


| Basic Information | |
|---|---|
| Family ID | F049969 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 146 |
| Average Sequence Length | 47 residues |
| Representative Sequence | VADIQKLNVELDPLPGERVQELIVRTLNVPQAVRERAKLAFGR |
| Number of Associated Samples | 133 |
| Number of Associated Scaffolds | 146 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.37 % |
| % of genes near scaffold ends (potentially truncated) | 97.26 % |
| % of genes from short scaffolds (< 2000 bps) | 93.84 % |
| Associated GOLD sequencing projects | 127 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.247 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (14.384 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.082 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.890 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.03% β-sheet: 0.00% Coil/Unstructured: 61.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 146 Family Scaffolds |
|---|---|---|
| PF05199 | GMC_oxred_C | 13.01 |
| PF03401 | TctC | 8.22 |
| PF03928 | HbpS-like | 6.85 |
| PF00561 | Abhydrolase_1 | 3.42 |
| PF01436 | NHL | 2.05 |
| PF01494 | FAD_binding_3 | 1.37 |
| PF02322 | Cyt_bd_oxida_II | 1.37 |
| PF00398 | RrnaAD | 0.68 |
| PF00501 | AMP-binding | 0.68 |
| PF03662 | Glyco_hydro_79n | 0.68 |
| PF00155 | Aminotran_1_2 | 0.68 |
| PF00440 | TetR_N | 0.68 |
| PF03480 | DctP | 0.68 |
| PF15937 | PrlF_antitoxin | 0.68 |
| PF02371 | Transposase_20 | 0.68 |
| PF10082 | BBP2_2 | 0.68 |
| PF07969 | Amidohydro_3 | 0.68 |
| PF13546 | DDE_5 | 0.68 |
| PF13649 | Methyltransf_25 | 0.68 |
| PF00171 | Aldedh | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 146 Family Scaffolds |
|---|---|---|---|
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 13.01 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 8.22 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 2.74 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.37 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 1.37 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 1.37 |
| COG1294 | Cytochrome bd-type quinol oxidase, subunit 2 | Energy production and conversion [C] | 1.37 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.68 |
| COG0030 | 16S rRNA A1518 and A1519 N6-dimethyltransferase RsmA/KsgA/DIM1 (may also have DNA glycosylase/AP lyase activity) | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.68 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.68 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.25 % |
| Unclassified | root | N/A | 15.75 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000033|ICChiseqgaiiDRAFT_c2288313 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1732 | Open in IMG/M |
| 3300001661|JGI12053J15887_10404929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 655 | Open in IMG/M |
| 3300002568|C688J35102_118859678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 605 | Open in IMG/M |
| 3300004145|Ga0055489_10162458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 681 | Open in IMG/M |
| 3300004153|Ga0063455_100194978 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300004268|Ga0066398_10230944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 500 | Open in IMG/M |
| 3300005147|Ga0066821_1026001 | Not Available | 519 | Open in IMG/M |
| 3300005328|Ga0070676_10770297 | Not Available | 708 | Open in IMG/M |
| 3300005332|Ga0066388_101624818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1139 | Open in IMG/M |
| 3300005332|Ga0066388_102334502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 969 | Open in IMG/M |
| 3300005332|Ga0066388_103451124 | Not Available | 807 | Open in IMG/M |
| 3300005356|Ga0070674_101166954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 682 | Open in IMG/M |
| 3300005366|Ga0070659_101258046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 655 | Open in IMG/M |
| 3300005456|Ga0070678_100730934 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300005459|Ga0068867_100742529 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300005545|Ga0070695_100925143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 705 | Open in IMG/M |
| 3300005557|Ga0066704_10517577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 783 | Open in IMG/M |
| 3300005563|Ga0068855_100405022 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1494 | Open in IMG/M |
| 3300005586|Ga0066691_10944600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 507 | Open in IMG/M |
| 3300005618|Ga0068864_102395547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Kaistiaceae → Bauldia → Bauldia litoralis | 534 | Open in IMG/M |
| 3300005713|Ga0066905_101822073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 562 | Open in IMG/M |
| 3300005764|Ga0066903_109012235 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
| 3300005842|Ga0068858_100077045 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3097 | Open in IMG/M |
| 3300006038|Ga0075365_10097718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 2008 | Open in IMG/M |
| 3300006038|Ga0075365_10504053 | Not Available | 855 | Open in IMG/M |
| 3300006049|Ga0075417_10443199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 647 | Open in IMG/M |
| 3300006052|Ga0075029_100768371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 654 | Open in IMG/M |
| 3300006163|Ga0070715_10278661 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 885 | Open in IMG/M |
| 3300006172|Ga0075018_10819500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 512 | Open in IMG/M |
| 3300006845|Ga0075421_102135529 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 593 | Open in IMG/M |
| 3300006854|Ga0075425_102145707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 623 | Open in IMG/M |
| 3300006854|Ga0075425_102863147 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300006871|Ga0075434_101315499 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300006914|Ga0075436_100411110 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 981 | Open in IMG/M |
| 3300007004|Ga0079218_13996873 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
| 3300009098|Ga0105245_12286199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 594 | Open in IMG/M |
| 3300009100|Ga0075418_10302506 | All Organisms → cellular organisms → Bacteria | 1705 | Open in IMG/M |
| 3300009100|Ga0075418_10497853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1308 | Open in IMG/M |
| 3300009100|Ga0075418_12541932 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300009137|Ga0066709_101847234 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300009143|Ga0099792_11128175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 529 | Open in IMG/M |
| 3300009147|Ga0114129_13085086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 545 | Open in IMG/M |
| 3300009153|Ga0105094_10696107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 595 | Open in IMG/M |
| 3300009156|Ga0111538_12974663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 592 | Open in IMG/M |
| 3300009162|Ga0075423_11822839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 656 | Open in IMG/M |
| 3300009174|Ga0105241_10658307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 952 | Open in IMG/M |
| 3300009176|Ga0105242_11163311 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 789 | Open in IMG/M |
| 3300009545|Ga0105237_10374464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1428 | Open in IMG/M |
| 3300009792|Ga0126374_11374648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 574 | Open in IMG/M |
| 3300010046|Ga0126384_10736370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 877 | Open in IMG/M |
| 3300010047|Ga0126382_10113535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1780 | Open in IMG/M |
| 3300010047|Ga0126382_12279442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 523 | Open in IMG/M |
| 3300010048|Ga0126373_12701687 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300010061|Ga0127462_188030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 547 | Open in IMG/M |
| 3300010071|Ga0127477_131485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 605 | Open in IMG/M |
| 3300010360|Ga0126372_13010205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 523 | Open in IMG/M |
| 3300010362|Ga0126377_10124402 | All Organisms → cellular organisms → Bacteria | 2387 | Open in IMG/M |
| 3300010362|Ga0126377_10285978 | All Organisms → cellular organisms → Bacteria | 1620 | Open in IMG/M |
| 3300010362|Ga0126377_10330834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1513 | Open in IMG/M |
| 3300010376|Ga0126381_101699963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 911 | Open in IMG/M |
| 3300010398|Ga0126383_10120987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2385 | Open in IMG/M |
| 3300010400|Ga0134122_10266585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1454 | Open in IMG/M |
| 3300010401|Ga0134121_10378317 | Not Available | 1273 | Open in IMG/M |
| 3300011270|Ga0137391_10620377 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300012205|Ga0137362_11424611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 579 | Open in IMG/M |
| 3300012206|Ga0137380_10330261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1362 | Open in IMG/M |
| 3300012208|Ga0137376_11026247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 706 | Open in IMG/M |
| 3300012376|Ga0134032_1022511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 530 | Open in IMG/M |
| 3300012507|Ga0157342_1034556 | Not Available | 652 | Open in IMG/M |
| 3300012582|Ga0137358_10970123 | Not Available | 552 | Open in IMG/M |
| 3300012906|Ga0157295_10399451 | Not Available | 512 | Open in IMG/M |
| 3300012917|Ga0137395_10855403 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300012924|Ga0137413_10240325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1238 | Open in IMG/M |
| 3300012925|Ga0137419_11164152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 644 | Open in IMG/M |
| 3300012930|Ga0137407_10806414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 887 | Open in IMG/M |
| 3300012944|Ga0137410_11675694 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300012948|Ga0126375_10172532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1389 | Open in IMG/M |
| 3300012957|Ga0164303_10670809 | Not Available | 694 | Open in IMG/M |
| 3300012971|Ga0126369_10639697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1137 | Open in IMG/M |
| 3300012971|Ga0126369_10758035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1051 | Open in IMG/M |
| 3300012985|Ga0164308_11900144 | Not Available | 555 | Open in IMG/M |
| 3300012988|Ga0164306_11338080 | Not Available | 607 | Open in IMG/M |
| 3300012989|Ga0164305_10450819 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 999 | Open in IMG/M |
| 3300014272|Ga0075327_1055003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1181 | Open in IMG/M |
| 3300015077|Ga0173483_10796163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 545 | Open in IMG/M |
| 3300015245|Ga0137409_10151183 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2124 | Open in IMG/M |
| 3300015264|Ga0137403_10398028 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1258 | Open in IMG/M |
| 3300015372|Ga0132256_101724604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 735 | Open in IMG/M |
| 3300016294|Ga0182041_10938358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 780 | Open in IMG/M |
| 3300016404|Ga0182037_12033795 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300018073|Ga0184624_10015830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2729 | Open in IMG/M |
| 3300018078|Ga0184612_10035462 | All Organisms → cellular organisms → Bacteria | 2586 | Open in IMG/M |
| 3300018432|Ga0190275_12605422 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 583 | Open in IMG/M |
| 3300018433|Ga0066667_10234428 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
| 3300018433|Ga0066667_11057259 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300018469|Ga0190270_11720238 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300021067|Ga0196978_1055001 | Not Available | 749 | Open in IMG/M |
| 3300021363|Ga0193699_10264699 | Not Available | 716 | Open in IMG/M |
| 3300021404|Ga0210389_11028963 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300021432|Ga0210384_10202590 | All Organisms → cellular organisms → Bacteria | 1784 | Open in IMG/M |
| 3300021475|Ga0210392_10646900 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300021559|Ga0210409_10875719 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 772 | Open in IMG/M |
| 3300025905|Ga0207685_10681224 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 558 | Open in IMG/M |
| 3300025908|Ga0207643_10516391 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300025937|Ga0207669_11037267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 690 | Open in IMG/M |
| 3300025944|Ga0207661_11569278 | Not Available | 603 | Open in IMG/M |
| 3300025945|Ga0207679_11593909 | Not Available | 598 | Open in IMG/M |
| 3300026111|Ga0208291_1025936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1076 | Open in IMG/M |
| 3300026467|Ga0257154_1078164 | Not Available | 527 | Open in IMG/M |
| 3300027288|Ga0208525_1005857 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1291 | Open in IMG/M |
| 3300027324|Ga0209845_1043539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 711 | Open in IMG/M |
| 3300027862|Ga0209701_10510207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 652 | Open in IMG/M |
| 3300027873|Ga0209814_10335883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 660 | Open in IMG/M |
| 3300027882|Ga0209590_10995992 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300027907|Ga0207428_11018161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 581 | Open in IMG/M |
| 3300028047|Ga0209526_10604954 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300028379|Ga0268266_11382715 | Not Available | 679 | Open in IMG/M |
| 3300028380|Ga0268265_10572505 | Not Available | 1075 | Open in IMG/M |
| 3300028712|Ga0307285_10007881 | All Organisms → cellular organisms → Bacteria | 2232 | Open in IMG/M |
| 3300028715|Ga0307313_10216232 | Not Available | 595 | Open in IMG/M |
| 3300028720|Ga0307317_10067739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1161 | Open in IMG/M |
| 3300028755|Ga0307316_10009091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Sinosporangium → Sinosporangium siamense | 3069 | Open in IMG/M |
| 3300028782|Ga0307306_10028276 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
| 3300028790|Ga0307283_10129854 | Not Available | 682 | Open in IMG/M |
| 3300028802|Ga0307503_10286001 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300028810|Ga0307294_10050686 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
| 3300028885|Ga0307304_10037120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Sinosporangium → Sinosporangium siamense | 1746 | Open in IMG/M |
| 3300028885|Ga0307304_10120979 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300028889|Ga0247827_10210066 | Not Available | 1082 | Open in IMG/M |
| 3300030829|Ga0308203_1047280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 644 | Open in IMG/M |
| 3300031152|Ga0307501_10252756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 525 | Open in IMG/M |
| 3300031538|Ga0310888_10858586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 565 | Open in IMG/M |
| 3300031720|Ga0307469_11868374 | Not Available | 581 | Open in IMG/M |
| 3300031769|Ga0318526_10054137 | All Organisms → cellular organisms → Bacteria | 1537 | Open in IMG/M |
| 3300031778|Ga0318498_10088732 | Not Available | 1398 | Open in IMG/M |
| 3300031858|Ga0310892_10317686 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 988 | Open in IMG/M |
| 3300031896|Ga0318551_10236691 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300031912|Ga0306921_12571848 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300031942|Ga0310916_10393638 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300031954|Ga0306926_12658593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 545 | Open in IMG/M |
| 3300032059|Ga0318533_11452958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 501 | Open in IMG/M |
| 3300032075|Ga0310890_11742429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 517 | Open in IMG/M |
| 3300032091|Ga0318577_10475672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300032174|Ga0307470_11457317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 567 | Open in IMG/M |
| 3300032261|Ga0306920_102539897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 704 | Open in IMG/M |
| 3300032261|Ga0306920_102585641 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.38% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.59% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.11% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.74% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.05% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.05% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.05% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.05% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.05% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.37% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.37% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.37% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.37% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.37% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.37% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.37% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.37% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.37% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.37% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.68% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.68% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.68% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.68% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.68% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004145 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300005147 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMC | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010061 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010071 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012376 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014272 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300021067 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20-13C | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026111 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
| 3300027288 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes) | Environmental | Open in IMG/M |
| 3300027324 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030829 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiDRAFT_22883131 | 3300000033 | Soil | IRKVDVELEPLPGERVQELITRTLAXPASVRERAKVAFGR* |
| JGI12053J15887_104049292 | 3300001661 | Forest Soil | GFDAMVKDPEFLADIQKINVELDPLPGAAVAQMVAQTLNVPAAVRERALNAFGR* |
| C688J35102_1188596781 | 3300002568 | Soil | RVGMLRDAFQKMVKDPEFVAELQRTNVELDPLPGAQVEELVVRTLNVPATVRDRAKLAFGR* |
| Ga0055489_101624581 | 3300004145 | Natural And Restored Wetlands | DSDFVADIKKVNVELDPLPGEGVQALTTKTLNVPASVRERARVAFGR* |
| Ga0063455_1001949781 | 3300004153 | Soil | GALRDAFQKMVKDPEFVAELQRTNVELDPLPGAQVEELVVRTLNVPATVRDRAKLAFGR* |
| Ga0066398_102309442 | 3300004268 | Tropical Forest Soil | MVNDANFIADIRRLEVELDPLPGERVQELVVRTLNVPSAVRERAKLAFGR* |
| Ga0066821_10260011 | 3300005147 | Soil | DFIADLQRTNVELEPLPGAEVEQLVVRTLNVPATVRDRAKLAFGR* |
| Ga0070676_107702971 | 3300005328 | Miscanthus Rhizosphere | AALRDAFQKMVRDPEFVADLQRTDVELDPLPGAQVEALVVRTLNVPAAVRDRAKLAFGR* |
| Ga0066388_1016248183 | 3300005332 | Tropical Forest Soil | VADINKVNVELDPLPGERVQELITRTLAVPASVRERAKVAFGR* |
| Ga0066388_1023345021 | 3300005332 | Tropical Forest Soil | DIQKLNVELDPLPGAALAQLVEKALSVPASVRQRAVEAFGR* |
| Ga0066388_1034511242 | 3300005332 | Tropical Forest Soil | DPEFVADLQRTDVELSPLSGEQVAQLVARTLAVPAAIRERAKLAFGR* |
| Ga0070674_1011669542 | 3300005356 | Miscanthus Rhizosphere | ADIKKVNVELDPLPGERVQELITRTLAVPASVRERAKVAFGR* |
| Ga0070659_1012580462 | 3300005366 | Corn Rhizosphere | LQRTNVELDPLPGAEVEQMVIRTLSVPATVRDRAKLAFGR* |
| Ga0070678_1007309341 | 3300005456 | Miscanthus Rhizosphere | RVGALRDAFQKMVKDPDFVADLQRTNVELDPLPGTQVEELVIRTLNVPATVRDRAKLAFGR* |
| Ga0068867_1007425292 | 3300005459 | Miscanthus Rhizosphere | FIADLQRTNVELEPLPGAEVEQLVVRTLNVPATVRDRAKLAFGR* |
| Ga0070695_1009251432 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VLREAFNAMVKDPDFVADIKKVNVELDPLPGERVQELITRTLAVPASVRERAKVAFGR* |
| Ga0066704_105175773 | 3300005557 | Soil | KTNVELDPLPGERVQELIVRTLNVPAAVRERAKLGFGR* |
| Ga0068855_1004050222 | 3300005563 | Corn Rhizosphere | DAFQKTVKDPEFVAELQRTNVELDPLPGAAVEQLVVRTLNVPATVRDRAKLAFGR* |
| Ga0066691_109446001 | 3300005586 | Soil | EAFNAMVRDPEFIADIQKTNVELDPLPGERLQELTVHTLNVPEAVRERAKLAFGR* |
| Ga0068864_1023955471 | 3300005618 | Switchgrass Rhizosphere | VDALRDAFQNMVKDPEFVADLRRTNVELDPLPGAEVERMVVRTLNVPAAVRDRAKLAFGR |
| Ga0066905_1018220731 | 3300005713 | Tropical Forest Soil | AFQAMVKDPEFVADIQRLNVELDPLPGEQVGELVIRTLNVPAAVRKRAKLAFGR* |
| Ga0066903_1090122352 | 3300005764 | Tropical Forest Soil | REGFDAMVKDPDFVADIARLNVELDPLSGAELAQRIAHTLALPAAVRERAKHAFGR* |
| Ga0068858_1000770453 | 3300005842 | Switchgrass Rhizosphere | VKDPEFVAELQRTNVELDPLPGAAVEQLVVRTLNVPATVRDRAKLAFGR* |
| Ga0075365_100977181 | 3300006038 | Populus Endosphere | NVELEPLSGEAVQEMIVRTLNVPQAVRDRAKLAFGR* |
| Ga0075365_105040533 | 3300006038 | Populus Endosphere | DPEFVADLQRTNVELDPLPGAQVQELVVRTLNVPATVRDRAKLAFGR* |
| Ga0075417_104431991 | 3300006049 | Populus Rhizosphere | LNVELEPLAGEQVGELVIRTLNVPAAVRERAKLAFGR* |
| Ga0075029_1007683712 | 3300006052 | Watersheds | GFDAMVKDPDFVADIRKINVELDPLPGAAVAQLVERTLNVPAAVRERAINAFGR* |
| Ga0070715_102786612 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | TVKDPEFVAELQRTNVELDPLPGAAVEQLVVRTLNVPATVRDRAKLAFGR* |
| Ga0075018_108195002 | 3300006172 | Watersheds | DPDFVADIQKLNVELDPLPGAAVAQLVARTLDVPAAVRERAIHAFGR* |
| Ga0075421_1021355291 | 3300006845 | Populus Rhizosphere | FVADIRKLNVELDPMPGERLQELITRTLNVPVSVRERAKVAFGR* |
| Ga0075425_1021457072 | 3300006854 | Populus Rhizosphere | LMIKDPEFLADIQKLNVELDPLPGEAVQELIVRTLNVPQAVRERAKLAFGR* |
| Ga0075425_1028631472 | 3300006854 | Populus Rhizosphere | VDLEPLSGEQLEGLVDRALNVPPAVRERAKLAFGR* |
| Ga0075434_1013154991 | 3300006871 | Populus Rhizosphere | DLQRTNVELDPLPGAEVERLVVRTLNVPATVRDRAKLAFGR* |
| Ga0075436_1004111101 | 3300006914 | Populus Rhizosphere | KDPEFIADIQKTNVELEPLPGDKLQDFVVRTLNVPPAVRERAKNAFGR* |
| Ga0079218_139968731 | 3300007004 | Agricultural Soil | ELDPMPGERLQELIVRTLNAPASVRERAQVAFGR* |
| Ga0105245_122861992 | 3300009098 | Miscanthus Rhizosphere | ELDPLPGAQVQELVVGTLNVPATVRDRAKLAFGR* |
| Ga0075418_103025063 | 3300009100 | Populus Rhizosphere | ERVQALRSAFVTMVKDPEFVADIQRLNVELDPLPGEQVGELVIRTLNVPAAVRERAKLAFGR* |
| Ga0075418_104978532 | 3300009100 | Populus Rhizosphere | LRTAFQAMAKDPDFVAEIQRLSVELDPLPGEHLERLVAQTLNTPAAVRERAKAAFGR* |
| Ga0075418_125419322 | 3300009100 | Populus Rhizosphere | RALCDAFEAMVRDPEFVGDARRLNLELDPLPGERVAELIAQTLNIPVAVRERAKRAFGR* |
| Ga0066709_1018472342 | 3300009137 | Grasslands Soil | MRNLDVELDPLSGDEVAKLVARTLDVSPSVRERAKLAFGR* |
| Ga0099792_111281752 | 3300009143 | Vadose Zone Soil | EAFNLMVKDPEFLADIAKLNVELDPLTGEAVQDLIVRTLNVPPAVRERAKLAFGR* |
| Ga0114129_130850862 | 3300009147 | Populus Rhizosphere | AFDAMVRDPEFVADIQKTNVELDPLPGDKLQQFVERTLNVPAAVRERAKVAFGR* |
| Ga0105094_106961071 | 3300009153 | Freshwater Sediment | VKDPEFVADIKKLNVELDPLPGDGVQALIARTLNVPASVKERAKVAFGR* |
| Ga0111538_129746631 | 3300009156 | Populus Rhizosphere | NVELDPLSGTQLAERIARTLAVPAAVRERAKLAFGR* |
| Ga0075423_118228391 | 3300009162 | Populus Rhizosphere | LRDAFKAMVKDPDFVADINKLNIELDPLPGERVQELITRTLAVPASVRERAKVAFGR* |
| Ga0105241_106583071 | 3300009174 | Corn Rhizosphere | ELQRTNVELDPLPGAAVEQLVVRTLNVPATVRDRAKLAFGR* |
| Ga0105242_111633112 | 3300009176 | Miscanthus Rhizosphere | DPDFIADLQRTNVELEPLPGAEVEQLVVRTLNVPATVRDRAKLAFGR* |
| Ga0105237_103744641 | 3300009545 | Corn Rhizosphere | RTNVDLEPLPGAEVEQMVIRTLSVPATVRDRAKLAFGR* |
| Ga0126374_113746481 | 3300009792 | Tropical Forest Soil | QRLNVELDPLPGERVGELVVRTLNVPAAVRERAKLAFGR* |
| Ga0126384_107363701 | 3300010046 | Tropical Forest Soil | VELDPLPGERVQELVVRTLNVPPAVRERAKLAFGR* |
| Ga0126382_101135354 | 3300010047 | Tropical Forest Soil | VADIQKLNVELDPLPGERVQELIVRTLNVPQAVRERAKLAFGR* |
| Ga0126382_122794422 | 3300010047 | Tropical Forest Soil | DVQKLNVELDPLPGERVQELIVRTLNVPPAVRERAKLAFGR* |
| Ga0126373_127016872 | 3300010048 | Tropical Forest Soil | ALCEGFDAMVKDADFLADVRKLDVELDPLPGAAVAQLIEKTLSVPAAVRERAINAFGR* |
| Ga0127462_1880301 | 3300010061 | Grasslands Soil | DIQKLNVELEPLPGERVQELIVRTLNVPQAVRERAKLAFGR* |
| Ga0127477_1314851 | 3300010071 | Grasslands Soil | QRLNVELEPLPGERVHELIVRTLNVPQAVRERAKLAFGR* |
| Ga0126372_130102051 | 3300010360 | Tropical Forest Soil | EFLADIQKLNVELDPLPGEAVQELIVRTLNVPQAVRERAKLAFGR* |
| Ga0126377_101244021 | 3300010362 | Tropical Forest Soil | RDAFNAMVKDTDFIADIQKLNVELDPLPGQRVQELIARTLNVPRAVRERARVAFGR* |
| Ga0126377_102859784 | 3300010362 | Tropical Forest Soil | LEVELDPLPGERVQELVVRTLNVPPAVRERAKLAFGR* |
| Ga0126377_103308344 | 3300010362 | Tropical Forest Soil | VLRDAFDAMVRDSDFVADIRKLNVELEPLSGDKVQALVVRTLNIPDTVRERAKVAFGR* |
| Ga0126381_1016999631 | 3300010376 | Tropical Forest Soil | AFNEMVKDADFIADIRKLEVELDPLPGERVQELVVRTLKVPPAVRERAKLAFGR* |
| Ga0126383_101209872 | 3300010398 | Tropical Forest Soil | VELEPLSGEQLEQLVRRALNIPAAVRERAKLAFGR* |
| Ga0134122_102665853 | 3300010400 | Terrestrial Soil | AMVKDPDFIADIQKLNVELEPMPGERVQELIVRTLNVPQAVRERAKLAFGR* |
| Ga0134121_103783171 | 3300010401 | Terrestrial Soil | KDPEFVAELQRTNVELDPLPGAAVEQLVVRTLNVPATVRDRAKLAFGR* |
| Ga0137391_106203771 | 3300011270 | Vadose Zone Soil | DVELDPLSGDEVAKLVARTLDVSPSVRERAKLAFGR* |
| Ga0137362_114246111 | 3300012205 | Vadose Zone Soil | MVKDPDFIADIQKLNVELEPLPGERVQELIVQTLNVPPAVRERAKLAFGR* |
| Ga0137380_103302614 | 3300012206 | Vadose Zone Soil | IADIQKTNVELDPLPGERLQELTVHTLNVPEAVRERAKLAFGR* |
| Ga0137376_110262473 | 3300012208 | Vadose Zone Soil | AMVRDREFIADVHKTNVELDPLPGERVQELIVRTLDVPAAVRERAKLAFGR* |
| Ga0134032_10225111 | 3300012376 | Grasslands Soil | KDPDFLADIQKLNVELEPLPGERVQELIVRTLNVPQAVRERAKLAFGR* |
| Ga0157342_10345562 | 3300012507 | Arabidopsis Rhizosphere | VAELQRTNVELDPLPGAAVEQLVVRTLNVPATVRDRAKLAFGR* |
| Ga0137358_109701232 | 3300012582 | Vadose Zone Soil | ELEPLPGERVQELIVQTLNVPPAVRERAKLAFGR* |
| Ga0157295_103994512 | 3300012906 | Soil | FQAMVRDPEFVADLQRTNVELDPLPGAEVERLVIRTLNVPATVRDRAKLAFGR* |
| Ga0137395_108554031 | 3300012917 | Vadose Zone Soil | KALRDAFNLMVRDREFIADIQKLNVELDPLPGQAVQDLILRTLSVPQSVRERAKLAFGR* |
| Ga0137413_102403251 | 3300012924 | Vadose Zone Soil | IAKLNVELDPLTGEAVQDLIVRTLNVPPAVRERAKLAFGR* |
| Ga0137419_111641522 | 3300012925 | Vadose Zone Soil | AFNAMVKDPDFIADIQKLNVELEPLPGERVQELIVRTLNVPQAVRERAKLAFGR* |
| Ga0137407_108064141 | 3300012930 | Vadose Zone Soil | ELDPLPGERVQELIARTLSVPQAVRERAKLAFGR* |
| Ga0137410_116756942 | 3300012944 | Vadose Zone Soil | QRLNVELDPLPGQAVQDLIVRTLNAPQSVRDRAKLAFGR* |
| Ga0126375_101725321 | 3300012948 | Tropical Forest Soil | TDFIADIQKLNVELDPLPGERVHDLIVRTLNVPQAVRDRAKLAFGR* |
| Ga0164303_106708091 | 3300012957 | Soil | TNVELDPLPGAQVEQLVIRTLSVPATVRDRAKLAFGR* |
| Ga0126369_106396971 | 3300012971 | Tropical Forest Soil | KLNVELEPLPGERVQELIVRTLNVPQAVRERAKLAFGR* |
| Ga0126369_107580351 | 3300012971 | Tropical Forest Soil | MNVELDPLPGEQVTQLAVRALAVPTAVRERAKSAFGR* |
| Ga0164308_119001441 | 3300012985 | Soil | DLQRTNVELDPLPGAQVEQMVIRTLSVPATVRDRAKLAFGR* |
| Ga0164306_113380802 | 3300012988 | Soil | DLQRTNVELEPLPGAEVEQLVVRTLNVPATVRDRAKLAFGR* |
| Ga0164305_104508191 | 3300012989 | Soil | ELDPLPGAAVEQLVIRTLNVPATVRDRAKLAFGR* |
| Ga0075327_10550031 | 3300014272 | Natural And Restored Wetlands | NVELDPLPGDGVQALITQTLNVPASVRERARVAFGR* |
| Ga0173483_107961632 | 3300015077 | Soil | FQKMVRDPEFVADLQRTDVELDPLPGAQVEALVVRTLNVPAAVRDRAKLAFGR* |
| Ga0137409_101511833 | 3300015245 | Vadose Zone Soil | FNLMVRDREFIADIQKLNVELDPLPGQAVQDLILRTLSVPQSVRERAKLAFGR* |
| Ga0137403_103980282 | 3300015264 | Vadose Zone Soil | ADIQKLNVELDPLPGQAVQDLILRTLSVPQSVRERAKLAFGR* |
| Ga0132256_1017246041 | 3300015372 | Arabidopsis Rhizosphere | LADIQKLNVELDPLPGEAVQELIVRTLNVPQAVRERAKLAFGR* |
| Ga0182041_109383581 | 3300016294 | Soil | KLDIDLEPLPGEALAELIVRTLNVPQAVRERAKLAFGR |
| Ga0182037_120337952 | 3300016404 | Soil | LADIRKLDIDLEPLPGAALAELIVRTLNVPQAVRERAKLAFGR |
| Ga0184624_100158304 | 3300018073 | Groundwater Sediment | LQRTNVELEPLPGAEVEQLVVRTLNVPATVRDRAKLAFGR |
| Ga0184612_100354621 | 3300018078 | Groundwater Sediment | IADIQKLNVELDPLPGERVQDLIVRTLNVPQAVRERAKLAFGR |
| Ga0190275_126054221 | 3300018432 | Soil | NVELDPLSGERVQELITRTLAVPAAVRERAKVAFGR |
| Ga0066667_102344282 | 3300018433 | Grasslands Soil | LMVRDPEFIADIQKLNVELDPLSGEAVQELIARTLNVPQSVRERAKLAFGR |
| Ga0066667_110572593 | 3300018433 | Grasslands Soil | DPEFLADVHKLDVELDPLPGEAVAEMIVRTLNVPQAVRERAKLAFGR |
| Ga0190270_117202382 | 3300018469 | Soil | NVELDPLTGERLQDLIATTLDVPASVRERAKVAFGR |
| Ga0196978_10550011 | 3300021067 | Soil | DIKKLNVELAPLSGAKVQELISRTLAVPASVRERAMVAFGR |
| Ga0193699_102646991 | 3300021363 | Soil | MSPLGLADLQRTNVELEPLPGAELEQLVIRTLNVPATVRDRAKLAFGR |
| Ga0210389_110289631 | 3300021404 | Soil | VQDPEFIADVRKLDIELDPLPGATVAQLVAQTLAVPAAVRERALNAFGR |
| Ga0210384_102025904 | 3300021432 | Soil | QKINVELDPLPGAAVAQLVARTLDVPAAVRERAIAAFGR |
| Ga0210392_106469002 | 3300021475 | Soil | INVELDPLPGAGVAQLVAQTLDVPPAVRERAVNAFGR |
| Ga0210409_108757192 | 3300021559 | Soil | AMVKDAEFVADVRKIDVELDPLPGAAVAQLVAQTLAVPAAVRERAVNAFGR |
| Ga0207685_106812241 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | TVKDPEFVAELQRTNVELDPLPGAAVEQLVVRTLNVPATVRDRAKLAFGR |
| Ga0207643_105163911 | 3300025908 | Miscanthus Rhizosphere | QQHLHAVAHRQGERVGALRDAFQKMVKDPEFVADLQRTDVELDSLPGAQVEALVVRTLNVPAAVRDRAKLAFGR |
| Ga0207669_110372672 | 3300025937 | Miscanthus Rhizosphere | FVADIKKVNVELDPLPGERVQELITRTLAVPASVRERAKVAFGR |
| Ga0207661_115692782 | 3300025944 | Corn Rhizosphere | DLQRTNVELDPLPGAQVEALVVRTLNVPAAVRDRAKLAFGR |
| Ga0207679_115939091 | 3300025945 | Corn Rhizosphere | VKDPEFVADLQRTNVELDPLPGAEVERLVIRTLNVPATVRDRAKLAFGR |
| Ga0208291_10259361 | 3300026111 | Natural And Restored Wetlands | NVELDPLPGDGVQALITQTLNVPASVRERARVAFGR |
| Ga0257154_10781641 | 3300026467 | Soil | RVQALREGFDAMVKDAEFVADIRKINVELEPLSGAAIAQLVAQTLNVPAAVRERAISAFG |
| Ga0208525_10058572 | 3300027288 | Soil | FQKTVKDPEFVAELQRTNVELDPLPGAAVEQLVVRTLNVPATVRDRAKLAFGR |
| Ga0209845_10435392 | 3300027324 | Groundwater Sand | AFDAMVKDPEFVADIRKLNVELEPLSGDKVQELAVRTLNIPDAVRERAKVAFGR |
| Ga0209701_105102071 | 3300027862 | Vadose Zone Soil | MIKDPDFLSDLQKLDVELDPLPGEQVAKLVAQTLDVPPAVRERAKLAFGR |
| Ga0209814_103358831 | 3300027873 | Populus Rhizosphere | LNVELEPLAGEQVGELVIRTLNVPAAVRERAKLAFGR |
| Ga0209590_109959921 | 3300027882 | Vadose Zone Soil | ADMRNLDVELDPLSGDEVAKLVARTLDVSPSVRERAKLAFGR |
| Ga0207428_110181612 | 3300027907 | Populus Rhizosphere | DAFQAMVKDPEFTADIGRLNVELDPLSGTQLAERIARTLAVPAAVRDRAKLAFGR |
| Ga0209526_106049542 | 3300028047 | Forest Soil | GIAAARVQALREGFDAMVKDAEFVADVRKIDVELDPLPGAAVARLVEQTLTVPAAVRERAINAFGR |
| Ga0268266_113827151 | 3300028379 | Switchgrass Rhizosphere | PEFVADLQRTDVELDSLPGAQVEALVVRTLNVPAAVRDRAKLAFGR |
| Ga0268265_105725051 | 3300028380 | Switchgrass Rhizosphere | RTNVELEPLPGAEVEQLVIRTLSVPATVRDRAKLAFGR |
| Ga0307285_100078811 | 3300028712 | Soil | VELEPLPGTEVEQLVIRTLNVPATVRDRAKLAFGR |
| Ga0307313_102162321 | 3300028715 | Soil | QAMVKDPEFIADLQRTNVELEPLPGAEVEQLVIRTLNVPATVRDRAKLAFGR |
| Ga0307317_100677392 | 3300028720 | Soil | GALRDAFQKMVKDPEFVAELQRTNVELDPLPGAQVEELVVRTLNVPATVRDRAKLAFGR |
| Ga0307316_100090913 | 3300028755 | Soil | ALRDAFQKMVKDPEFVAELQRTNVELDPLPGAQVEELVVRTLNVPATVRDRAKLAFGR |
| Ga0307306_100282761 | 3300028782 | Soil | DAFQAMVKDPEFVAELQRTDVELDPLPGAAVEQLVVRTLNVPATVRDRAKLAFGR |
| Ga0307283_101298542 | 3300028790 | Soil | MVKDPEFIADLQRTNVELEPLPGTEVEQLVIRTLNVPATVRDRAKLAFGR |
| Ga0307503_102860012 | 3300028802 | Soil | MNVDLEPLPGEAVAQLAARALAVPAAVRERAKAAFGR |
| Ga0307294_100506862 | 3300028810 | Soil | TDPEFVAELQRTDVELDPLPGAAVEQLVVRTLNVPATVRDRAKLAFGR |
| Ga0307304_100371201 | 3300028885 | Soil | VGALRDAFQKMVKDPEFVAELQRTNVELDPLPGAQVEELVVRTLNVPATVRDRAKLAFGR |
| Ga0307304_101209792 | 3300028885 | Soil | NVELEPLPGTEVEQLVIRTLNVPATVRDRAKLAFGR |
| Ga0247827_102100661 | 3300028889 | Soil | ADLQRTNVELDPLPGAQVQELVVRTLNVPATVRDRAKLAFGR |
| Ga0308203_10472801 | 3300030829 | Soil | PDFIADIQKLNVDLEPLPGERVQELIARTLNVPPAVRERAKLAFGR |
| Ga0307501_102527561 | 3300031152 | Soil | LNVDLEPLPGERVQELIVRTLNVPQAVRERAKLAFGR |
| Ga0310888_108585861 | 3300031538 | Soil | VELDPLPGERVQELITRTLAVPDSVRERAKVAFGR |
| Ga0307469_118683742 | 3300031720 | Hardwood Forest Soil | VVDPEFVADLQRTDVELSPLPGEQVAELAARTLSVPAAVRERAKLAFGR |
| Ga0318526_100541372 | 3300031769 | Soil | VKDADFLADVRKLDVELDPLPGAAVAQLIERTLSVPAAVRERAINAFGR |
| Ga0318498_100887321 | 3300031778 | Soil | LDVELDPLPGAAVAQLIEKTLSVPAAVRERAINAFGR |
| Ga0310892_103176863 | 3300031858 | Soil | LNIELDPLPGERVQELITRTLAAPASVRERAKVAFGR |
| Ga0318551_102366912 | 3300031896 | Soil | NRVAMLREALRAMVADPEFLADIHKLDVDLEPLPGEALAELIVRTLNVPQAVRERAKLAFGR |
| Ga0306921_125718481 | 3300031912 | Soil | RLAALRAGFDAMVKDADFIADVGKLDVELDPLPGAAVAQLIEKTLSVPAAVRERAINAFG |
| Ga0310916_103936381 | 3300031942 | Soil | EALRATVADPEFLADIRKLDIDLEPLPGEALAELIVRTLNVPQAVRERAKLAFGR |
| Ga0306926_126585931 | 3300031954 | Soil | LDVELDPLPGAAVAQLIERTLSVPAAVRERAINAFGR |
| Ga0318533_114529581 | 3300032059 | Soil | RKLDIDLEPLPGEALAELIVRTLNVPQAVRERAKLAFGR |
| Ga0310890_117424291 | 3300032075 | Soil | NAMVKDPEFVGDIKKVNVELDPLPGERVQELITRTLAVPDSVRERAKVAFGR |
| Ga0318577_104756721 | 3300032091 | Soil | AMLREALRATVADPEFLADIRKLDIDLEPLPGEALAELIVRTLNVPQAVRERAKLAFGR |
| Ga0307470_114573172 | 3300032174 | Hardwood Forest Soil | KLNVELEPLPGERVQELIVRTLNVPQAVRERAKLAFGR |
| Ga0306920_1025398972 | 3300032261 | Soil | PEFIADVRKINVELDPLPGAAVAQLVAEALDVPRAVRERAIGAFGR |
| Ga0306920_1025856411 | 3300032261 | Soil | IHKLNVELDPLPGQAVQNLIVSTLNIPQAVRERAKLAFGR |
| ⦗Top⦘ |