


| Basic Information | |
|---|---|
| Family ID | F049930 |
| Family Type | Metagenome |
| Number of Sequences | 146 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MPIRKVKGGWTFGGAVYKTLEAAKRSYKAYLAKKHT |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 146 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 65.75 % |
| % of genes near scaffold ends (potentially truncated) | 24.66 % |
| % of genes from short scaffolds (< 2000 bps) | 62.33 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (60.274 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (45.890 % of family members) |
| Environment Ontology (ENVO) | Unclassified (88.356 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (80.822 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.00% β-sheet: 15.62% Coil/Unstructured: 59.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 146 Family Scaffolds |
|---|---|---|
| PF03237 | Terminase_6N | 13.01 |
| PF03592 | Terminase_2 | 4.11 |
| PF00166 | Cpn10 | 4.11 |
| PF11351 | GTA_holin_3TM | 2.74 |
| PF13392 | HNH_3 | 2.05 |
| PF13365 | Trypsin_2 | 2.05 |
| PF10124 | Mu-like_gpT | 2.05 |
| PF01476 | LysM | 1.37 |
| PF13884 | Peptidase_S74 | 0.68 |
| PF00271 | Helicase_C | 0.68 |
| PF00961 | LAGLIDADG_1 | 0.68 |
| PF12708 | Pectate_lyase_3 | 0.68 |
| PF00565 | SNase | 0.68 |
| PF13482 | RNase_H_2 | 0.68 |
| PF16778 | Phage_tail_APC | 0.68 |
| PF11753 | DUF3310 | 0.68 |
| PF01381 | HTH_3 | 0.68 |
| PF14216 | DUF4326 | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 146 Family Scaffolds |
|---|---|---|---|
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 4.11 |
| COG3728 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 4.11 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 60.27 % |
| All Organisms | root | All Organisms | 39.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001450|JGI24006J15134_10006172 | All Organisms → cellular organisms → Bacteria | 6177 | Open in IMG/M |
| 3300001533|MLSed_10103545 | Not Available | 1322 | Open in IMG/M |
| 3300001723|JGI24661J20069_1000981 | All Organisms → cellular organisms → Bacteria | 9734 | Open in IMG/M |
| 3300002231|KVRMV2_101191565 | All Organisms → cellular organisms → Bacteria | 4163 | Open in IMG/M |
| 3300002484|JGI25129J35166_1014485 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 1944 | Open in IMG/M |
| 3300002511|JGI25131J35506_1002323 | Not Available | 2768 | Open in IMG/M |
| 3300002511|JGI25131J35506_1006397 | Not Available | 1658 | Open in IMG/M |
| 3300002511|JGI25131J35506_1038251 | Not Available | 663 | Open in IMG/M |
| 3300002519|JGI25130J35507_1011808 | Not Available | 2169 | Open in IMG/M |
| 3300002519|JGI25130J35507_1095831 | Not Available | 541 | Open in IMG/M |
| 3300002760|JGI25136J39404_1001143 | All Organisms → Viruses → Predicted Viral | 4197 | Open in IMG/M |
| 3300002760|JGI25136J39404_1035026 | Not Available | 923 | Open in IMG/M |
| 3300002760|JGI25136J39404_1049840 | Not Available | 775 | Open in IMG/M |
| 3300002760|JGI25136J39404_1070137 | Not Available | 653 | Open in IMG/M |
| 3300002760|JGI25136J39404_1106124 | Not Available | 530 | Open in IMG/M |
| 3300002760|JGI25136J39404_1108920 | Not Available | 523 | Open in IMG/M |
| 3300003690|PicViral_1002933 | Not Available | 6680 | Open in IMG/M |
| 3300003690|PicViral_1003962 | Not Available | 5630 | Open in IMG/M |
| 3300005426|Ga0066847_10260852 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 524 | Open in IMG/M |
| 3300005514|Ga0066866_10193546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 715 | Open in IMG/M |
| 3300006165|Ga0075443_10248045 | Not Available | 646 | Open in IMG/M |
| 3300006736|Ga0098033_1200307 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300006738|Ga0098035_1193401 | Not Available | 680 | Open in IMG/M |
| 3300006751|Ga0098040_1150691 | Not Available | 688 | Open in IMG/M |
| 3300006752|Ga0098048_1067281 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 1107 | Open in IMG/M |
| 3300006753|Ga0098039_1005370 | All Organisms → cellular organisms → Bacteria | 4868 | Open in IMG/M |
| 3300006753|Ga0098039_1076088 | Not Available | 1163 | Open in IMG/M |
| 3300006753|Ga0098039_1086398 | All Organisms → Viruses → Predicted Viral | 1083 | Open in IMG/M |
| 3300006753|Ga0098039_1104038 | Not Available | 977 | Open in IMG/M |
| 3300006754|Ga0098044_1348802 | Not Available | 561 | Open in IMG/M |
| 3300006754|Ga0098044_1372262 | Not Available | 539 | Open in IMG/M |
| 3300006789|Ga0098054_1024654 | Not Available | 2380 | Open in IMG/M |
| 3300006789|Ga0098054_1286393 | Not Available | 591 | Open in IMG/M |
| 3300006923|Ga0098053_1089489 | Not Available | 622 | Open in IMG/M |
| 3300006926|Ga0098057_1006407 | All Organisms → cellular organisms → Eukaryota | 3126 | Open in IMG/M |
| 3300006926|Ga0098057_1122784 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 633 | Open in IMG/M |
| 3300006927|Ga0098034_1043875 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 1328 | Open in IMG/M |
| 3300006928|Ga0098041_1109129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 893 | Open in IMG/M |
| 3300007276|Ga0070747_1012060 | Not Available | 3663 | Open in IMG/M |
| 3300007514|Ga0105020_1013226 | Not Available | 8369 | Open in IMG/M |
| 3300007538|Ga0099851_1014400 | Not Available | 3226 | Open in IMG/M |
| 3300007541|Ga0099848_1271633 | Not Available | 588 | Open in IMG/M |
| 3300007542|Ga0099846_1007863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | 4265 | Open in IMG/M |
| 3300007963|Ga0110931_1005281 | All Organisms → cellular organisms → Bacteria | 4078 | Open in IMG/M |
| 3300008216|Ga0114898_1001148 | Not Available | 16583 | Open in IMG/M |
| 3300008216|Ga0114898_1025370 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 2023 | Open in IMG/M |
| 3300008216|Ga0114898_1048872 | All Organisms → Viruses → Predicted Viral | 1354 | Open in IMG/M |
| 3300008216|Ga0114898_1154631 | Not Available | 659 | Open in IMG/M |
| 3300008217|Ga0114899_1003499 | Not Available | 7860 | Open in IMG/M |
| 3300008217|Ga0114899_1025426 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 2249 | Open in IMG/M |
| 3300008217|Ga0114899_1218768 | Not Available | 597 | Open in IMG/M |
| 3300008218|Ga0114904_1000825 | All Organisms → cellular organisms → Bacteria | 16184 | Open in IMG/M |
| 3300008219|Ga0114905_1010707 | All Organisms → cellular organisms → Bacteria | 3855 | Open in IMG/M |
| 3300008629|Ga0115658_1066507 | Not Available | 2146 | Open in IMG/M |
| 3300009173|Ga0114996_10234078 | Not Available | 1464 | Open in IMG/M |
| 3300009173|Ga0114996_10266986 | Not Available | 1351 | Open in IMG/M |
| 3300009412|Ga0114903_1001168 | All Organisms → cellular organisms → Bacteria | 11529 | Open in IMG/M |
| 3300009413|Ga0114902_1009427 | All Organisms → Viruses → Predicted Viral | 3417 | Open in IMG/M |
| 3300009413|Ga0114902_1153132 | Not Available | 583 | Open in IMG/M |
| 3300009413|Ga0114902_1181713 | Not Available | 518 | Open in IMG/M |
| 3300009509|Ga0123573_10120817 | All Organisms → Viruses → Predicted Viral | 2654 | Open in IMG/M |
| 3300009602|Ga0114900_1045417 | All Organisms → Viruses → Predicted Viral | 1375 | Open in IMG/M |
| 3300009602|Ga0114900_1115135 | Not Available | 723 | Open in IMG/M |
| 3300009605|Ga0114906_1101107 | Not Available | 1035 | Open in IMG/M |
| 3300009706|Ga0115002_10063275 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 3150 | Open in IMG/M |
| 3300009706|Ga0115002_10178925 | Not Available | 1663 | Open in IMG/M |
| 3300009706|Ga0115002_10675741 | Not Available | 731 | Open in IMG/M |
| 3300010150|Ga0098056_1187021 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 694 | Open in IMG/M |
| 3300010151|Ga0098061_1148908 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 849 | Open in IMG/M |
| 3300010153|Ga0098059_1395770 | Not Available | 522 | Open in IMG/M |
| 3300010155|Ga0098047_10000845 | Not Available | 12373 | Open in IMG/M |
| 3300010883|Ga0133547_10017339 | Not Available | 18789 | Open in IMG/M |
| 3300011013|Ga0114934_10007606 | Not Available | 6411 | Open in IMG/M |
| 3300012675|Ga0137337_1000080 | Not Available | 5598 | Open in IMG/M |
| 3300014205|Ga0172380_10635843 | Not Available | 777 | Open in IMG/M |
| 3300014271|Ga0075326_1126474 | Not Available | 735 | Open in IMG/M |
| 3300014656|Ga0180007_10047168 | All Organisms → Viruses → Predicted Viral | 3118 | Open in IMG/M |
| 3300017775|Ga0181432_1297413 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300017991|Ga0180434_10423040 | Not Available | 1030 | Open in IMG/M |
| 3300021791|Ga0226832_10260730 | Not Available | 696 | Open in IMG/M |
| 3300022198|Ga0196905_1055554 | All Organisms → Viruses → Predicted Viral | 1116 | Open in IMG/M |
| 3300022200|Ga0196901_1009831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | 4081 | Open in IMG/M |
| 3300022200|Ga0196901_1018246 | Not Available | 2858 | Open in IMG/M |
| 3300022227|Ga0187827_10039285 | Not Available | 3958 | Open in IMG/M |
| 3300024344|Ga0209992_10045054 | All Organisms → Viruses → Predicted Viral | 2142 | Open in IMG/M |
| (restricted) 3300024517|Ga0255049_10367444 | Not Available | 663 | Open in IMG/M |
| 3300025045|Ga0207901_1039337 | Not Available | 635 | Open in IMG/M |
| 3300025050|Ga0207892_1037755 | Not Available | 561 | Open in IMG/M |
| 3300025052|Ga0207906_1048061 | Not Available | 573 | Open in IMG/M |
| 3300025069|Ga0207887_1008093 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 1613 | Open in IMG/M |
| 3300025069|Ga0207887_1025918 | Not Available | 935 | Open in IMG/M |
| 3300025069|Ga0207887_1051504 | Not Available | 671 | Open in IMG/M |
| 3300025072|Ga0208920_1052645 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 809 | Open in IMG/M |
| 3300025103|Ga0208013_1068789 | Not Available | 930 | Open in IMG/M |
| 3300025109|Ga0208553_1003621 | All Organisms → cellular organisms → Bacteria | 4844 | Open in IMG/M |
| 3300025112|Ga0209349_1001489 | Not Available | 11546 | Open in IMG/M |
| 3300025118|Ga0208790_1017228 | All Organisms → Viruses → Predicted Viral | 2509 | Open in IMG/M |
| 3300025122|Ga0209434_1000499 | Not Available | 18934 | Open in IMG/M |
| 3300025125|Ga0209644_1000633 | Not Available | 6491 | Open in IMG/M |
| 3300025125|Ga0209644_1008534 | Not Available | 2105 | Open in IMG/M |
| 3300025125|Ga0209644_1130294 | Not Available | 599 | Open in IMG/M |
| 3300025128|Ga0208919_1000192 | All Organisms → cellular organisms → Bacteria | 45344 | Open in IMG/M |
| 3300025133|Ga0208299_1041220 | All Organisms → Viruses → Predicted Viral | 1830 | Open in IMG/M |
| 3300025168|Ga0209337_1012327 | All Organisms → cellular organisms → Bacteria | 5306 | Open in IMG/M |
| 3300025218|Ga0207882_1038924 | Not Available | 672 | Open in IMG/M |
| 3300025236|Ga0207884_1009958 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 1880 | Open in IMG/M |
| 3300025236|Ga0207884_1042176 | Not Available | 760 | Open in IMG/M |
| 3300025236|Ga0207884_1052232 | Not Available | 659 | Open in IMG/M |
| 3300025236|Ga0207884_1052763 | Not Available | 654 | Open in IMG/M |
| 3300025244|Ga0207908_1011287 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 1265 | Open in IMG/M |
| 3300025251|Ga0208182_1000303 | All Organisms → cellular organisms → Bacteria | 38464 | Open in IMG/M |
| 3300025251|Ga0208182_1023544 | All Organisms → cellular organisms → Bacteria | 1490 | Open in IMG/M |
| 3300025251|Ga0208182_1030418 | Not Available | 1238 | Open in IMG/M |
| 3300025257|Ga0207899_1045960 | Not Available | 704 | Open in IMG/M |
| 3300025277|Ga0208180_1046523 | All Organisms → Viruses → Predicted Viral | 1134 | Open in IMG/M |
| 3300025280|Ga0208449_1088888 | Not Available | 747 | Open in IMG/M |
| 3300025286|Ga0208315_1003670 | All Organisms → Viruses | 6438 | Open in IMG/M |
| 3300025286|Ga0208315_1070108 | Not Available | 882 | Open in IMG/M |
| 3300025293|Ga0208934_1081110 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300025655|Ga0208795_1003725 | All Organisms → cellular organisms → Bacteria | 6158 | Open in IMG/M |
| 3300025655|Ga0208795_1011695 | Not Available | 3087 | Open in IMG/M |
| 3300025873|Ga0209757_10036949 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 1408 | Open in IMG/M |
| 3300025873|Ga0209757_10042239 | Not Available | 1325 | Open in IMG/M |
| 3300027838|Ga0209089_10630894 | Not Available | 559 | Open in IMG/M |
| 3300027839|Ga0209403_10020130 | Not Available | 5682 | Open in IMG/M |
| 3300027839|Ga0209403_10029189 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 4448 | Open in IMG/M |
| 3300027844|Ga0209501_10199910 | Not Available | 1288 | Open in IMG/M |
| (restricted) 3300027868|Ga0255053_10637313 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 515 | Open in IMG/M |
| 3300027917|Ga0209536_100038344 | Not Available | 6414 | Open in IMG/M |
| 3300028018|Ga0256381_1002988 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium | 2462 | Open in IMG/M |
| 3300028018|Ga0256381_1019333 | Not Available | 1116 | Open in IMG/M |
| 3300028022|Ga0256382_1083100 | Not Available | 764 | Open in IMG/M |
| 3300028039|Ga0256380_1033752 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 813 | Open in IMG/M |
| 3300031371|Ga0307423_1091951 | Not Available | 923 | Open in IMG/M |
| 3300031371|Ga0307423_1107039 | Not Available | 836 | Open in IMG/M |
| 3300031811|Ga0310125_10400783 | Not Available | 666 | Open in IMG/M |
| 3300031886|Ga0315318_10014192 | Not Available | 3910 | Open in IMG/M |
| 3300032006|Ga0310344_11146017 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 647 | Open in IMG/M |
| 3300032138|Ga0315338_1061533 | All Organisms → cellular organisms → Bacteria | 1396 | Open in IMG/M |
| 3300032278|Ga0310345_10088273 | Not Available | 2694 | Open in IMG/M |
| 3300032278|Ga0310345_12001516 | Not Available | 563 | Open in IMG/M |
| 3300034629|Ga0326756_016427 | Not Available | 856 | Open in IMG/M |
| 3300034629|Ga0326756_050386 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 518 | Open in IMG/M |
| 3300034654|Ga0326741_002876 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 3681 | Open in IMG/M |
| 3300034655|Ga0326746_010823 | Not Available | 853 | Open in IMG/M |
| 3300034656|Ga0326748_064803 | Not Available | 520 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 45.89% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 21.92% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 6.16% |
| Filtered Seawater | Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater | 3.42% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 2.74% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 2.74% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.37% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.37% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.37% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.37% |
| Marine, Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Marine, Hydrothermal Vent Plume | 1.37% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.37% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.68% |
| Benthic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Benthic | 0.68% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.68% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.68% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.68% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 0.68% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.68% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.68% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.68% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.68% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.68% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.68% |
| Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001533 | Benthic freshwater microbial communities from British Columbia, Canada | Environmental | Open in IMG/M |
| 3300001723 | Marine viral communities from the Deep Pacific Ocean - MSP-144 | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002484 | Marine viral communities from the Pacific Ocean - ETNP_2_130 | Environmental | Open in IMG/M |
| 3300002511 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 | Environmental | Open in IMG/M |
| 3300002519 | Marine viral communities from the Pacific Ocean - ETNP_2_300 | Environmental | Open in IMG/M |
| 3300002760 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 | Environmental | Open in IMG/M |
| 3300003690 | Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Piccard2013-Plume - Viral/microbial metagenome assembly | Environmental | Open in IMG/M |
| 3300005426 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV74 | Environmental | Open in IMG/M |
| 3300005514 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV263 | Environmental | Open in IMG/M |
| 3300006165 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA | Environmental | Open in IMG/M |
| 3300006736 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006923 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG | Environmental | Open in IMG/M |
| 3300006926 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG | Environmental | Open in IMG/M |
| 3300006927 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007514 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008216 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar | Environmental | Open in IMG/M |
| 3300008217 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 | Environmental | Open in IMG/M |
| 3300008218 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 | Environmental | Open in IMG/M |
| 3300008219 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 | Environmental | Open in IMG/M |
| 3300008629 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 200m, 2.7-0.2um | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009412 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2 | Environmental | Open in IMG/M |
| 3300009413 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 | Environmental | Open in IMG/M |
| 3300009509 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11 | Environmental | Open in IMG/M |
| 3300009602 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 | Environmental | Open in IMG/M |
| 3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
| 3300009706 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300012675 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT333_2 | Environmental | Open in IMG/M |
| 3300014205 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 162 metaG | Engineered | Open in IMG/M |
| 3300014271 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2 | Environmental | Open in IMG/M |
| 3300014656 | Groundwater microbial communities from the Aspo Hard Rock Laboratory (HRL) deep subsurface site, Sweden - MM_PC_MetaG | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300017991 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_2 metaG | Environmental | Open in IMG/M |
| 3300021791 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmer | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022227 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_150_PacBio MetaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024517 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3 | Environmental | Open in IMG/M |
| 3300025045 | Marine viral communities from the Pacific Ocean - LP-46 (SPAdes) | Environmental | Open in IMG/M |
| 3300025050 | Marine viral communities from the Pacific Ocean - LP-54 (SPAdes) | Environmental | Open in IMG/M |
| 3300025052 | Marine viral communities from the Pacific Ocean - LP-37 (SPAdes) | Environmental | Open in IMG/M |
| 3300025069 | Marine viral communities from the Pacific Ocean - LP-38 (SPAdes) | Environmental | Open in IMG/M |
| 3300025072 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025109 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025112 | Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300025118 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025122 | Marine viral communities from the Pacific Ocean - ETNP_2_300 (SPAdes) | Environmental | Open in IMG/M |
| 3300025125 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025218 | Marine viral communities from the Deep Pacific Ocean - MSP-103 (SPAdes) | Environmental | Open in IMG/M |
| 3300025236 | Marine viral communities from the Deep Pacific Ocean - MSP-144 (SPAdes) | Environmental | Open in IMG/M |
| 3300025244 | Marine viral communities from the Deep Pacific Ocean - MSP-81 (SPAdes) | Environmental | Open in IMG/M |
| 3300025251 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 (SPAdes) | Environmental | Open in IMG/M |
| 3300025257 | Marine viral communities from the Deep Pacific Ocean - MSP-134 (SPAdes) | Environmental | Open in IMG/M |
| 3300025277 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 (SPAdes) | Environmental | Open in IMG/M |
| 3300025280 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 (SPAdes) | Environmental | Open in IMG/M |
| 3300025286 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 (SPAdes) | Environmental | Open in IMG/M |
| 3300025293 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025873 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300027838 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300027839 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 (SPAdes) | Environmental | Open in IMG/M |
| 3300027844 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027868 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_22 | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028018 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 1600m | Environmental | Open in IMG/M |
| 3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
| 3300028039 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 2300m | Environmental | Open in IMG/M |
| 3300031371 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-10 | Environmental | Open in IMG/M |
| 3300031811 | Marine microbial communities from Western Arctic Ocean, Canada - CB11b_Tmax_Bot8 | Environmental | Open in IMG/M |
| 3300031886 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 3416 | Environmental | Open in IMG/M |
| 3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
| 3300032138 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - ASW #8 | Environmental | Open in IMG/M |
| 3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300034629 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 543_2600 | Environmental | Open in IMG/M |
| 3300034654 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 487_2244 | Environmental | Open in IMG/M |
| 3300034655 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 494_2800 | Environmental | Open in IMG/M |
| 3300034656 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 502_2477 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24006J15134_100061724 | 3300001450 | Marine | MPIRKVKGGWTFGGAVYKTLAAAKRSYKAYLAKSKSAGKR* |
| MLSed_101035452 | 3300001533 | Benthic | MPVRKVKGGWTFGGAVYDSRDKAERAYRAYLAKKHSGKGKKK* |
| JGI24661J20069_10009813 | 3300001723 | Deep Ocean | MPIRKIKGGWTFGGHVYKSLEKAQKSYKAYLAKKHSTRKRA* |
| KVRMV2_1011915656 | 3300002231 | Marine Sediment | MPVRKVKRGWTFGGAVYSSKAKADRAYRAYLAKKHGKGKGGGS* |
| JGI25129J35166_10144854 | 3300002484 | Marine | MPIRKVKGGWTFGGAVYKTLKAAKRSYKAYLAKKHTRGGK* |
| JGI25131J35506_10023235 | 3300002511 | Marine | MPIRKVKGGYSFGGGVYGTLKKAKASYTAYLARKHSKSKSKTRRA* |
| JGI25131J35506_10063972 | 3300002511 | Marine | IRKVKGGWSFGGGVHKTLESCKRAYRAYLAKKNSKTKRG* |
| JGI25131J35506_10382512 | 3300002511 | Marine | MPLRKVKGGWSFGGHVYKTWEAAKRAYKAYLAKKRAKSRKKK* |
| JGI25130J35507_10118082 | 3300002519 | Marine | MPIRKVKGGWTFGGAVYKTLKAAKRAYKAYLAKKHSKKRK* |
| JGI25130J35507_10958312 | 3300002519 | Marine | KGLRMPIRKVKGGWTFGGAVYKTLKAAKRAYKAYLAKKHSAK* |
| JGI25136J39404_10011433 | 3300002760 | Marine | MPIRKVKGGWSFGGGVHKTLESCKKSYKAYLAKKNSKRG* |
| JGI25136J39404_10350263 | 3300002760 | Marine | MPIRKVKGGWTFGGHVXKSLDKAKKSYKAYLAKKHSTRKRA* |
| JGI25136J39404_10498402 | 3300002760 | Marine | MPIRKVKGGWTFGGHVYKSLEKAQKSYKAYLAKKHSTRKRA* |
| JGI25136J39404_10701371 | 3300002760 | Marine | YGEGQIDMPIKKVKGGWSFGGGVHKTLASAKRSYKAYLAKKNSKRG* |
| JGI25136J39404_11061241 | 3300002760 | Marine | MPIKKVKGGWSFGGGVHKTLASCKRAYRAYLAKKNSKRG* |
| JGI25136J39404_11089201 | 3300002760 | Marine | MPIRKVKGGWTFGGAVYKTLKAAKRSYKAYLAKKHTRGGKKYA* |
| PicViral_10029333 | 3300003690 | Marine, Hydrothermal Vent Plume | MPIKKVKGGWSFGGGVHKTLASAKRSYRAYLAKKNSKTKRG* |
| PicViral_10039627 | 3300003690 | Marine, Hydrothermal Vent Plume | MPIRKVKGGWTFGGAVYKTLEVAKKAYKAYLAKKHERGA* |
| Ga0066847_102608522 | 3300005426 | Marine | MPIRKVKGGWTFSSSGRPLYKTLAAAKRAYKAYLAKKNA* |
| Ga0066866_101935462 | 3300005514 | Marine | MPIRKVKSGWTFGGGVYKTLEEAKRAYQAYLASKK* |
| Ga0075443_102480451 | 3300006165 | Marine | LMPCKKVKGGWSFGGGVHKTLASCKRSYKAYLAKKNSKRG* |
| Ga0098033_12003072 | 3300006736 | Marine | MPIRKVKGGWSFGGGVHKTLASCKRAYKAYLAKKNSKRG* |
| Ga0098035_11934011 | 3300006738 | Marine | RIGELMPIRKVKGGWSFGGGVHKTLASCKRAYKAYLAKKNSKRG* |
| Ga0098040_11506912 | 3300006751 | Marine | MPIKKVKGGWSFGGGVHKTLASCKRAYKAYLAKKNSKRG* |
| Ga0098048_10672812 | 3300006752 | Marine | MPIRKVKGGWTFSSSGKPVYETLAAAKRSYKAYLARKASKTRKA* |
| Ga0098039_10053701 | 3300006753 | Marine | KVKGGWTFSSSGRPLYKTLAAAKRAYKAYLAKKNA* |
| Ga0098039_10760881 | 3300006753 | Marine | SKDLRMPIRKVKGGWTFGGAVYKTLAAAKRAYKAYLAKKHSAKRK* |
| Ga0098039_10863982 | 3300006753 | Marine | MPLRKVKGGWTFGGHVYKKLVNAKKSYKAYLARTRKGKK* |
| Ga0098039_11040383 | 3300006753 | Marine | MPIKKVKGGWSFGGGVHKTLASAKRSYRAYLAKKNSKSKKG* |
| Ga0098044_13488022 | 3300006754 | Marine | MPIRKVKGGWTFGGGVYKTIEQVQRAYQAYLASKK* |
| Ga0098044_13722623 | 3300006754 | Marine | MPIRKVKGGYTFGGGKHKTKASANRSYRAYLAKKNTKKK |
| Ga0098054_10246543 | 3300006789 | Marine | MPIRKVKGGYTFGGGKHKTKASANRSYRAYLAKKNTKKKANT* |
| Ga0098054_12863931 | 3300006789 | Marine | HGELMPVKKVKGGWSFGGGVHKTKASVDRSYRAYLAKKNSKKKRG* |
| Ga0098053_10894892 | 3300006923 | Marine | MPIRKVKGGWTFGGAVYDTLEKAKKSYRAYLARNYRKKKKRTA* |
| Ga0098057_10064072 | 3300006926 | Marine | MPIRKVKGGWTFGGAVYKTLAAAKRAYKAYLAKKHSKKRK* |
| Ga0098057_11227842 | 3300006926 | Marine | MPIRKVKGGWTFGGAVYKTLKAAKRAYKAYLAKKHGAKRKRKA* |
| Ga0098034_10438751 | 3300006927 | Marine | RKVKGGWTFSSSGRPLYKTLAAAKRAYKAYLAKKNA* |
| Ga0098041_11091292 | 3300006928 | Marine | MPIRKVKSGWTFNGGVYKTLEQAKRAYQAYLASKK* |
| Ga0070747_10120606 | 3300007276 | Aqueous | MPIRKVKGGYTFGGGTHKTEASAKRSYKAYLAKKHTKNKKVEK* |
| Ga0105020_101322610 | 3300007514 | Marine | MPIRKVKGGWSFGGGVHKTLASAERSYAAYLAKKNSKKKRG* |
| Ga0099851_10144003 | 3300007538 | Aqueous | MPLRKVKNGYTFGGAVYKDKDKAVRAYKAYLAKKQSKAPKR* |
| Ga0099848_12716333 | 3300007541 | Aqueous | MPLRKVKNGYTFGGAVYKDKDKAIRAYKAYLAKKQSKSPK |
| Ga0099846_10078633 | 3300007542 | Aqueous | MPLRKVKNGYTFGGAVYKDKDKAIRAYKAYLAKKQSKSPKR* |
| Ga0110931_10052816 | 3300007963 | Marine | MPIRKVKGGWTFSSSGKPVYDTLAAAKRSYKAYLARRASKTRKA* |
| Ga0114898_100114822 | 3300008216 | Deep Ocean | MPIRKVKGGWTFGGHVYKSLEKAQKSYKAYLAKKHSTRRA* |
| Ga0114898_10253704 | 3300008216 | Deep Ocean | MPIRKVKGGWTFGGHVFKSLDKAKKSYKAYLAKKHSTRKRA* |
| Ga0114898_10488722 | 3300008216 | Deep Ocean | MEGILMPIRKVKGGWSFGGGVHKTLASAERSYAAYLAKKNSKKKRG* |
| Ga0114898_11546312 | 3300008216 | Deep Ocean | MPVKKVKGGWSFGGGVHKTLASAKRSYRAYLAKKNSKSKKG* |
| Ga0114899_10034993 | 3300008217 | Deep Ocean | MPIRKTKGGWTFGGAVYKTLKAAKKAYRAYLAKKHGDKPKRKT* |
| Ga0114899_10254268 | 3300008217 | Deep Ocean | MPIRKVKGGWTFGGAVYKTLKAAKRAYKAYLAKRKRKA* |
| Ga0114899_12187683 | 3300008217 | Deep Ocean | MPIRKVKGGWTFGGHVYKSLDKAKKSYKAYLAKKHSTRKRA* |
| Ga0114904_100082525 | 3300008218 | Deep Ocean | MPIRKVKGGWTFGGVVYKTLKAAKRAYRAYLAKKHGAKPKSRRA* |
| Ga0114905_10107074 | 3300008219 | Deep Ocean | MPVRKVKGGWTFGGAVYKTLKSATKAYQAYLAKKHKRRA* |
| Ga0115658_10665071 | 3300008629 | Marine | RKVKGGWSFGGGVHKTLASAERSYAAYLAKKNSKKKRG* |
| Ga0114996_102340783 | 3300009173 | Marine | MPIRKVKGGWTFGGAVYKTLAAAKKSYKAYLAKSKSRKA* |
| Ga0114996_102669862 | 3300009173 | Marine | MPIRKVKGGWTFGGAVYKTLAAAKKSYKAYLAKSKSRKT* |
| Ga0114903_100116816 | 3300009412 | Deep Ocean | MPIRKVKGGYTFGGGVHKTLESAKKSYKAYLAKKNSKTKRG* |
| Ga0114902_10094272 | 3300009413 | Deep Ocean | MPCKKVKGGWSFGGGVHKTLASCKRSYKAYLAKKNSKRG* |
| Ga0114902_11531321 | 3300009413 | Deep Ocean | KVKGGWTFGGHVFKSLDKAKKSYKAYLAKKHSTRRA* |
| Ga0114902_11817132 | 3300009413 | Deep Ocean | MPVKKVKGGWSFGGGVHKTLASAERSYAAYLAKKNSKKKRG* |
| Ga0123573_101208175 | 3300009509 | Mangrove Sediment | MPIRKVKGGWTFGGAVYDTKAKAERAYKAYLAKKHSKKGGR* |
| Ga0114900_10454172 | 3300009602 | Deep Ocean | MPIKKVKGGWSFGGGVHKTLASCKRAYKAYLAKKNSERG* |
| Ga0114900_11151353 | 3300009602 | Deep Ocean | MPIRKTKGGWTFGGAGYKTLKAAKKAYRAYLAKKHG |
| Ga0114906_11011072 | 3300009605 | Deep Ocean | MEGILMPIRKVKGGWSFGGGVHKTLASAERSYAAYLAQKNSKKKRG* |
| Ga0115002_100632757 | 3300009706 | Marine | MPIRKVKGGWSFASSGKPVYKTLAAAKRSYKAYLARRARV* |
| Ga0115002_101789255 | 3300009706 | Marine | MPIRKVKGGWTFGGAVYKTLAAAKKSYKAYLDKSKSRKT* |
| Ga0115002_106757413 | 3300009706 | Marine | LMPIRKVKGGWTFGGAVYKTLAAAKKSYKAYLAKSKSRKA* |
| Ga0098056_11870212 | 3300010150 | Marine | MPIRKVKGGWTFSSSGKPVYDTLAAAKRSYKAYLA |
| Ga0098061_11489082 | 3300010151 | Marine | MPIRKVKGGWTFGGAVYKTLKAAKRAYKAYLAKKHGAK* |
| Ga0098059_13957702 | 3300010153 | Marine | MPCKKVKGGWGFGGGVHKTLASCKRSYAAYLAKKNSKKKRG* |
| Ga0098047_1000084510 | 3300010155 | Marine | MPVRKVKGGWTFSSSGRPLYKTLAAAKRAYKAYLAKKNA* |
| Ga0133547_1001733922 | 3300010883 | Marine | MPIRKVKDGWTFGGHVFKSLDKAKKSYKAYLAKKHSMKKRA* |
| Ga0114934_100076065 | 3300011013 | Deep Subsurface | MPCKKVKGGWSFGGGVHKTLASCKRSYKAYLAKKHSKSKKG* |
| Ga0137337_10000802 | 3300012675 | Soil | MPVRKVEGGKGWTFGGSIYKTKATAERAYRAYLAKKHGSQK* |
| Ga0172380_106358433 | 3300014205 | Landfill Leachate | MPIRKRGKKWTFGGKADYDTKEEAERSYQAYLAKKHSKKGKK* |
| Ga0075326_11264743 | 3300014271 | Natural And Restored Wetlands | MPLRRVDGGWTFGGSVYRTKAVAMRAYRAYLARKHSRRS* |
| Ga0180007_100471687 | 3300014656 | Groundwater | MPIRKVANGWTFGGGVFKSLAAAKRAYQAYLAKKHSKGKHGKRG* |
| Ga0181432_12974131 | 3300017775 | Seawater | MPCKKVKGGWSFGGGVHKTLESCKKSYKAYLAKKT |
| Ga0180434_104230402 | 3300017991 | Hypersaline Lake Sediment | MPVRKVQGGWTFGGAVYKTKEAALRAYMAYLAKKHGGK |
| Ga0226832_102607302 | 3300021791 | Hydrothermal Vent Fluids | MPIRKVKGGFSFGGGTHKTEASAKRSYKAYLAKKHTKDKKVEK |
| Ga0196905_10555542 | 3300022198 | Aqueous | MPLRKVKNGYTFGGAVYKDKDKAIRAYKAYLAKKQSKAPKR |
| Ga0196901_10098312 | 3300022200 | Aqueous | MPLRKVKNGYTFGGAVYKDKDKAIRAYKAYLAKKQSKSPKR |
| Ga0196901_10182463 | 3300022200 | Aqueous | IMPLRKVKNGYTFGGAVYKDKDKAVRAYKAYLAKKQSKAPKR |
| Ga0187827_100392854 | 3300022227 | Seawater | MPIRKVKGGWTFSSSGRPLYKTLAAAKRAYKAYLAKKNA |
| Ga0209992_100450547 | 3300024344 | Deep Subsurface | MPIRKVKGGWTFSSSGKPVYDTLAAAKRSYKAYLARRASKTRKA |
| (restricted) Ga0255049_103674441 | 3300024517 | Seawater | NIMPIRKVKGGWSFGGGVHKTLPSAKRSYAAYLAKKNSKKKRG |
| Ga0207901_10393373 | 3300025045 | Marine | MPIRKVKGGWTFGGAVYKTLKAAKRAYKAYLAKKHGAKRKRKA |
| Ga0207892_10377553 | 3300025050 | Marine | QAVLMPIRKVKGGWTFGGHVFKSLDKAKKSYKAYLAKKHSTRKRA |
| Ga0207906_10480612 | 3300025052 | Marine | MPIKKVKGGWSFGGGVHKTLASCKRSYKAYLAKKNSKRG |
| Ga0207887_10080933 | 3300025069 | Marine | MPIRKVKGGWTFGGHVFKSLDKAKKSYKAYLAKKHSTRKRA |
| Ga0207887_10259182 | 3300025069 | Marine | MPIKKVKGGWSFGGGVHKTLASCKRAYKAYLAKKNSKRG |
| Ga0207887_10515042 | 3300025069 | Marine | LMPIKKVKGGWSFGGGVHKTLASCKRAYKAYLAKKNSKRG |
| Ga0208920_10526452 | 3300025072 | Marine | MPIRKVKGGWTFGGAVYKTLKAAKRAYKAYLAKKHSAK |
| Ga0208013_10687892 | 3300025103 | Marine | MPIRKVKSGWTFGGGVYKTLEEAKRAYQAYLASKK |
| Ga0208553_10036211 | 3300025109 | Marine | KVKGGWTFSSSGRPLYKTLAAAKRAYKAYLAKKNA |
| Ga0209349_10014899 | 3300025112 | Marine | MPIRKVKGGWTFGGAVYKTLKAAKRSYKAYLAKKHTRGGK |
| Ga0208790_10172282 | 3300025118 | Marine | MPIRKVKSGWTFGGGVYKTLEQAKRAYQAYLASKK |
| Ga0209434_10004993 | 3300025122 | Marine | MPIRKVKGGWTFGGAVYKTLKAAKRAYKAYLAKKHSKKRK |
| Ga0209644_10006335 | 3300025125 | Marine | MPIRKVKGGYSFGGGVYGTLKKAKASYTAYLARKHSKSKSKTRRA |
| Ga0209644_10085341 | 3300025125 | Marine | MPIRKVKGGWTFGGAVYKTLEAAKRSYKAYLAKKHT |
| Ga0209644_11302942 | 3300025125 | Marine | MPLRKVKGGWSFGGHVYKTWEAAKRAYKAYLAKKRAKSRKKK |
| Ga0208919_100019254 | 3300025128 | Marine | MPIRKVKGGWTFSSSGKPVYETLAAAKRSYKAYLARKASKTRKA |
| Ga0208299_10412203 | 3300025133 | Marine | MPIRKVKGGYTFGGGKHKTKASANRSYRAYLAKKNTKKKANT |
| Ga0209337_101232710 | 3300025168 | Marine | MPIRKVKGGWTFGGAVYKTLAAAKRSYKAYLAKSKSAGKR |
| Ga0207882_10389241 | 3300025218 | Deep Ocean | IRKIKGGWTFGGHVYKSLEKAQKSYKAYLAKKHSTRKRA |
| Ga0207884_10099581 | 3300025236 | Deep Ocean | MPIRKIKGGWTFGGHVYKSLEKAQKSYKAYLAKKHSTRKR |
| Ga0207884_10421761 | 3300025236 | Deep Ocean | GARQLMPIRKVKGGWTFGGAVYKTLKAAKRAYKAYLAKRKRKA |
| Ga0207884_10522323 | 3300025236 | Deep Ocean | MPIRKVKGGWTFGGAVYKTLKAAKRAYKAYLAKRHWQKHGAKPKGRKA |
| Ga0207884_10527631 | 3300025236 | Deep Ocean | MPIRKVKGGWTFGGAVYKTLEVAKKAYKAYLAKKHERGA |
| Ga0207908_10112872 | 3300025244 | Deep Ocean | MPIRKVKGGWTFGGAVYKTLKAAKRAYGAYLAKRKR |
| Ga0208182_100030313 | 3300025251 | Deep Ocean | MPIRKVKGGWTFGGVVYKTLKAAKRAYRAYLAKKHGAKPKSRRA |
| Ga0208182_10235442 | 3300025251 | Deep Ocean | MPIRKVKGGYTFGGGVHKTLESAKKSYKAYLAKKNSKTKRG |
| Ga0208182_10304185 | 3300025251 | Deep Ocean | MPIRKVKGGWTFGGHVYKSLEKAQKSYKAYLAKKHSTRRA |
| Ga0207899_10459602 | 3300025257 | Deep Ocean | MPIRKVKGGWTFGGHVYKSLEKAQKSYKAYLAKKHSTRKRA |
| Ga0208180_10465234 | 3300025277 | Deep Ocean | MPVRKVKGGWTFGGAVYKTLKSATKAYQAYLAKKHKRRA |
| Ga0208449_10888882 | 3300025280 | Deep Ocean | MEGILMPIRKVKGGWSFGGGVHKTLASAERSYAAYLAKKNSKKKRG |
| Ga0208315_10036702 | 3300025286 | Deep Ocean | MPIRKTKGGWTFGGAVYKTLKAAKKAYRAYLAKKHGDKPKRKT |
| Ga0208315_10701082 | 3300025286 | Deep Ocean | MDATQNMEGILMPIRKVKGGWSFGGGVHKTLASAERSYAAYLAKKNSKKKRG |
| Ga0208934_10811103 | 3300025293 | Deep Ocean | LPIRKVKGGYSFGGGVHKTLASAKRSYRAYLAKKN |
| Ga0208795_10037253 | 3300025655 | Aqueous | MPLRKVKNGYTFGGAVYKDKDKAIRAYKAYLAKKQSKSPKRK |
| Ga0208795_10116953 | 3300025655 | Aqueous | MPLRKVKNGYTFGGAVYKDKDKAVRAYKAYLAKKQSKAPKR |
| Ga0209757_100369492 | 3300025873 | Marine | MPIRKVKGGWTFGGAVYKTLKEAKGAYKAYLAKKHGAKRK |
| Ga0209757_100422393 | 3300025873 | Marine | MPIRKVKGGWTFGGAVYKTLKAAKRSYKAYLAKKHTRGGKKYA |
| Ga0209089_106308942 | 3300027838 | Marine | MPIRKVKDGWTFGGHVFKSLDKAKKSYKAYLAKKHSMKKRA |
| Ga0209403_100201301 | 3300027839 | Marine | QGSFLMPIRKVKGGWTFGGAVYKTLAAAKKSYKAYLDKSKSRKT |
| Ga0209403_100291896 | 3300027839 | Marine | MPIRKVKGGWTFGGAVYKTLAAAKKSYKAYLAKSKSRKA |
| Ga0209501_101999104 | 3300027844 | Marine | MPIRKVKGGWTFGGAVYKTLAAAKKSYKAYLAKSKSRKT |
| (restricted) Ga0255053_106373131 | 3300027868 | Seawater | MPIRKVKGGWSFGGGVHKTLASCKRAYKAYLAKKNSKR |
| Ga0209536_10003834411 | 3300027917 | Marine Sediment | MPIRKVKGGYTFGGGNVYKTKAAAERSYRAYLAKKHSK |
| Ga0256381_10029883 | 3300028018 | Seawater | MPLRKVKGGWTFGGAVFKSKAKAERAYAAYLAKKHSK |
| Ga0256381_10193333 | 3300028018 | Seawater | MPIRKVKGGWTFGGAVYKTLETAKRSYKAYLAKKHSKKGN |
| Ga0256382_10831002 | 3300028022 | Seawater | MPIRKAKGGWTFGGAVYDSKSKAERAYKAYLAKKHSKASN |
| Ga0256380_10337523 | 3300028039 | Seawater | MPIRKVKGGWTFGGHVYKSLDKAKKSYKAYLAKKHSTRKRA |
| Ga0307423_10919512 | 3300031371 | Salt Marsh | MPVRKTKGGYTFGGGTYKSKASANRSYKAYLAKKYSKRGKKRK |
| Ga0307423_11070391 | 3300031371 | Salt Marsh | MPVRKTKGGYTFGGGTYKSKASANRSYKAYLAKKYSK |
| Ga0310125_104007832 | 3300031811 | Marine | KVKGGWGFGGGVHKTLASCKRSYAAYLAKKNSKTKRG |
| Ga0315318_100141922 | 3300031886 | Seawater | MPVKKVKGGWSFGGGVHKTKASVDRSYRAYLAKKNSKKKRG |
| Ga0310344_111460172 | 3300032006 | Seawater | MPIRKVKGGWTFGGAIYKTLEAAKRAYKAYLAKKHSKKRK |
| Ga0315338_10615333 | 3300032138 | Seawater | MPIRKVKGGYSFGGGVHKTLASAKRSYKAYLAKKNSKTKRG |
| Ga0310345_100882733 | 3300032278 | Seawater | MPIRKVKGGWTFGGAVYKTLKAAKKAYKAYLAKTHSAKRKRKA |
| Ga0310345_120015162 | 3300032278 | Seawater | MPIRKVKGGWTFGGAVYKTLKAAKKAYKAYLHKSKNAGKR |
| Ga0326756_016427_332_469 | 3300034629 | Filtered Seawater | MPIRKVKGGYSFGGGVYDTLKKAKASYTAYLAKKHSKSKPKIRRA |
| Ga0326756_050386_224_346 | 3300034629 | Filtered Seawater | MPIRKVKGGWTFGGAVYKTLAAAKRAYKAYLAKKHSAKRK |
| Ga0326741_002876_201_326 | 3300034654 | Filtered Seawater | MPIKKVKGGWSFGGGVHKTLASAKRSYKAYLAKKNSKSKRD |
| Ga0326746_010823_735_851 | 3300034655 | Filtered Seawater | MPIRKVKGGWTFGGHVYKSLEKAQKSYKAYLAKKHSTRK |
| Ga0326748_064803_366_488 | 3300034656 | Filtered Seawater | MPIRKVKGGWTFGGAVYKTLAAAKRSYKAYLAKKHGAKRK |
| ⦗Top⦘ |