


| Basic Information | |
|---|---|
| Family ID | F049938 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 146 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MELIKATNPYSGESEMLTPEEHKLYIEIKTAEFDEDY |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 146 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 94.52 % |
| % of genes near scaffold ends (potentially truncated) | 99.32 % |
| % of genes from short scaffolds (< 2000 bps) | 97.26 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | environmental samples (35.616 % of family members) |
| NCBI Taxonomy ID | 186616 |
| Taxonomy | All Organisms → Viruses → environmental samples |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (35.616 % of family members) |
| Environment Ontology (ENVO) | Unclassified (88.356 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (82.192 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.69% β-sheet: 12.31% Coil/Unstructured: 60.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.14 % |
| Unclassified | root | N/A | 19.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001450|JGI24006J15134_10189218 | All Organisms → Viruses → environmental samples → uncultured virus | 638 | Open in IMG/M |
| 3300001450|JGI24006J15134_10210913 | All Organisms → Viruses → environmental samples → uncultured virus | 584 | Open in IMG/M |
| 3300001460|JGI24003J15210_10092179 | All Organisms → Viruses → environmental samples → uncultured virus | 887 | Open in IMG/M |
| 3300001460|JGI24003J15210_10138356 | All Organisms → Viruses → environmental samples → uncultured virus | 640 | Open in IMG/M |
| 3300001472|JGI24004J15324_10111063 | All Organisms → Viruses → environmental samples → uncultured virus | 687 | Open in IMG/M |
| 3300001472|JGI24004J15324_10116362 | All Organisms → Viruses → environmental samples → uncultured virus | 662 | Open in IMG/M |
| 3300001589|JGI24005J15628_10165434 | All Organisms → Viruses → environmental samples → uncultured virus | 655 | Open in IMG/M |
| 3300001589|JGI24005J15628_10177694 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 618 | Open in IMG/M |
| 3300001718|JGI24523J20078_1016429 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 942 | Open in IMG/M |
| 3300001718|JGI24523J20078_1037585 | All Organisms → Viruses → environmental samples → uncultured virus | 537 | Open in IMG/M |
| 3300001720|JGI24513J20088_1018543 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 775 | Open in IMG/M |
| 3300002231|KVRMV2_100029860 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300002231|KVRMV2_100709920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 537 | Open in IMG/M |
| 3300006164|Ga0075441_10190197 | All Organisms → Viruses → environmental samples → uncultured virus | 766 | Open in IMG/M |
| 3300006165|Ga0075443_10307994 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 582 | Open in IMG/M |
| 3300006190|Ga0075446_10198233 | All Organisms → Viruses → environmental samples → uncultured virus | 561 | Open in IMG/M |
| 3300006191|Ga0075447_10308800 | All Organisms → Viruses → environmental samples → uncultured virus | 508 | Open in IMG/M |
| 3300006336|Ga0068502_1866579 | Not Available | 640 | Open in IMG/M |
| 3300006340|Ga0068503_10466080 | All Organisms → Viruses → Predicted Viral | 1376 | Open in IMG/M |
| 3300006340|Ga0068503_10543008 | All Organisms → Viruses → Predicted Viral | 1601 | Open in IMG/M |
| 3300006738|Ga0098035_1158590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 767 | Open in IMG/M |
| 3300006749|Ga0098042_1097397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 748 | Open in IMG/M |
| 3300006752|Ga0098048_1189148 | Not Available | 609 | Open in IMG/M |
| 3300006752|Ga0098048_1256408 | Not Available | 510 | Open in IMG/M |
| 3300006753|Ga0098039_1205018 | Not Available | 668 | Open in IMG/M |
| 3300006754|Ga0098044_1141177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 969 | Open in IMG/M |
| 3300006802|Ga0070749_10624758 | All Organisms → Viruses → environmental samples → uncultured virus | 580 | Open in IMG/M |
| 3300006802|Ga0070749_10783937 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 506 | Open in IMG/M |
| 3300006810|Ga0070754_10261976 | All Organisms → Viruses → environmental samples → uncultured virus | 786 | Open in IMG/M |
| 3300006925|Ga0098050_1049270 | All Organisms → Viruses → Predicted Viral | 1112 | Open in IMG/M |
| 3300006925|Ga0098050_1085313 | All Organisms → Viruses → environmental samples → uncultured virus | 812 | Open in IMG/M |
| 3300006928|Ga0098041_1186501 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300006928|Ga0098041_1295151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 515 | Open in IMG/M |
| 3300007229|Ga0075468_10126027 | All Organisms → Viruses → environmental samples → uncultured virus | 791 | Open in IMG/M |
| 3300007229|Ga0075468_10153325 | Not Available | 696 | Open in IMG/M |
| 3300007345|Ga0070752_1365697 | All Organisms → Viruses → environmental samples → uncultured virus | 539 | Open in IMG/M |
| 3300008216|Ga0114898_1134641 | All Organisms → Viruses → environmental samples → uncultured virus | 719 | Open in IMG/M |
| 3300008217|Ga0114899_1121276 | All Organisms → Viruses → environmental samples → uncultured virus | 868 | Open in IMG/M |
| 3300008219|Ga0114905_1168002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 722 | Open in IMG/M |
| 3300008219|Ga0114905_1282204 | All Organisms → Viruses → environmental samples → uncultured virus | 514 | Open in IMG/M |
| 3300008220|Ga0114910_1206823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 538 | Open in IMG/M |
| 3300008221|Ga0114916_1116943 | All Organisms → Viruses → environmental samples → uncultured virus | 627 | Open in IMG/M |
| 3300009173|Ga0114996_10957282 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 610 | Open in IMG/M |
| 3300009418|Ga0114908_1083534 | All Organisms → Viruses → Predicted Viral | 1088 | Open in IMG/M |
| 3300009418|Ga0114908_1277411 | Not Available | 500 | Open in IMG/M |
| 3300009601|Ga0114914_1069383 | Not Available | 543 | Open in IMG/M |
| 3300009602|Ga0114900_1049756 | All Organisms → Viruses → Predicted Viral | 1291 | Open in IMG/M |
| 3300009619|Ga0105236_1028723 | Not Available | 677 | Open in IMG/M |
| 3300009620|Ga0114912_1152310 | Not Available | 539 | Open in IMG/M |
| 3300009703|Ga0114933_10374685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 935 | Open in IMG/M |
| 3300009785|Ga0115001_10916942 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300009786|Ga0114999_10827516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 682 | Open in IMG/M |
| 3300010148|Ga0098043_1115696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 775 | Open in IMG/M |
| 3300010150|Ga0098056_1029310 | All Organisms → Viruses → Predicted Viral | 1936 | Open in IMG/M |
| 3300010151|Ga0098061_1130293 | Not Available | 921 | Open in IMG/M |
| 3300010153|Ga0098059_1083681 | All Organisms → Viruses → Predicted Viral | 1272 | Open in IMG/M |
| 3300010883|Ga0133547_11570720 | All Organisms → Viruses → Predicted Viral | 1231 | Open in IMG/M |
| 3300011013|Ga0114934_10454557 | All Organisms → Viruses → environmental samples → uncultured virus | 568 | Open in IMG/M |
| 3300012524|Ga0129331_1004035 | Not Available | 506 | Open in IMG/M |
| 3300017697|Ga0180120_10209597 | All Organisms → Viruses → environmental samples → uncultured virus | 804 | Open in IMG/M |
| 3300017729|Ga0181396_1122791 | All Organisms → Viruses → environmental samples → uncultured virus | 535 | Open in IMG/M |
| 3300017735|Ga0181431_1086008 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 705 | Open in IMG/M |
| 3300017741|Ga0181421_1065764 | All Organisms → Viruses → environmental samples → uncultured virus | 955 | Open in IMG/M |
| 3300017741|Ga0181421_1178249 | All Organisms → Viruses → environmental samples → uncultured virus | 546 | Open in IMG/M |
| 3300017756|Ga0181382_1050455 | All Organisms → Viruses → Predicted Viral | 1201 | Open in IMG/M |
| 3300017759|Ga0181414_1173382 | All Organisms → Viruses → environmental samples → uncultured virus | 561 | Open in IMG/M |
| 3300017773|Ga0181386_1244613 | All Organisms → Viruses → environmental samples → uncultured virus | 531 | Open in IMG/M |
| 3300017986|Ga0181569_10926583 | Not Available | 565 | Open in IMG/M |
| 3300018410|Ga0181561_10277689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 787 | Open in IMG/M |
| 3300018417|Ga0181558_10483312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 647 | Open in IMG/M |
| 3300020176|Ga0181556_1297522 | Not Available | 552 | Open in IMG/M |
| 3300020404|Ga0211659_10215272 | Not Available | 859 | Open in IMG/M |
| 3300022074|Ga0224906_1013208 | Not Available | 3130 | Open in IMG/M |
| 3300022178|Ga0196887_1097206 | All Organisms → Viruses → environmental samples → uncultured virus | 663 | Open in IMG/M |
| (restricted) 3300024052|Ga0255050_10050568 | Not Available | 887 | Open in IMG/M |
| 3300024344|Ga0209992_10232641 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 771 | Open in IMG/M |
| (restricted) 3300024520|Ga0255047_10255334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 889 | Open in IMG/M |
| 3300025049|Ga0207898_1041145 | Not Available | 580 | Open in IMG/M |
| 3300025069|Ga0207887_1062625 | Not Available | 608 | Open in IMG/M |
| 3300025071|Ga0207896_1012756 | All Organisms → Viruses → Predicted Viral | 1492 | Open in IMG/M |
| 3300025071|Ga0207896_1020658 | All Organisms → Viruses → Predicted Viral | 1143 | Open in IMG/M |
| 3300025101|Ga0208159_1064170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 725 | Open in IMG/M |
| 3300025112|Ga0209349_1021027 | All Organisms → Viruses → environmental samples → uncultured virus | 2306 | Open in IMG/M |
| 3300025120|Ga0209535_1103384 | All Organisms → Viruses → environmental samples → uncultured virus | 1014 | Open in IMG/M |
| 3300025120|Ga0209535_1126390 | All Organisms → Viruses → environmental samples → uncultured virus | 858 | Open in IMG/M |
| 3300025120|Ga0209535_1191164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 589 | Open in IMG/M |
| 3300025122|Ga0209434_1062364 | All Organisms → Viruses → Predicted Viral | 1126 | Open in IMG/M |
| 3300025133|Ga0208299_1131646 | Not Available | 807 | Open in IMG/M |
| 3300025138|Ga0209634_1174267 | All Organisms → Viruses → environmental samples → uncultured virus | 851 | Open in IMG/M |
| 3300025138|Ga0209634_1246629 | All Organisms → Viruses → environmental samples → uncultured virus | 649 | Open in IMG/M |
| 3300025138|Ga0209634_1273150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 598 | Open in IMG/M |
| 3300025168|Ga0209337_1069658 | All Organisms → Viruses → Predicted Viral | 1745 | Open in IMG/M |
| 3300025168|Ga0209337_1133436 | All Organisms → Viruses → Predicted Viral | 1101 | Open in IMG/M |
| 3300025168|Ga0209337_1169984 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 921 | Open in IMG/M |
| 3300025168|Ga0209337_1173811 | Not Available | 906 | Open in IMG/M |
| 3300025168|Ga0209337_1186496 | All Organisms → Viruses → environmental samples → uncultured virus | 858 | Open in IMG/M |
| 3300025168|Ga0209337_1285213 | All Organisms → Viruses → environmental samples → uncultured virus | 608 | Open in IMG/M |
| 3300025237|Ga0208031_1037182 | All Organisms → Viruses → environmental samples → uncultured virus | 631 | Open in IMG/M |
| 3300025237|Ga0208031_1042689 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 580 | Open in IMG/M |
| 3300025237|Ga0208031_1047468 | All Organisms → Viruses → environmental samples → uncultured virus | 543 | Open in IMG/M |
| 3300025266|Ga0208032_1071993 | All Organisms → Viruses → environmental samples → uncultured virus | 736 | Open in IMG/M |
| 3300025267|Ga0208179_1049967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 948 | Open in IMG/M |
| 3300025270|Ga0208813_1108067 | All Organisms → Viruses → environmental samples → uncultured virus | 548 | Open in IMG/M |
| 3300025270|Ga0208813_1119280 | Not Available | 511 | Open in IMG/M |
| 3300025276|Ga0208814_1046821 | All Organisms → Viruses → Predicted Viral | 1281 | Open in IMG/M |
| 3300025276|Ga0208814_1064317 | All Organisms → Viruses → Predicted Viral | 1023 | Open in IMG/M |
| 3300025276|Ga0208814_1085041 | All Organisms → Viruses → environmental samples → uncultured virus | 830 | Open in IMG/M |
| 3300025276|Ga0208814_1099449 | All Organisms → Viruses → environmental samples → uncultured virus | 735 | Open in IMG/M |
| 3300025282|Ga0208030_1033758 | All Organisms → Viruses | 1560 | Open in IMG/M |
| 3300025282|Ga0208030_1112151 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 676 | Open in IMG/M |
| 3300025287|Ga0207903_1092653 | Not Available | 506 | Open in IMG/M |
| 3300025296|Ga0208316_1057962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 783 | Open in IMG/M |
| 3300025508|Ga0208148_1121106 | All Organisms → Viruses → environmental samples → uncultured virus | 539 | Open in IMG/M |
| 3300025621|Ga0209504_1080417 | All Organisms → Viruses → environmental samples → uncultured virus | 897 | Open in IMG/M |
| 3300025873|Ga0209757_10257032 | Not Available | 555 | Open in IMG/M |
| 3300027522|Ga0209384_1101947 | All Organisms → Viruses → environmental samples → uncultured virus | 681 | Open in IMG/M |
| 3300027522|Ga0209384_1138971 | All Organisms → Viruses → environmental samples → uncultured virus | 541 | Open in IMG/M |
| 3300027668|Ga0209482_1091909 | All Organisms → Viruses → environmental samples → uncultured virus | 991 | Open in IMG/M |
| 3300027668|Ga0209482_1137674 | All Organisms → Viruses → environmental samples → uncultured virus | 734 | Open in IMG/M |
| 3300027686|Ga0209071_1063502 | All Organisms → Viruses → Predicted Viral | 1105 | Open in IMG/M |
| 3300027686|Ga0209071_1153693 | All Organisms → Viruses → environmental samples → uncultured virus | 655 | Open in IMG/M |
| 3300027704|Ga0209816_1128434 | All Organisms → Viruses → environmental samples → uncultured virus | 940 | Open in IMG/M |
| 3300027704|Ga0209816_1179821 | Not Available | 723 | Open in IMG/M |
| 3300027714|Ga0209815_1125979 | All Organisms → Viruses | 834 | Open in IMG/M |
| 3300027771|Ga0209279_10130630 | Not Available | 727 | Open in IMG/M |
| (restricted) 3300027861|Ga0233415_10185964 | All Organisms → Viruses → environmental samples → uncultured virus | 954 | Open in IMG/M |
| 3300028022|Ga0256382_1027157 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1254 | Open in IMG/M |
| 3300028190|Ga0257108_1071256 | All Organisms → Viruses → Predicted Viral | 1038 | Open in IMG/M |
| 3300031167|Ga0308023_1040546 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 909 | Open in IMG/M |
| 3300031510|Ga0308010_1036318 | All Organisms → Viruses → Predicted Viral | 2060 | Open in IMG/M |
| 3300031510|Ga0308010_1119925 | All Organisms → Viruses → Predicted Viral | 1003 | Open in IMG/M |
| 3300031519|Ga0307488_10422203 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 818 | Open in IMG/M |
| 3300031519|Ga0307488_10437314 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 798 | Open in IMG/M |
| 3300031601|Ga0307992_1222484 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 690 | Open in IMG/M |
| 3300031627|Ga0302118_10384036 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 634 | Open in IMG/M |
| 3300031629|Ga0307985_10023481 | All Organisms → Viruses → Predicted Viral | 2835 | Open in IMG/M |
| 3300031638|Ga0302125_10155820 | Not Available | 724 | Open in IMG/M |
| 3300031655|Ga0308018_10065685 | All Organisms → Viruses → Predicted Viral | 1300 | Open in IMG/M |
| 3300031801|Ga0310121_10697908 | Not Available | 539 | Open in IMG/M |
| 3300032274|Ga0316203_1151577 | Not Available | 645 | Open in IMG/M |
| 3300033742|Ga0314858_028628 | All Organisms → Viruses → Predicted Viral | 1274 | Open in IMG/M |
| 3300033742|Ga0314858_149991 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 599 | Open in IMG/M |
| 3300034374|Ga0348335_121787 | All Organisms → Viruses → environmental samples → uncultured virus | 771 | Open in IMG/M |
| 3300034374|Ga0348335_131540 | All Organisms → Viruses → environmental samples → uncultured virus | 720 | Open in IMG/M |
| 3300034418|Ga0348337_062619 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 1405 | Open in IMG/M |
| 3300034656|Ga0326748_036513 | Not Available | 682 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 35.62% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 17.81% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 10.27% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 8.22% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 5.48% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 4.11% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 2.74% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 2.05% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.05% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 2.05% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.37% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 1.37% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 1.37% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 1.37% |
| Marine Oceanic | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic | 0.68% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.68% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.68% |
| Filtered Seawater | Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater | 0.68% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.68% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300001718 | Marine viral communities from the Pacific Ocean - LP-48 | Environmental | Open in IMG/M |
| 3300001720 | Marine viral communities from the Pacific Ocean - LP-36 | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006165 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA | Environmental | Open in IMG/M |
| 3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
| 3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
| 3300006336 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0500m | Environmental | Open in IMG/M |
| 3300006340 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0770m | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300008216 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar | Environmental | Open in IMG/M |
| 3300008217 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 | Environmental | Open in IMG/M |
| 3300008219 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 | Environmental | Open in IMG/M |
| 3300008220 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 | Environmental | Open in IMG/M |
| 3300008221 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009418 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 | Environmental | Open in IMG/M |
| 3300009601 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_38 | Environmental | Open in IMG/M |
| 3300009602 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 | Environmental | Open in IMG/M |
| 3300009619 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3827_250 | Environmental | Open in IMG/M |
| 3300009620 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_51 | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300012524 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017729 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11 | Environmental | Open in IMG/M |
| 3300017735 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017986 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018410 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300024052 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_5 | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024520 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1 | Environmental | Open in IMG/M |
| 3300025049 | Marine viral communities from the Pacific Ocean - LP-55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025069 | Marine viral communities from the Pacific Ocean - LP-38 (SPAdes) | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025112 | Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025122 | Marine viral communities from the Pacific Ocean - ETNP_2_300 (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025237 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_38 (SPAdes) | Environmental | Open in IMG/M |
| 3300025266 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 (SPAdes) | Environmental | Open in IMG/M |
| 3300025267 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar (SPAdes) | Environmental | Open in IMG/M |
| 3300025270 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025282 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 (SPAdes) | Environmental | Open in IMG/M |
| 3300025287 | Marine viral communities from the Deep Pacific Ocean - MSP-131 (SPAdes) | Environmental | Open in IMG/M |
| 3300025296 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025621 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes) | Environmental | Open in IMG/M |
| 3300025873 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300027522 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027668 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027686 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027704 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027714 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027771 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
| 3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
| 3300028190 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_1000m | Environmental | Open in IMG/M |
| 3300031167 | Marine microbial communities from water near the shore, Antarctic Ocean - #418 | Environmental | Open in IMG/M |
| 3300031510 | Marine microbial communities from water near the shore, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031601 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #133 | Environmental | Open in IMG/M |
| 3300031627 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_33.1 | Environmental | Open in IMG/M |
| 3300031629 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #80 | Environmental | Open in IMG/M |
| 3300031638 | Marine microbial communities from Western Arctic Ocean, Canada - CB4_surface | Environmental | Open in IMG/M |
| 3300031655 | Marine microbial communities from water near the shore, Antarctic Ocean - #282 | Environmental | Open in IMG/M |
| 3300031801 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_Tmax_986 | Environmental | Open in IMG/M |
| 3300032274 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1 | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| 3300034656 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 502_2477 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24006J15134_101892183 | 3300001450 | Marine | MDTMIKATNPYSNESAMLTPEEHKLYIEIKEHERDE |
| JGI24006J15134_102109132 | 3300001450 | Marine | MDTMIKATNPYSNQSTMLTPEEHKLYIEIKEHERDEEYNQMQKKLSK |
| JGI24003J15210_100921794 | 3300001460 | Marine | MDTMIKATNPYSNESAMLTPEEHKLYIEIKEHERDEEYNEMQKKL |
| JGI24003J15210_101383563 | 3300001460 | Marine | MDTMIKATNPYSNQSTMLTPEEHKLYIEIKTAEFDQDYNT |
| JGI24004J15324_101110631 | 3300001472 | Marine | MDTMIKATNPYSNQSTMLTPDEHKLYIEIKTAEFDEDYNTMQKKL |
| JGI24004J15324_101163623 | 3300001472 | Marine | MELNNCIKATNPYSGQSVLLTPEEHKLYIEIKTAEFDEDYNT |
| JGI24005J15628_101654343 | 3300001589 | Marine | MDDTMIKATNPYSNQSTMLTPEEHKLYIEIKTAEFDEDYNTMQKK |
| JGI24005J15628_101776941 | 3300001589 | Marine | MELNNCIKATNPYSGQSAMLTPEEHKLYIEIKTAE |
| JGI24523J20078_10164292 | 3300001718 | Marine | MDTMIKATNPYSKQSTMLTPDEHKLYIEIKEHERDEEYNEMQKTNGG* |
| JGI24523J20078_10375852 | 3300001718 | Marine | MELNNCIKATNPYSKQSVMLTPEEHKLYIEIKEHERD |
| JGI24513J20088_10185431 | 3300001720 | Marine | MELNNCIKATNPYSGESAMLTPEEHKLYIEIKTAEF |
| KVRMV2_1000298601 | 3300002231 | Marine Sediment | MELIKATNPYSGESEMLTPEEHKLYIEIKEAELNEDYK |
| KVRMV2_1007099203 | 3300002231 | Marine Sediment | MELIKATNPYSGESEMLTPEEHKLYMEIKIAEINEDYDTVR |
| Ga0075441_101901974 | 3300006164 | Marine | MDLDRMIKATNPYSNQSTMLTPTEHKLYIEIKTAE |
| Ga0075443_103079942 | 3300006165 | Marine | MDTMIKATNPYSNQSTMLTPTEHKLYIEIKQAEFDEDYTAMQKKLSK |
| Ga0075446_101982333 | 3300006190 | Marine | MDTMIKATNPYSNQSTMLTPTEHKLYIEIKQAEFDEDY |
| Ga0075447_103088002 | 3300006191 | Marine | MDLDRMIKATNPYSNQSTMLTPTEHKLYIEIKTAEFDE |
| Ga0068502_18665793 | 3300006336 | Marine | MTDKIKATNPYSGQSEMLTPEEHKLYIEIKEAERDE |
| Ga0068503_104660805 | 3300006340 | Marine | MTQQIKTTNPYSGESAMLTQDEHKLYIEIKEAERDE |
| Ga0068503_105430086 | 3300006340 | Marine | MTDKIKATNPYSGQSEMLTPEEHKLYIEIKDAEIKEDYK |
| Ga0098035_11585901 | 3300006738 | Marine | MTDKIKATNPYSGQSEMLTPEEHKLYIEIKDAEIAEDYKTM |
| Ga0098042_10973974 | 3300006749 | Marine | MELIKATNPYSGESEMLTPEEHKLYIEIKQAEWDED |
| Ga0098048_11891483 | 3300006752 | Marine | MTDKIKTINPFSGQSEMLTPEEHALYTQIKQDEITENYSSMTK |
| Ga0098048_12564081 | 3300006752 | Marine | MTDKIKTINPYSGESEMLTPEEHALYTQIKQDEITENYSSM |
| Ga0098039_12050183 | 3300006753 | Marine | MTDKIKATNPYSGQSEMLTPEEHKLYIEIKEAERDED |
| Ga0098044_11411774 | 3300006754 | Marine | MTDKIKATNPYSGQSEMLTPEEHKLYIEIKEAEINEDYKT |
| Ga0070749_106247581 | 3300006802 | Aqueous | MDDTMIKATNPYSGESAMLTPDEHKLYIEIKQAEWDEDYKTVQQGLSK |
| Ga0070749_107839373 | 3300006802 | Aqueous | MSKIKATNPYSGESEMLTPEEHKLYIEIKQAEWDED |
| Ga0070754_102619764 | 3300006810 | Aqueous | MDKIKATNPDSGESAMLTTEEHKLYIKIKEAEFNEDYKTVQQGLSK |
| Ga0098050_10492701 | 3300006925 | Marine | MTDKIKTINPYSGQSEMLTPEEHKLYIEIKDAEIAEDYK |
| Ga0098050_10853133 | 3300006925 | Marine | MTDKIKTINPYSGESEMLTPEEHALYTQIKQDEITENYSSMTK |
| Ga0098041_11865013 | 3300006928 | Marine | MTDKIKATNPYSGQSEMLTPEEHKLYIEIKEAERDEDYKTMQ |
| Ga0098041_12951513 | 3300006928 | Marine | MELIKATNPYSGESAMLTPEEHKLYIEIKQAEIDE |
| Ga0075468_101260271 | 3300007229 | Aqueous | MDKIKATNPDSGESAMLTTEEHKLYIKIKEAEFNEDYKTVQQGLSKFSR |
| Ga0075468_101533251 | 3300007229 | Aqueous | MDTMIKATNPYSNESTMLTPTEHKLYIEIKEAEFDK |
| Ga0070752_13656972 | 3300007345 | Aqueous | MDKIKATNPDSGESAMLTTEEHKLYIKIKEAEFNEDYKTVQQGLSKF |
| Ga0114898_11346411 | 3300008216 | Deep Ocean | MIERIKATNPYSGESEMLTPEEHKLYIEIKEAELN |
| Ga0114899_11212764 | 3300008217 | Deep Ocean | MIERIKATNPYSGESEMLTPEEHKLYIEIKQAEWDEDYD |
| Ga0114905_11680024 | 3300008219 | Deep Ocean | MELIKATNPYSGESEMLTPEEHKLYIEIKTAEFDEDY |
| Ga0114905_12822042 | 3300008219 | Deep Ocean | MIEKIKATNPYSGQSEMLTPEEHKLYIEIKEAELNE |
| Ga0114910_12068233 | 3300008220 | Deep Ocean | MELIKATNPYSGESEMLTPEEHKLYIEIKTAEFDEDYNTM |
| Ga0114916_11169432 | 3300008221 | Deep Ocean | MIKATNPYSNQSTMLTPTEHKLYIEIKQAEFDEDYTAMQKKLSKFSR |
| Ga0114996_109572823 | 3300009173 | Marine | MNLDTMIKATNPYSKQSTMLTPDEHKLYIEIKEHERDEEYNEMQKK |
| Ga0114908_10835346 | 3300009418 | Deep Ocean | MTDKIKATNPYSGQSEMLTPEEHKLYIEIKEAERDEDYK |
| Ga0114908_12774112 | 3300009418 | Deep Ocean | MTTLIRATNPYSGQSEMLTPDEHKLYIEIKEAERDEDYKT |
| Ga0114914_10693833 | 3300009601 | Deep Ocean | MDTMIKATNPYSNQSAMLTPTEHKLYIEIKQAEFDEDYNSMQK |
| Ga0114900_10497561 | 3300009602 | Deep Ocean | MTDKIKTTNPYSGQSEMLTPEEHTLYIEIKEHERDEE |
| Ga0105236_10287231 | 3300009619 | Marine Oceanic | MTQQIKTTNPYSGQSTMLTDEEHKLYIDIKQAEMDEH |
| Ga0114912_11523101 | 3300009620 | Deep Ocean | MKGRMTQQIKTINPYSGQSTMLTKEEHDLYQQIKQDEYLGNYNLM |
| Ga0114933_103746851 | 3300009703 | Deep Subsurface | MIEKIKATNPYSGESEMLTPEEHKLYIAIKEAELDE |
| Ga0115001_109169423 | 3300009785 | Marine | MTKVTNPYSNQSTMLTPEEHKLYIEIKEHERDEEYSAMQKKLSKFSR |
| Ga0114999_108275161 | 3300009786 | Marine | MTQQIKTTNPYSGESAMLSDEEHKLYIEIKDAEINEDYNTM |
| Ga0098043_11156961 | 3300010148 | Marine | MELIKATNPYSGESEMLTPEEHKLYIEIKQAEWDEDYDTV |
| Ga0098056_10293107 | 3300010150 | Marine | MTDKIKTTNPYSGESEMLTPEEHKLYTQVKQDEIDE |
| Ga0098061_11302931 | 3300010151 | Marine | MTDKIKTINPYSGESEMLTPEEHALYTQIKQDEITENY |
| Ga0098059_10836816 | 3300010153 | Marine | MTDKIKATNPYSGQSEMLTSEEHTLYIEIKEHERDEEY |
| Ga0133547_115707201 | 3300010883 | Marine | MDTMIKATNPYSNQSTMLTPEEHKLYIEIKTAEFDEDYNTMQKKLSK |
| Ga0114934_104545571 | 3300011013 | Deep Subsurface | MIERIKATNPYSGESEMLTPEEHKLYIEIKEAELNEDY |
| Ga0129331_10040353 | 3300012524 | Aqueous | MDTMIKATNPYSNESTMLTPTEHKLYIEIKEAEFDKDYNTMQK |
| Ga0180120_102095974 | 3300017697 | Freshwater To Marine Saline Gradient | MDKIKATNPYSGESAMLTPDEHKLYIEIKQAEWDEDYKTVQQGL |
| Ga0181396_11227912 | 3300017729 | Seawater | MDTMIKATNPYSNQSTMLTPDEHKLYIEIKQAEFDEDY |
| Ga0181431_10860083 | 3300017735 | Seawater | MDKIKATNPYSGQSAMLTPDEHKLYIEIKEAEFNED |
| Ga0181421_10657641 | 3300017741 | Seawater | MDKIKATKPYSGQSEMLTPEEHKLYIEIKEAEFNEDYKTV |
| Ga0181421_11782493 | 3300017741 | Seawater | MIERIKATNPYSGESEMLTPEEHKLYMEIKEAELDE |
| Ga0181382_10504555 | 3300017756 | Seawater | MTDKIKATNPYSGESEMLTPEEHKLYIEIKEAEFNEDYKTV |
| Ga0181414_11733821 | 3300017759 | Seawater | MSKIKATNPYSGESEMLTPEEHKLYIEIKEHERDEEYS |
| Ga0181386_12446131 | 3300017773 | Seawater | MDKIKATNPYSGESAMLTPDEHKLYIEIKQAEWDE |
| Ga0181569_109265833 | 3300017986 | Salt Marsh | MITKIKTTNPYSGQSEMLTPEEHKLYVEVKQAEVNE |
| Ga0181561_102776891 | 3300018410 | Salt Marsh | MELIKATNPYSGESEMLTPEEHKLYIEIKQAEWDEDY |
| Ga0181558_104833122 | 3300018417 | Salt Marsh | MNDKIKATNPYSGQSEMLTPEEHKLYIQIKEAERDEDY |
| Ga0181556_12975221 | 3300020176 | Salt Marsh | MTTKIKTTNPYSGQSEMLTPEEHKLYVEVKQAEVNEDY |
| Ga0211659_102152724 | 3300020404 | Marine | MELIKATNPYSGESEMLTPEEHKLYIEIKQAEIDEDYST |
| Ga0224906_10132081 | 3300022074 | Seawater | MIERIKATNPYSGQSEMLTPEEHKLYVEILQAEWD |
| Ga0196887_10972063 | 3300022178 | Aqueous | MDTMIKATNPYSNESAMLTPEEHKLYIEIKTAEFDEDYNT |
| (restricted) Ga0255050_100505681 | 3300024052 | Seawater | MDTMIKATNPYSNQSTMLTPEEHKLYIEIKEHERDEEYN |
| Ga0209992_102326411 | 3300024344 | Deep Subsurface | MELIKATNPYSGESEMLTPEEHKLYIEIKEAELDEDYK |
| (restricted) Ga0255047_102553344 | 3300024520 | Seawater | MTQQIKTTNPYSGQSTMLTDEEHKLYIDIKQAEMDEHYDVM |
| Ga0207898_10411451 | 3300025049 | Marine | MTTQTQVTNPYSGQSTMLTDEEHKLYIEIKTAEMDEHYDVMQ |
| Ga0207887_10626251 | 3300025069 | Marine | MTQQIKTTNPYSGESTMLTDEEYTLYLNIKDAEWTE |
| Ga0207896_10127567 | 3300025071 | Marine | MELIKATNPFSGESAMLTPEEHKLYIEIKEHERDEEYS |
| Ga0207896_10206586 | 3300025071 | Marine | MDTMIKATNPYSNQSTMLTPEEHKLYIEIKTAEFDE |
| Ga0208159_10641703 | 3300025101 | Marine | MTDKIKATNPYSGQSEMLTPEEHKLYIQIKEAERDEDYDTM |
| Ga0209349_10210277 | 3300025112 | Marine | MTDKIKATNPYSGQSEMLTPEEHTLYIQIKEAERD |
| Ga0209535_11033841 | 3300025120 | Marine | MDKIKATNPYSGESAMLTTEEHKLYIKIKEAEFNE |
| Ga0209535_11263904 | 3300025120 | Marine | MDTMIKATNPYSNQSTMLTPEEHKLYIEIKTAEFDEDYNT |
| Ga0209535_11911643 | 3300025120 | Marine | MELNNCIKATNPYSGESAMLTPEEHKLYIEIKEHE |
| Ga0209434_10623641 | 3300025122 | Marine | MSDKIKAINPYSGQTEMLTPDEHKLYIEIKQAEFDEDYTTMQKGL |
| Ga0208299_11316464 | 3300025133 | Marine | MTDKIKATNPYSGQSEMLTPEEHKLYIEIKEAERD |
| Ga0209634_11742671 | 3300025138 | Marine | MTQQIKATNPYSGESAMLTPEEHKLYIEIKEAEFNED |
| Ga0209634_12466293 | 3300025138 | Marine | MDKIKATNPYSGESAMLTTEEHKLYIKIKEAEFNEDYKT |
| Ga0209634_12731501 | 3300025138 | Marine | MELNNCIKATNPYSGQSAMLTPEEHKLYIEIKTAEFDEDYK |
| Ga0209337_10696581 | 3300025168 | Marine | MDDTMIKATNPYSNQSTMLTPEEHKLYIEIKTAEF |
| Ga0209337_11334361 | 3300025168 | Marine | MTQQIKATNPYSGESAMLTPEEHKLYIEIKEAEFN |
| Ga0209337_11699845 | 3300025168 | Marine | MEQNNCIKATNPYSGQSALLTPEEHKLYIEIKEHE |
| Ga0209337_11738114 | 3300025168 | Marine | METKIKTTNPYSGQSAMLTEDEHKLYIDIKTAEVNED |
| Ga0209337_11864963 | 3300025168 | Marine | MDTMIKATNPYSNQSTMLTPDEHKLYIEIKEHERDEEYSAMQKK |
| Ga0209337_12852133 | 3300025168 | Marine | MELNNCIKATNPYSKQSVMLTPEEHKLYIEIKEHERDEEYNQMQKKLS |
| Ga0208031_10371823 | 3300025237 | Deep Ocean | MDTMIKATNPYSNQSTMLTPTEHKLYIEIKTAEFDEDYNTM |
| Ga0208031_10426893 | 3300025237 | Deep Ocean | MDTMIKATNPYSNESTMLTPTEHKLYIEIKTAEFDEDYN |
| Ga0208031_10474682 | 3300025237 | Deep Ocean | MTQMIKTTNPDSNQSTMLTPEEHKLYIEIKTAEFDEDYD |
| Ga0208032_10719931 | 3300025266 | Deep Ocean | MTQMIKATNPYSNQSTMLTPEEHKLYIEIKTAEFDEDY |
| Ga0208179_10499673 | 3300025267 | Deep Ocean | MELIKATNPYSGESEMLTPEEHKLYIEIKTAEFDEDYN |
| Ga0208813_11080673 | 3300025270 | Deep Ocean | MIEKIKATNPYSGESEMLTPEEHKLYIEIKEAELDED |
| Ga0208813_11192801 | 3300025270 | Deep Ocean | MTDKIKATNPYSGQSEMLTPEEHKLYIEIKEAERDEDYKTM |
| Ga0208814_10468215 | 3300025276 | Deep Ocean | MTQMIKATNPYSNQSTMLTPTEHKLYIEIKTAEFDEDYN |
| Ga0208814_10643175 | 3300025276 | Deep Ocean | MDTMIKATNPYSNESTMLTPTEHKLYIEIKQAEFDE |
| Ga0208814_10850414 | 3300025276 | Deep Ocean | MDTMIKATNPYSNQSTMLTPTEHKLYIEIKTAEFDEDYNT |
| Ga0208814_10994493 | 3300025276 | Deep Ocean | MDTMIKATNPYSNESTMLTPTEHKLYIEIKTAEFDE |
| Ga0208030_10337581 | 3300025282 | Deep Ocean | VTKQIKTTNEYSGESAMLTPEEYRLFIWIKEAELNEN |
| Ga0208030_11121513 | 3300025282 | Deep Ocean | MIERIKATNPYSGESEMLTPEEHKLYIEIKEAELNEDYK |
| Ga0207903_10926531 | 3300025287 | Deep Ocean | MTTLTQVTNPYSNQSTMLTDEEHKLYIEIKEAERDEEYNTMQKGL |
| Ga0208316_10579621 | 3300025296 | Deep Ocean | MELIKATNPYSGESEMLTPEEHKLYMEIKIAEINEDY |
| Ga0208148_11211061 | 3300025508 | Aqueous | MDKIKATNPYSGESAMLTPDEHKLYIEIKQAEWDEDYKTV |
| Ga0209504_10804171 | 3300025621 | Pelagic Marine | MDKIKATNPYSGESEMLTPEEHKLYIEIKEAEFNEDYKTV |
| Ga0209757_102570321 | 3300025873 | Marine | MTDKIKATNPYSGQSEMLTPEEHKLYIEIKDAEIAED |
| Ga0209384_11019471 | 3300027522 | Marine | MDTMIKATNPYSNESTMLTPTEHKLYIEIKQAEFDEDYNA |
| Ga0209384_11389711 | 3300027522 | Marine | MTQMIKATNPYSNQSTMLTPEEHKLYIEIKTAEFD |
| Ga0209482_10919091 | 3300027668 | Marine | MTQMIKATNPYSNQSTMLTPTEHKLYIEIKQAEFDED |
| Ga0209482_11376741 | 3300027668 | Marine | MDTMIKATNPYSNQSTMLTPTEHKLYIEIKTAEFDEDYNTMQKKLSK |
| Ga0209071_10635024 | 3300027686 | Marine | MTQMIKATNPYSNESTMLTPTEHKLYIEIKQAEFDEDYNAM |
| Ga0209071_11536933 | 3300027686 | Marine | MDTMIKATNPYSNQSTMLTPTEHKLYIEIKTAEFDEDYN |
| Ga0209816_11284341 | 3300027704 | Marine | MDLDRMIKATNPYSNQSTMLTPTEHKLYIEIKTAEFDEDYNTMQKKL |
| Ga0209816_11798211 | 3300027704 | Marine | MDTMIKATNPYSNQSAMLTPTEHKLYIEIKQAEFDEDYN |
| Ga0209815_11259793 | 3300027714 | Marine | MDTMIKATNPYSNESTMLTPTEHKLYIEIKQAEFDEDYNAMQKK |
| Ga0209279_101306303 | 3300027771 | Marine | MTTQTQVTNPYSGQSTMLTDEEHKLYIEIKEAERDEEYN |
| (restricted) Ga0233415_101859645 | 3300027861 | Seawater | MDTMIKTTNPYSNQSTMLTPEEHKLYIEIKTAEFDEDYST |
| Ga0256382_10271571 | 3300028022 | Seawater | MELIKATNPYSGESEMLTPEEHKLYIEIKEAELNEDY |
| Ga0257108_10712561 | 3300028190 | Marine | MTQQIKTTNPYSGESALLTQEEHKLYIEIKTAEIDEDYNTMQKKLSK |
| Ga0308023_10405461 | 3300031167 | Marine | MDTMIKATNPYSNESTMLTPTEHKLYIEIKQAEFDEDYNAM |
| Ga0308010_10363185 | 3300031510 | Marine | MTTKIKTTNPYSGQSAMLTEQEHKLYMDIKTAEVNE |
| Ga0308010_11199254 | 3300031510 | Marine | MTQMIKATNPYSNQSTMLTPEEHKLYIEIKTAEFDEDYNTMQKKLSK |
| Ga0307488_104222034 | 3300031519 | Sackhole Brine | MDTMIKATNPYSNESAMLTPEEHKLYIEIKTAEFD |
| Ga0307488_104373141 | 3300031519 | Sackhole Brine | MDTMIKATNPYSNQSTMLTPEEHKLYIEIKDHERD |
| Ga0307992_12224841 | 3300031601 | Marine | MDTMIKATNPYSNESTMLTPTEHKLYIEIKTAEFDEDYNT |
| Ga0302118_103840361 | 3300031627 | Marine | MNLDTMIKATNPYSNESAMLTPEEHKLYIEIKEHERDEE |
| Ga0307985_100234811 | 3300031629 | Marine | MDTMIKATNPYSNESTMLTPTEHKLYIEIKQAEFDEDYSAMQK |
| Ga0302125_101558201 | 3300031638 | Marine | MAQQIKTTNPYSGQSAMLTEQEHKLYIDIKTAEVAE |
| Ga0308018_100656851 | 3300031655 | Marine | MDTMIKATNPYSNQSTMLTPTEHKLYIEIKQAEFDE |
| Ga0310121_106979082 | 3300031801 | Marine | MKGRMTKQIKATNPYSGQSAMLTPEEHTLYIEIKEHER |
| Ga0316203_11515771 | 3300032274 | Microbial Mat | MDTMIKATNPYSNQSTMLTPEEHKLYIEIKTAEFDEDYNTMQKKLS |
| Ga0314858_028628_2_130 | 3300033742 | Sea-Ice Brine | MELNNCIKATNPYSKQSVMLTPEEHKLYIEIKEHERDEEYNLL |
| Ga0314858_149991_491_598 | 3300033742 | Sea-Ice Brine | MTTKIKTTNPYSGQSAMLTEDEHKLYIDIKTAEVND |
| Ga0348335_121787_649_771 | 3300034374 | Aqueous | MDKIKATNPYSGESAMLTPDEHKLYIEIKQAEWDEDYKTVQ |
| Ga0348335_131540_595_720 | 3300034374 | Aqueous | MDDTMIKATNPYSGESAMLTPDEHKLYIEIKQAEWDEDYKTV |
| Ga0348337_062619_2_118 | 3300034418 | Aqueous | MDDTMIKATNPYSGESAMLTPDEHKLYIEIKQAEWDEDY |
| Ga0326748_036513_542_682 | 3300034656 | Filtered Seawater | MTTLTQVTNPYSNQSTMLTDEEHKLYIEIKEAERDEEYNTMQKGLDK |
| ⦗Top⦘ |