Core 4571-4, 0-3 cm | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
| 3300020417 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082) | Environmental | Open in IMG/M |
| 3300020428 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024322 | Seawater microbial communities from Monterey Bay, California, United States - 68D | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025079 | Marine viral communities from the Pacific Ocean - LP-48 (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025570 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025577 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025699 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes) | Environmental | Open in IMG/M |
| 3300025809 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025897 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes) | Environmental | Open in IMG/M |
| 3300027852 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 7 (SPAdes) | Environmental | Open in IMG/M |
| 3300027856 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_23 | Environmental | Open in IMG/M |
| 3300027858 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027868 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_22 | Environmental | Open in IMG/M |
| 3300027881 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27 | Environmental | Open in IMG/M |
| 3300028124 | Seawater microbial communities from Monterey Bay, California, United States - 25D | Environmental | Open in IMG/M |
| 3300028128 | Seawater microbial communities from Monterey Bay, California, United States - 57D | Environmental | Open in IMG/M |
| 3300028194 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m | Environmental | Open in IMG/M |
| 3300029293 | Marine harbor viral communities from the Indian Ocean - SCH2 | Environmental | Open in IMG/M |
| 3300029301 | Marine harbor viral communities from the Indian Ocean - SRH1 | Environmental | Open in IMG/M |
| 3300029306 | Marine harbor viral communities from the Indian Ocean - SCH3 | Environmental | Open in IMG/M |
| 3300029309 | Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440 | Environmental | Open in IMG/M |
| 3300029345 | Marine harbor viral communities from the Indian Ocean - SCH1 | Environmental | Open in IMG/M |
| 3300029753 | Marine harbor viral communities from the Indian Ocean - SRH3 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300032274 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100388499 | 3300000101 | Marine | MKNNKKPNRDRSNKGEKVFQMKGTFQEVWKEYMKLNEQLKNN* |
| DelMOSum2010_102629603 | 3300000101 | Marine | MKNKKKLSRDRTNKGDKVFQMKGTFQEVWKEYMKLNEQLKNS* |
| DelMOSum2011_101006433 | 3300000115 | Marine | MNKKKLSRDRTNKGDKVFQMKGTFQEVWKEYMKLNEQLKNS* |
| BBAY94_101680373 | 3300000949 | Macroalgal Surface | MKNKKQNRDRTNKGEKVYHIKGTFNEVWQEYVKLNQQFKNGTIK* |
| JGI20158J14315_100287036 | 3300001355 | Pelagic Marine | MKNKKKLSRDRVNKGEKVFQMKGTFDEVWKEYMKLNEQLKNN* |
| JGI20158J14315_100769596 | 3300001355 | Pelagic Marine | MKNKKKLSRARANKGEKVFQMKGTFDEVWKEYMKLNEQLKN |
| JGI24006J15134_100853703 | 3300001450 | Marine | MENKKKXNRDRSSKGEKVFQMKGTFQEVWKEYVKLNEQLKNN* |
| JGI24006J15134_101059113 | 3300001450 | Marine | MKNKKPNRDKSSKGEKVFQMKGTFQEVWKEYVKLNEQLKNN* |
| JGI24003J15210_101453953 | 3300001460 | Marine | MKNKKPNRDRSSKGEKVFQMKGTFQEVWKEYVKLNEQLKNN* |
| JGI24003J15210_101509521 | 3300001460 | Marine | MENKKKLNRDRSSKGEKVFQMKGTFQEVWKEYVKLNEQL |
| JGI24003J15210_101570331 | 3300001460 | Marine | MENKKKPSRKRTNKGEKVFHMKGTFQEVWKEYVKLNEQLKNN* |
| FS898DNA_109182002 | 3300003543 | Diffuse Hydrothermal Flow Volcanic Vent | MKKKKPNRERTNKGEKIFQMKGTFQEVWKEYVKLNEQLKNN* |
| Ga0055584_1008118952 | 3300004097 | Pelagic Marine | MNNKKKLSRDRANKGEKVFQMKGTFQEVWKEYMKLNEQLKNN* |
| Ga0066223_10633583 | 3300004461 | Marine | MKKLSRDRVNKGEKVFQMKGTFQEVWKEYMKLNDQLKNS* |
| Ga0074648_100577715 | 3300005512 | Saline Water And Sediment | MKNKKQNRDRTDKGEKVYHFKGTFQEVWKEYLKLNQQFKNNYGN* |
| Ga0070722_104663752 | 3300005601 | Marine Sediment | MNNKSKTSRARANKGEKVFQMKGTFQEVWKEYVKFN |
| Ga0070723_100427081 | 3300005612 | Marine Sediment | SRARANKGEKVFQMKGTFQEVWKEYMKLNEQLKNN* |
| Ga0075466_11793602 | 3300006029 | Aqueous | MKNKKKLSRERTNKGEKVFQMKGTFDEVWKEYLKLNEQLKNI* |
| Ga0098038_12187633 | 3300006735 | Marine | MKNKKPNRERNNKGEKVFQMKGTFQEVWKEYMKLNEQLKTK* |
| Ga0098037_10344665 | 3300006737 | Marine | MKIKKKISRERTNKGEKVFQMKGTFQEVWKEYMKLNEQLKNN* |
| Ga0098037_12681222 | 3300006737 | Marine | MKNKKPNRNRSNKGEKVYHFKGTFDEVWEDYVKMIKIWKKI* |
| Ga0098048_10162308 | 3300006752 | Marine | MKIKKKISRERTNKGEKVFQMKGTFDEVWKEYMKLNQQLKTK* |
| Ga0098055_101053911 | 3300006793 | Marine | MNNKSKPNRERTNKGEKVFQMKGTFQEVWKEYMKLNEQLKTK* |
| Ga0098055_10786595 | 3300006793 | Marine | MKNKKPNRERNNKGEKVFQMKGTFQEVWKEYMKLNEQLKNN* |
| Ga0075467_104899072 | 3300006803 | Aqueous | MNNKKKLSRERTNKGEKVFQMKGTFDEVWKEYLKLNEQLKNI* |
| Ga0070746_104393381 | 3300006919 | Aqueous | IMKNKKKLSRDRTNKGDKVFQMKGTFQEVWKEYMKLNDQLKNS* |
| Ga0070748_10471645 | 3300006920 | Aqueous | MKNKKKLSRDRTNKGDKVFQMKGTFQEVWKEYMKLNDQLKNS* |
| Ga0098060_10545551 | 3300006921 | Marine | MNNKKKLSRDRVNKGEKVFQMKGTFQEVWKEYMKLNEQLKNN* |
| Ga0075468_101181301 | 3300007229 | Aqueous | MKNKKKLSRDRTNKGDKVFQMKGTFQEVWKEYMKLN |
| Ga0075463_100681544 | 3300007236 | Aqueous | MKNKKKLSRERINKGEKVYHFKGTFDEVWKEYLKLNEQLKNI* |
| Ga0070747_10435431 | 3300007276 | Aqueous | MKNKKQNRDRTNKGDKVFQMKGTFDEVWKEYLKLNEQLKNI* |
| Ga0099851_10192338 | 3300007538 | Aqueous | MKNKKQNRDRTNKGEKVYHFRGTFDQVWQEYLKLNQQLKNNL* |
| Ga0099849_10875863 | 3300007539 | Aqueous | MKNKKQNRERTNKGEKVYHFKGTFDEVWQEYLKLNQQLKNN* |
| Ga0099849_13635622 | 3300007539 | Aqueous | MKNKKQNRDRTNKGEKVYYFKGTFDEVWKEYLKVNQQLKNN* |
| Ga0115566_102667441 | 3300009071 | Pelagic Marine | MKNKKKLSRERTNKGEKVYHFKGTFDEVWKEYMKLNEQL |
| Ga0115566_102823831 | 3300009071 | Pelagic Marine | IMKNKKKLSRERTNKGEKVFQMKGTFDEVWKEYMKLNEQFKNN* |
| Ga0115566_103366024 | 3300009071 | Pelagic Marine | MKNKKKLSRARANKGEKVFQMKGTFDEVWKEYMKLNEQLKNN* |
| Ga0115549_11252082 | 3300009074 | Pelagic Marine | MKNKKKLSRERTNKGEKVFQMKGTFQEVWKEYMKLNEQLKNN* |
| Ga0114918_1001846911 | 3300009149 | Deep Subsurface | MKNKKQNRDRTNKGEKVYHFKGTFDEVWKEYMKLNEQLKNN* |
| Ga0115551_10710394 | 3300009193 | Pelagic Marine | MKNKKKLSRERTNKGEKVFQMKGTFDEVWKEYMKLNEQFKNN* |
| Ga0115551_14653603 | 3300009193 | Pelagic Marine | MKNKKKQNRDRTNKGEKVFQMKGTFQEVWKEYMKLNEQLKNN* |
| Ga0115555_102896710 | 3300009476 | Pelagic Marine | MKNKKQNRERTNKGEKVFQMKGTFDEVWKEYMKLNEQFKNN* |
| Ga0114925_112055932 | 3300009488 | Deep Subsurface | LTMKNKKPNRDRTNKGEKLYHFKGTFDEVWQEYVKLNQQLKNN* |
| Ga0098043_10414632 | 3300010148 | Marine | MKNKKPNRDRTNKGEKVYHFKGTFDEVWEDYVKMIKIWKKI* |
| Ga0098043_10989905 | 3300010148 | Marine | MKNKKPNRDRSNKGEKVYHFKGTFDEVWQEYLKLNQQFKNNYEN* |
| Ga0098056_11664493 | 3300010150 | Marine | MKNKKPNRDRTNKGEKVFQMKGTFQEVWKEYMKLNE |
| Ga0098059_12045883 | 3300010153 | Marine | MKNKKKLSRDSVNKGEKVFQMKGTFQEVWKEYMKLNEQLKTK* |
| Ga0098059_12996551 | 3300010153 | Marine | MNNKSKPNRERTNKGEKVFQMKGTFQEVWKEYMKLNEQLKNN* |
| Ga0098047_101590614 | 3300010155 | Marine | RERTNKGEKVFQMKGTFQEVWKEYMKLNEQLKTK* |
| Ga0129348_11415703 | 3300010296 | Freshwater To Marine Saline Gradient | MKNKKQNRDRTNKGEKVYYFKGTFDEVWKEYLKLNQQLKNN* |
| Ga0118731_1050534023 | 3300010392 | Marine | MKNKKKLSRDRTNKGDKVFQMKGTFQEVWKEYMKLNEQLKN |
| Ga0118731_1082086572 | 3300010392 | Marine | MNNKSKTSRARANKGEKVFQMKGTFQEVWKEYVKFNEEFKKI* |
| Ga0118731_1095409255 | 3300010392 | Marine | MKNNKKPNRDRSNKGEKVFQMKGTFQEVWKEYMKLN |
| Ga0118733_1016426712 | 3300010430 | Marine Sediment | MNNKKKPSRARANKGEKVFQMKGTFQEVWKEYMKLNEQLKNN* |
| Ga0151654_10411023 | 3300011126 | Marine | MKNKKPNRDRTNKGEKVFQMKGTFEEVWKEYVKLNEQLKTK* |
| Ga0151672_1546582 | 3300011129 | Marine | MKNKKPNRERVNKGEKVFQMKGTFEEVWKEYVKLNQQLKTK* |
| Ga0160423_102043532 | 3300012920 | Surface Seawater | MKNTKPNRNRTNKGEKVYHFKGTFDEVWEDYVKMIKIWKKI* |
| Ga0163179_106557654 | 3300012953 | Seawater | MKNKKQNRDRTNKGEKVFQMKGTFQEVWKEYIKINKQLKNN* |
| Ga0164313_110933281 | 3300013101 | Marine Sediment | NKKQNRDRTNKGEKVYHFKGTFDEVWEDYVKMIKIWKKI* |
| Ga0164318_106693262 | 3300013103 | Marine Sediment | MKNKKQNRDRTNKGEKVYHFKGTFDEVWQEYLKLNQQFKNNYGIKTNR* |
| Ga0181377_10061338 | 3300017706 | Marine | MKNKKKLSRDRVNKGEKVFQMKGTFQEVWKEYMKLNEQLKNN |
| Ga0181403_100069512 | 3300017710 | Seawater | MKNKNKPNRDRTNKGEKVFQMKGTFDEVWKEYMKLNQQLKTK |
| Ga0181403_10069166 | 3300017710 | Seawater | MKNKNKSNRDRVNKGEKVFQMKGTFQEVWKEYVKLNEQLKNN |
| Ga0181391_10219156 | 3300017713 | Seawater | MKNKKPNRDRTNKGEKVFQIKGTFQEVWKEYVKLNEQLKNN |
| Ga0181391_10748331 | 3300017713 | Seawater | MNNKNKPNRERTNKGEKVFQMKGTFQEVWKEYMKFNEEFKKI |
| Ga0181391_11121202 | 3300017713 | Seawater | MKNKKKPNRDKTNKGEKVFQMKGTFQEVWKEYVKLNEQLKNN |
| Ga0181388_11419602 | 3300017724 | Seawater | MKNKNKSNRDRVNKGEKVFQMKGTFQEVWKEYMKFNEEFKKI |
| Ga0181401_11107162 | 3300017727 | Seawater | MKNKNKSNRDRVNKGEKVFQMKGTFDEVWKEYMKLNEQLKTK |
| Ga0181428_11645202 | 3300017738 | Seawater | MKNKKPNRDRSNKGEKIFQMKGTFQEVWKEYMKLNEQLKNN |
| Ga0181418_10077168 | 3300017740 | Seawater | MKNKKQNRDRTNKGEKVFQMKGTFDEVWKEYMKLNEQLKNN |
| Ga0181418_10187114 | 3300017740 | Seawater | MKNKKPNRDRTNKGEKVFQIKGTFQEVWKEYMKLNEQLKNN |
| Ga0181392_10402081 | 3300017749 | Seawater | MKNKKQNRDRTNKGEKVFQIKGTFQEVWKEYVKLNEQLKNN |
| Ga0187219_11474183 | 3300017751 | Seawater | IIRIMDKYTKFKLLTMKNKKPNRDRTNKGEKVYQIKGTFQEVWKEYMKLNEQLKNN |
| Ga0187219_12313193 | 3300017751 | Seawater | LTMKNKKPNRDRTNKGEKVFQIKGTFQEVWKEYVKLNEQLKNN |
| Ga0181420_11437801 | 3300017757 | Seawater | QNRDRTNKGEKVYQIKGTFQEVWKEYMKLNEQLKNN |
| Ga0181409_11649142 | 3300017758 | Seawater | MKNKKQNRDRTNKGEKIFQMKGTFQEVWKEYVKLNEQLKNN |
| Ga0181406_11663573 | 3300017767 | Seawater | MKNKKPNRDRSNKGEKVFQMKGTFQEVWKEYVKLNEQLKNN |
| Ga0181424_101219023 | 3300017786 | Seawater | MKNKKPNRDRTNKGEKVFQMKGTFDEVWKEYMKLNQQLKTK |
| Ga0181424_103629883 | 3300017786 | Seawater | MKNKKPNRDRTNKGEKVFQMKGTFDEVWKEYMKLNEQLKN |
| Ga0181568_111847112 | 3300018428 | Salt Marsh | MKNKKQNRDRTNKGEKVYHFKGTFDEVWQEYLKLNQQFKNGTIK |
| Ga0206125_100586546 | 3300020165 | Seawater | MKNKKKPNRDRVNKGEKVFQMKGTFQEVWKEYMKLNEQLKNN |
| Ga0206124_100917852 | 3300020175 | Seawater | MKNKKQNRERTNKGEKVFQMKGTFDEVWKEYMKLNEQLKNN |
| Ga0211677_100156083 | 3300020385 | Marine | MKNKKKLSRDRVNKGEKVFQIKGTFQEVWKEYMKLNEQLKNN |
| Ga0211677_100698494 | 3300020385 | Marine | MNNKSKTSRARTNKGEKVFQMKGTFQEVWKEYMKFNEEFKKI |
| Ga0211528_101275673 | 3300020417 | Marine | MKNKKQNRDRTNKGEKVYHIKGTFNEVWQEYVKLNQQFKNGTIK |
| Ga0211521_100304151 | 3300020428 | Marine | MKNKKKLSRDRANKGEKVFQMKGTFQEVWKEYMKLNEQLKNN |
| Ga0211521_103118901 | 3300020428 | Marine | MNNKSKTNRVRTNKGEKVYHFKGTFQEVWKEYMKLN |
| Ga0211576_100386884 | 3300020438 | Marine | MKNKKQNRDRTNKGEKVYQIKGTFQEVWKEYMKLNEQLKNN |
| Ga0211558_104429171 | 3300020439 | Marine | INLIMKNKKQNRTNKGEKVYHFKGTFDEVWQEYLKLNQQFKNNYDTN |
| Ga0213869_101088593 | 3300021375 | Seawater | MKNKKKLSRERTNKGEKVFQMKGTFDEVWKEYLKLNEQLKNI |
| Ga0213861_103687162 | 3300021378 | Seawater | MKNKKKLSRERTNKGEKVYHFKGTFDEVWKEYMKLNEQLKNN |
| Ga0222717_100832628 | 3300021957 | Estuarine Water | MKNKKPNRDRTNKGEKVFQMKGTFDEVWKEYMKLNEQLKNN |
| Ga0222717_101548462 | 3300021957 | Estuarine Water | MKNKKQNRDRTNKGEKVFQIKGTFQEVWKEYMKLNEQLKNN |
| Ga0222718_100722718 | 3300021958 | Estuarine Water | MKNKKKPNRNRTNKGEKVFQMKGTFQEVWKEYIKLNEQLKNN |
| Ga0222716_101626907 | 3300021959 | Estuarine Water | QNRDRTNKGEKVFQIKGTFQEVWKEYMKLNEQLKNN |
| Ga0222719_102866764 | 3300021964 | Estuarine Water | MKNKKKPNRNRINKGEKVFQMKGTFDEVWKEYIKLNEQLKNN |
| Ga0196887_10369121 | 3300022178 | Aqueous | MKNNKKPNRDRSNKGEKVFQMKGTFQEVWKEYMKL |
| Ga0196887_11167502 | 3300022178 | Aqueous | MKNKKKLSRERINKGEKVYHFKGTFDEVWKEYLKLNEQLKNI |
| (restricted) Ga0233412_105141032 | 3300023210 | Seawater | MENKKKLNRDRSSKGEKVFQMKGTFQEVWKEYVKLNEQLKNN |
| Ga0210003_100622810 | 3300024262 | Deep Subsurface | MKNKKQNRDRTNKGEKVYHFKGTFDEVWKEYMKLNEQLKNN |
| Ga0228656_10514491 | 3300024322 | Seawater | ILTKIKIMNNKNKPNRDRTNKGEKVFQMKGTFDEVWKEYMKLNEQLKTK |
| (restricted) Ga0255046_101801292 | 3300024519 | Seawater | MKNKNKPNRDRTNKGEKVFQMKGTFDEVWKEYMKLNEQLKNN |
| Ga0208667_10241413 | 3300025070 | Marine | MKNKKPNRERNNKGEKVFQMKGTFQEVWKEYMKLNEQLKTK |
| Ga0207896_10191713 | 3300025071 | Marine | MENKKKPSRKRTNKGEKVFHMKGTFQEVWKEYVKLNEQLKNN |
| Ga0207890_10567251 | 3300025079 | Marine | MKNKKPNRDRSSKGEKVFQMKGTFQEVWKEYVKLNEQLKNN |
| Ga0208434_10222721 | 3300025098 | Marine | KKKISRERTNKGEKVFQMKGTFDEVWKEYMKLNQQLKTK |
| Ga0208669_10103864 | 3300025099 | Marine | MKIKKKISRERTNKGEKVFQMKGTFDEVWKEYMKLNQQLKTK |
| Ga0208159_10147325 | 3300025101 | Marine | MKNKKPNRNRSNKGEKVYHFKGTFDEVWEDYVKMIKIWKKI |
| Ga0208793_10340191 | 3300025108 | Marine | KKPNRERNNKGEKVFQMKGTFQEVWKEYMKLNEQLKTK |
| Ga0208793_11283861 | 3300025108 | Marine | MNNKSKPNRERTNKGEKVFQMKGTFQEVWKEYMKLNEQLKNN |
| Ga0209535_10809874 | 3300025120 | Marine | MKNKKPNRERVNKGEKVFQMKGTFQEVWKEYVKLNEQLKNN |
| Ga0209535_11896011 | 3300025120 | Marine | MKNKKPNRDKSSKGEKVFQMKGTFQEVWKEYVKLNEQLKNN |
| Ga0209645_10313412 | 3300025151 | Marine | MKNKKQNRDRTNKGEKVYHFKGTFDEVWQEYLKLNQQFKNNYGN |
| Ga0208660_10146309 | 3300025570 | Aqueous | MKNNKKPNRDRSNKGEKVFQMKGTFQEVWKEYMKLNEQLKNN |
| Ga0209304_11153553 | 3300025577 | Pelagic Marine | MKNKKKLSRERTNKGEKVFQMKGTFDEVWKEYMKLNEQFKNN |
| Ga0208643_11100383 | 3300025645 | Aqueous | MKNKKKLSRDRTNKGDKVFQMKGTFQEVWKEYMKLNEQLKNS |
| Ga0208795_10853972 | 3300025655 | Aqueous | MKNKKQNRDRTNKGEKVYHFRGTFDQVWQEYLKLNQQLKNNL |
| Ga0208162_10581085 | 3300025674 | Aqueous | MKNKKQNRDRTNKGEKVYYFKGTFDEVWKEYLKVNQQLKNN |
| Ga0208162_10581803 | 3300025674 | Aqueous | MKNKKQNRERTNKGEKVYHFKGTFDEVWQEYLKLNQQLKNN |
| Ga0209715_11309284 | 3300025699 | Pelagic Marine | MKNKKKLSRARANKGEKVFQMKGTFDEVWKEYMKLNEQLKNN |
| Ga0209199_12472462 | 3300025809 | Pelagic Marine | MKNKKKQNRDRTNKGEKVFQMKGTFDEVWKEYMKLNEQFKNN |
| Ga0209603_10125155 | 3300025849 | Pelagic Marine | MKNKKKLSRDRVNKGEKVFQMKGTFDEVWKEYMKLNEQLKNN |
| Ga0209630_102264771 | 3300025892 | Pelagic Marine | MKNKKKLSRERTNKGEKVFQMKGTFDEVWKEYMKL |
| Ga0209425_101113767 | 3300025897 | Pelagic Marine | NKKKLSRDRVNKGEKVFQMKGTFDEVWKEYMKLNEQLKNN |
| Ga0209345_103703702 | 3300027852 | Marine | MKNKNKSNRDRVNKGEKVFQMKGTFQEVWKEYMKLNEQLKNN |
| (restricted) Ga0255054_104345882 | 3300027856 | Seawater | MENKKKPNRDRTNKGEKVFQMKGTFDEVWKEYMKLNEQLKNN |
| Ga0209013_102511724 | 3300027858 | Marine | MKNKKPNRDRTNKGEKVYQIKGTFQEVWKEYMKLNEQLKNN |
| (restricted) Ga0255053_102197685 | 3300027868 | Seawater | RDRTNKGEKVFQMKGTFDEVWKEYMKLNEQLKNNYGN |
| (restricted) Ga0255055_100369656 | 3300027881 | Seawater | MKNKNKPNRDRTNKGEKVFQMKGTFDEVWKEYLKLNEQLKTK |
| (restricted) Ga0255055_101006582 | 3300027881 | Seawater | MKNKKKPSRKRTNKGEKVFQMKGTFQEVWKEYVKLNEQLKNN |
| Ga0228621_10741773 | 3300028124 | Seawater | NKNKPNRDRTNKGEKVFQMKGTFDEVWKEYMKLNEQLKTK |
| Ga0228645_10473873 | 3300028128 | Seawater | MNNKNKPNRDRTNKGEKVFQMKGTFDEVWKEYMKLNEQLKTK |
| Ga0257106_12412062 | 3300028194 | Marine | MENKKKLNRDKSNKGEKVFHMKGTFQEVWKEYVKLNEQLKNN |
| Ga0135211_10044206 | 3300029293 | Marine Harbor | MKNKKPNRDRTNKGEKVYHIKGTFNEVWQEYVKLNEQLKNN |
| Ga0135211_10282393 | 3300029293 | Marine Harbor | MKNKKQNRDRTNKGHKVYHFKGTFNEVWQEYVKLNEQLKNNYGTK |
| Ga0135211_10329533 | 3300029293 | Marine Harbor | MKNKKQNRDRTNKGEKVYHFKGTFDEVWQEYLKINEQFKNNYGKTRNI |
| Ga0135211_10364243 | 3300029293 | Marine Harbor | MKNKKQNRDRLNKGEKVYHIKGTFNEVWQEYVKLNKQLKTK |
| Ga0135222_10147895 | 3300029301 | Marine Harbor | KNSVSQSRSNKREKVYHIKGTFNEVWQEYVKLNEQLKNN |
| Ga0135222_10242361 | 3300029301 | Marine Harbor | MKNKKRNSKGEKVYHIKGTFNEVWKEYLKLNKPIVTGK |
| Ga0135212_10029701 | 3300029306 | Marine Harbor | MKNKKQNRDRTNKGEKVYHFKGTFDEVWQEYLKINEQFKNNYGT |
| Ga0183683_10309455 | 3300029309 | Marine | TLTLQIMKNTKPNRDRSNKGEKVYHFKGTFDEVWQEYLKLNKQFKNN |
| Ga0135210_10250924 | 3300029345 | Marine Harbor | MKNKKRNSKGEKVYHIKGTFNEVWKEYLKLNKQLKNNYGIFRP |
| Ga0135224_10017154 | 3300029753 | Marine Harbor | MKNKKRNSKGEKVYHIKGTFNEVWKEYLKLNKQLKGS |
| Ga0315315_105168932 | 3300032073 | Seawater | MNNKNKPNRERVNKGEKVFQMKGTFQEVWKEYVKLNEQLKNN |
| Ga0316203_10367341 | 3300032274 | Microbial Mat | KFKLLIMKNKKKLSRDRTNKGEKVFQMKGTFQEVWKEYMKLNEQLKNN |
| Ga0316202_102212773 | 3300032277 | Microbial Mat | MKNKKKLSRDRTNKGEKVFQMKGTFQEVWKEYMKLNEQLKNN |
| ⦗Top⦘ |