


| Basic Information | |
|---|---|
| Family ID | F049863 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 146 |
| Average Sequence Length | 43 residues |
| Representative Sequence | GVAAGAATAEDQAAANQFDKAGRTLLDVINRLTDVLLEMR |
| Number of Associated Samples | 125 |
| Number of Associated Scaffolds | 146 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.69 % |
| % of genes near scaffold ends (potentially truncated) | 97.26 % |
| % of genes from short scaffolds (< 2000 bps) | 90.41 % |
| Associated GOLD sequencing projects | 114 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.67 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.096 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (10.274 % of family members) |
| Environment Ontology (ENVO) | Unclassified (49.315 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (65.068 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.47% β-sheet: 0.00% Coil/Unstructured: 48.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.67 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 146 Family Scaffolds |
|---|---|---|
| PF00092 | VWA | 10.96 |
| PF13519 | VWA_2 | 10.96 |
| PF00691 | OmpA | 6.16 |
| PF00478 | IMPDH | 4.79 |
| PF11199 | DUF2891 | 2.74 |
| PF00171 | Aldedh | 2.74 |
| PF02817 | E3_binding | 0.68 |
| PF00441 | Acyl-CoA_dh_1 | 0.68 |
| PF01936 | NYN | 0.68 |
| PF00198 | 2-oxoacid_dh | 0.68 |
| PF03099 | BPL_LplA_LipB | 0.68 |
| PF00903 | Glyoxalase | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 146 Family Scaffolds |
|---|---|---|---|
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 2.74 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 2.74 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 2.74 |
| COG0508 | Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component | Energy production and conversion [C] | 1.37 |
| COG0095 | Lipoate-protein ligase A | Coenzyme transport and metabolism [H] | 0.68 |
| COG0321 | Lipoate-protein ligase B | Coenzyme transport and metabolism [H] | 0.68 |
| COG0340 | Biotin-protein ligase | Coenzyme transport and metabolism [H] | 0.68 |
| COG1432 | NYN domain, predicted PIN-related RNAse, tRNA/rRNA maturation | General function prediction only [R] | 0.68 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.10 % |
| Unclassified | root | N/A | 8.90 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918007|ConsensusfromContig169983 | Not Available | 653 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_14038122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 865 | Open in IMG/M |
| 3300000574|JGI1357J11328_10084056 | Not Available | 1056 | Open in IMG/M |
| 3300000890|JGI11643J12802_12262768 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2370 | Open in IMG/M |
| 3300002886|JGI25612J43240_1046896 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300004157|Ga0062590_102074245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300005295|Ga0065707_10216502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1242 | Open in IMG/M |
| 3300005333|Ga0070677_10104276 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1256 | Open in IMG/M |
| 3300005343|Ga0070687_101443005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300005354|Ga0070675_100336714 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1336 | Open in IMG/M |
| 3300005356|Ga0070674_101231554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
| 3300005438|Ga0070701_10109400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1542 | Open in IMG/M |
| 3300005440|Ga0070705_101380388 | Not Available | 587 | Open in IMG/M |
| 3300005444|Ga0070694_101935069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300005544|Ga0070686_100847963 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
| 3300005574|Ga0066694_10535156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300005577|Ga0068857_101903411 | Not Available | 583 | Open in IMG/M |
| 3300005577|Ga0068857_102491397 | Not Available | 508 | Open in IMG/M |
| 3300005617|Ga0068859_100272962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1783 | Open in IMG/M |
| 3300005617|Ga0068859_100780565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1044 | Open in IMG/M |
| 3300005617|Ga0068859_101960812 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300005618|Ga0068864_101474397 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300005841|Ga0068863_100242822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1738 | Open in IMG/M |
| 3300005843|Ga0068860_101458708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
| 3300005844|Ga0068862_100092151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2641 | Open in IMG/M |
| 3300005844|Ga0068862_100853348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 893 | Open in IMG/M |
| 3300006049|Ga0075417_10567765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300006173|Ga0070716_101048315 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300006794|Ga0066658_10320221 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 828 | Open in IMG/M |
| 3300006796|Ga0066665_10203057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1539 | Open in IMG/M |
| 3300006844|Ga0075428_101278305 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 772 | Open in IMG/M |
| 3300006846|Ga0075430_101326302 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300006876|Ga0079217_10705756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
| 3300006894|Ga0079215_10027121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2002 | Open in IMG/M |
| 3300006903|Ga0075426_10724699 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
| 3300006954|Ga0079219_10121702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1332 | Open in IMG/M |
| 3300007076|Ga0075435_101693825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300007265|Ga0099794_10412701 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300007788|Ga0099795_10560702 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300009011|Ga0105251_10118146 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1205 | Open in IMG/M |
| 3300009088|Ga0099830_10738191 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300009089|Ga0099828_11448357 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300009090|Ga0099827_11471854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300009098|Ga0105245_10853468 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 951 | Open in IMG/M |
| 3300009100|Ga0075418_11331799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
| 3300009101|Ga0105247_10796722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300009147|Ga0114129_13421112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 510 | Open in IMG/M |
| 3300009148|Ga0105243_10368174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1325 | Open in IMG/M |
| 3300009162|Ga0075423_12305351 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300009174|Ga0105241_10813563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 862 | Open in IMG/M |
| 3300009176|Ga0105242_10435298 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
| 3300009545|Ga0105237_10201191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1992 | Open in IMG/M |
| 3300010042|Ga0126314_10057446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2546 | Open in IMG/M |
| 3300010044|Ga0126310_11587221 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300010044|Ga0126310_11852012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300010045|Ga0126311_10037457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 3034 | Open in IMG/M |
| 3300010045|Ga0126311_11167543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300010359|Ga0126376_10412507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1221 | Open in IMG/M |
| 3300010360|Ga0126372_12924363 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300010375|Ga0105239_10313524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1768 | Open in IMG/M |
| 3300010375|Ga0105239_13467061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300010397|Ga0134124_10926138 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 879 | Open in IMG/M |
| 3300010399|Ga0134127_10187771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1911 | Open in IMG/M |
| 3300010400|Ga0134122_11232548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
| 3300010400|Ga0134122_11819837 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300010401|Ga0134121_10689761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 967 | Open in IMG/M |
| 3300010401|Ga0134121_10835046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 888 | Open in IMG/M |
| 3300010401|Ga0134121_11020558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
| 3300011269|Ga0137392_10884028 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300011332|Ga0126317_10341802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300012198|Ga0137364_11264354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300012202|Ga0137363_11046142 | Not Available | 694 | Open in IMG/M |
| 3300012362|Ga0137361_11199114 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
| 3300012363|Ga0137390_10255813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1736 | Open in IMG/M |
| 3300012363|Ga0137390_11358168 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300012469|Ga0150984_113829632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300012681|Ga0136613_10547419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
| 3300012925|Ga0137419_10753537 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300012927|Ga0137416_10803668 | Not Available | 832 | Open in IMG/M |
| 3300013297|Ga0157378_11083810 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
| 3300013297|Ga0157378_11678036 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
| 3300013308|Ga0157375_11662860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 755 | Open in IMG/M |
| 3300014325|Ga0163163_10933311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 931 | Open in IMG/M |
| 3300014326|Ga0157380_11105806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 832 | Open in IMG/M |
| 3300014326|Ga0157380_11673561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
| 3300014883|Ga0180086_1003332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 3071 | Open in IMG/M |
| 3300014968|Ga0157379_10372735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1309 | Open in IMG/M |
| 3300015052|Ga0137411_1202783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 967 | Open in IMG/M |
| 3300015371|Ga0132258_10736655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2483 | Open in IMG/M |
| 3300015371|Ga0132258_11837134 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1526 | Open in IMG/M |
| 3300015373|Ga0132257_100827398 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300015374|Ga0132255_100781631 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1422 | Open in IMG/M |
| 3300015374|Ga0132255_103564604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
| 3300018054|Ga0184621_10339718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300018061|Ga0184619_10286145 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
| 3300018469|Ga0190270_12294167 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300018476|Ga0190274_12913995 | Not Available | 574 | Open in IMG/M |
| 3300019360|Ga0187894_10366487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300019767|Ga0190267_11403438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300020016|Ga0193696_1102297 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300021088|Ga0210404_10562341 | Not Available | 647 | Open in IMG/M |
| 3300021445|Ga0182009_10728150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300025885|Ga0207653_10228561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
| 3300025893|Ga0207682_10468426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300025903|Ga0207680_10992088 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300025907|Ga0207645_10066400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2306 | Open in IMG/M |
| 3300025911|Ga0207654_11235638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300025914|Ga0207671_10049218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 3120 | Open in IMG/M |
| 3300025922|Ga0207646_11534660 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300025922|Ga0207646_11835904 | Not Available | 518 | Open in IMG/M |
| 3300025927|Ga0207687_10044541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 3063 | Open in IMG/M |
| 3300025936|Ga0207670_10564607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 931 | Open in IMG/M |
| 3300025942|Ga0207689_10322654 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1282 | Open in IMG/M |
| 3300025942|Ga0207689_10690394 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 861 | Open in IMG/M |
| 3300025960|Ga0207651_11627771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300025981|Ga0207640_12009518 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300026023|Ga0207677_10265926 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1400 | Open in IMG/M |
| 3300026041|Ga0207639_10026092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 4243 | Open in IMG/M |
| 3300026063|Ga0208656_1020399 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300026088|Ga0207641_12413537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300026089|Ga0207648_10512753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1098 | Open in IMG/M |
| 3300026095|Ga0207676_10393042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1294 | Open in IMG/M |
| 3300026095|Ga0207676_12287654 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300026118|Ga0207675_102360482 | Not Available | 545 | Open in IMG/M |
| 3300026118|Ga0207675_102381455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300026322|Ga0209687_1096645 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 960 | Open in IMG/M |
| 3300027678|Ga0209011_1186873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300027716|Ga0209682_10044960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1066 | Open in IMG/M |
| 3300027778|Ga0209464_10140943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 843 | Open in IMG/M |
| 3300027831|Ga0209797_10210923 | Not Available | 824 | Open in IMG/M |
| 3300027840|Ga0209683_10336759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 694 | Open in IMG/M |
| 3300027873|Ga0209814_10051402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1720 | Open in IMG/M |
| 3300028381|Ga0268264_10277296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1569 | Open in IMG/M |
| 3300028381|Ga0268264_10446061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1253 | Open in IMG/M |
| 3300028536|Ga0137415_10381571 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1213 | Open in IMG/M |
| 3300028578|Ga0272482_10177270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300031731|Ga0307405_11783935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300031740|Ga0307468_101693536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300031911|Ga0307412_10969838 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
| 3300031949|Ga0214473_10066886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 4203 | Open in IMG/M |
| 3300032126|Ga0307415_100043034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3010 | Open in IMG/M |
| 3300033412|Ga0310810_10997626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
| 3300034174|Ga0334932_098208 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300034376|Ga0334923_015430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1576 | Open in IMG/M |
| 3300034376|Ga0334923_131892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 517 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.27% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 10.27% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.16% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.79% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.11% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.42% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.42% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.42% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 2.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.74% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.05% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.05% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.05% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.05% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.05% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.37% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.37% |
| Hypolithic Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust | 1.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.37% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.68% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.68% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.68% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.68% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.68% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.68% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.68% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.68% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.68% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.68% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000574 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012681 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026063 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027716 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028578 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT160D0 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034174 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 28HNS | Environmental | Open in IMG/M |
| 3300034376 | Biocrust microbial communities from Mojave Desert, California, United States - 19HNC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A_all_C_03469450 | 2140918007 | Soil | GSAAGAATAEDQAAAGHFDQAGRTMLGVANRLTDVLLAMR |
| ICChiseqgaiiFebDRAFT_140381221 | 3300000363 | Soil | AATAEEQAAANQFDAAGRTLLNVINRLTDVLLAMRS* |
| JGI1357J11328_100840562 | 3300000574 | Groundwater | ATAEEQAADGHFDQAGRTMLGVVNRLTDVLLAMR* |
| JGI11643J12802_122627683 | 3300000890 | Soil | AGAATAEQQAAANQFDPAGRTLLTVINRLADVLVIMRQ* |
| JGI25612J43240_10468962 | 3300002886 | Grasslands Soil | AGVASGAANAEQQAAANQFDAAGRSLLNVVNRLTDVLLAMR* |
| Ga0062590_1020742451 | 3300004157 | Soil | PFYIKLAGVAAGAATAEEQANANQFDAAGRTLLNVINRLADVLVIMRQ* |
| Ga0065707_102165021 | 3300005295 | Switchgrass Rhizosphere | YIKLAGVAAGAATAEEQAAANQFDASGRTLLNVINRLTDVLLIMRTTA* |
| Ga0070677_101042762 | 3300005333 | Miscanthus Rhizosphere | PDLRRYYTRLAGVAAGAAAAEQQAAANQFDRAGRSLLEVVNRLTDVLLEMQR* |
| Ga0070687_1014430051 | 3300005343 | Switchgrass Rhizosphere | SPDLRRYYTRLAGVAAGAAAAEQQAAANQFDRAGRSLLEVVNRLTDVLLEMQR* |
| Ga0070675_1003367142 | 3300005354 | Miscanthus Rhizosphere | TPELQRYYIKLAGVAARAANAEDLAAANQFDKAGRNLLEVVNQLTDVLLEMRNR* |
| Ga0070674_1012315542 | 3300005356 | Miscanthus Rhizosphere | FSSSPDLRRYYTRLAGVAAGAAAAEQQAAANQFDRAGRSLLEVVNRLTDVLLEMQR* |
| Ga0070701_101094001 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | GVAAGAAAAEQQAAANQFDRAGRSLLEVVNRLTDVLLEMQR* |
| Ga0070705_1013803881 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | KLAGSAAGAATAEEQAAANQFGASGRTLLNVIYRLTDVLLIMR* |
| Ga0070694_1019350692 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | PALQRYYIKLAGVAAGAAKAEDLAAANQFDKAGRALLEVVNHLTDVLLAMR* |
| Ga0070686_1008479631 | 3300005544 | Switchgrass Rhizosphere | KLAGVAAGAATAEEQANANQFDAAGRTLLSVINRLADVLVIMRQ* |
| Ga0066694_105351561 | 3300005574 | Soil | AGVADGGSKAEQLAAAGQFDQAGRTLLSVINRLTDVLLDMK* |
| Ga0068857_1019034111 | 3300005577 | Corn Rhizosphere | QPYYIKLAGVAAGAASAEEQAAANQFDAAGRTLLNVINRLTDVLLIMRTTT* |
| Ga0068857_1024913972 | 3300005577 | Corn Rhizosphere | LQPYYIKLAGVAAGAATAEDLAAKNQFDAAGRQLLNVINRLTDVLLLMRTTA* |
| Ga0068859_1002729623 | 3300005617 | Switchgrass Rhizosphere | VAAGAATAEEQAAANQFDASGRTLLNVINRLTDVLLLMRTTA* |
| Ga0068859_1007805651 | 3300005617 | Switchgrass Rhizosphere | AAGAATAEEQANANQFDAAGRTLLNVINRLADVLVIMRQ* |
| Ga0068859_1019608121 | 3300005617 | Switchgrass Rhizosphere | TAEEQAAANQFDAAGRSLLTVIGRLTDVLVIMRQ* |
| Ga0068864_1014743972 | 3300005618 | Switchgrass Rhizosphere | GAATAEEQAAANQFDRAGRTLLDVIGRLADVLVIMRQ* |
| Ga0068863_1002428221 | 3300005841 | Switchgrass Rhizosphere | GVAAGAADAEQKATTEQFDAAGRSLLGVVNRLTDVLLLMRY* |
| Ga0068860_1014587082 | 3300005843 | Switchgrass Rhizosphere | LQPYYIKLAGVAAGAATAEEQAAANQFDASGRTLLNVINRLTDVLLLMRTTT* |
| Ga0068862_1000921511 | 3300005844 | Switchgrass Rhizosphere | RYYTRLAGVAAGAAAAEEQAAANQFDRSGRTLIEVVNRLTDVLLEMR* |
| Ga0068862_1008533482 | 3300005844 | Switchgrass Rhizosphere | SAAGAAKAEDLAAANQFDKAGRALLDVVNHLTDVLLAMR* |
| Ga0081540_11593082 | 3300005983 | Tabebuia Heterophylla Rhizosphere | AKAEDLAAANQFDKAGRALLEVVNHLTDVLLEMR* |
| Ga0075417_105677651 | 3300006049 | Populus Rhizosphere | ATAEEQAAANQFDRSGRTLLDVVNRLADVLVIMRQ* |
| Ga0070716_1010483152 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | ATAEEQAASNQFDAAGRSLLNVINRLTDVLLGMRE* |
| Ga0066658_103202211 | 3300006794 | Soil | AGVAAGAATAEDQAAGGQYDQAGRSLLNVVNRLTDVLLEMR* |
| Ga0066665_102030572 | 3300006796 | Soil | GAATAEDQAAAGHFDQAGRTLLGVVNRLTDVLLAMR* |
| Ga0075428_1012783052 | 3300006844 | Populus Rhizosphere | AAAEERAAANQFDAAGRQLLNVVNRLTDVLLLMRTTE* |
| Ga0075430_1013263022 | 3300006846 | Populus Rhizosphere | LAGVAAGAAAAEERAAANQFDAAGRQLLNVVNRLTDVLLLMRTTE* |
| Ga0079217_107057561 | 3300006876 | Agricultural Soil | AAGAATAEEQAGANQFDAAGRSLLNVINRLTDVLLAMR* |
| Ga0079215_100271213 | 3300006894 | Agricultural Soil | IKLAGVAAGAATADEQAAANQFDAAGRTLLTVINRLTDVLLIMRQ* |
| Ga0075426_107246992 | 3300006903 | Populus Rhizosphere | IKLAGVAAGAATAEEQAANNQFDGAGRTLLNVVARLADVLVVMRQ* |
| Ga0079219_101217022 | 3300006954 | Agricultural Soil | VAAGAATAEERAGANQFDAAGRQLLNVVNRLTDVLLLMRTTE* |
| Ga0075435_1016938251 | 3300007076 | Populus Rhizosphere | PLAGVASGAAKAEEQAAANQFDQAGRTLLDVVNRLTDVLLEMSK* |
| Ga0099794_104127011 | 3300007265 | Vadose Zone Soil | LEQYYLKLAGSAAGAATAEDQAAAGHFDQAGRTMLGVVNRLTDVLLAMR* |
| Ga0099795_105607021 | 3300007788 | Vadose Zone Soil | AADAEQQAAANQFDRAGRSLLNVVNRLTDVLLAMRY* |
| Ga0105251_101181461 | 3300009011 | Switchgrass Rhizosphere | EDLAAKNQFDAAGRQLLNVINRLTDVLLLMRTTA* |
| Ga0099830_107381911 | 3300009088 | Vadose Zone Soil | KLAGVAAGAADAEQQAAANQFDRAGRSLLNVVNRLTDVLLAMR* |
| Ga0099828_114483572 | 3300009089 | Vadose Zone Soil | EQYYLKLAGSAAGAATAEDQATAGHFDQAGRTMLGVVNRLTDVLLAMR* |
| Ga0099827_114718541 | 3300009090 | Vadose Zone Soil | GVAAGAATAEDQAAANQFDKAGRTLLDVINRLTDVLLEMR* |
| Ga0105245_108534682 | 3300009098 | Miscanthus Rhizosphere | LQPYYIKLAGVAAGAATAEEQANANQFDAGGRTLLNVINRLADVLVIMRQ* |
| Ga0075418_113317991 | 3300009100 | Populus Rhizosphere | AATAEQQAANNQFDAAGRSLLGVINRLTDVLLIMR* |
| Ga0105247_107967222 | 3300009101 | Switchgrass Rhizosphere | YYIKLAGVAAGAATAEEQANTNQFDAGGRTLLNVINRLADVLVIMRQ* |
| Ga0114129_134211121 | 3300009147 | Populus Rhizosphere | KLAGVASGAATAEELAAKNQFDASGRQLLNVINRLTDVLLLIRTTT* |
| Ga0105243_103681743 | 3300009148 | Miscanthus Rhizosphere | AGVAAGAAKAEELAARNQFDQAGRSLLGVVNQLTDVLVVMR* |
| Ga0075423_123053511 | 3300009162 | Populus Rhizosphere | LAGSADGAANAENFAAAGQFDRAGRTLLDVVNRLTDTLAIMR* |
| Ga0105241_108135632 | 3300009174 | Corn Rhizosphere | GAAAAEERANVNEYDAGGRTLLNVINRLADVLVIMRQ* |
| Ga0105242_104352982 | 3300009176 | Miscanthus Rhizosphere | YLKLAGSAEGAAAAENLAASGRFDQAGRALLGVVNRLADTLVSMRQP* |
| Ga0105237_102011913 | 3300009545 | Corn Rhizosphere | AAGAATAEEQANANQFDAAGRTLLSVINRLADVLVIMRQ* |
| Ga0126314_100574463 | 3300010042 | Serpentine Soil | QPFYIKLAGVAAGAATAEEQANANQFDAGGRTLLNVINRLADVLVIMRQ* |
| Ga0126310_115872212 | 3300010044 | Serpentine Soil | AATAEEQAAANQFDASGRTLLNVINRLTDVLVVMRQ* |
| Ga0126310_118520122 | 3300010044 | Serpentine Soil | ADAEDQAAANRFDQAGRTLLNVVNRLTDVLLEMR* |
| Ga0126311_100374574 | 3300010045 | Serpentine Soil | YYIKLAGVAAGAATAEERAAANQFDAAGRQLLNVVNRLTDVLLLMRTTE* |
| Ga0126311_111675432 | 3300010045 | Serpentine Soil | AAGAAAAEDQAAANQFDQAGRSLLNVVNRLTDVLLEMR* |
| Ga0126376_104125071 | 3300010359 | Tropical Forest Soil | QPYYIKLAGSAAGAATAEEQAAANQFDAAGRSLLNVINRLTDVLLIMRQ* |
| Ga0126372_129243631 | 3300010360 | Tropical Forest Soil | GAADAEALANQGQFDRAGRALLGVVNRLTDVLVIMP* |
| Ga0105239_103135241 | 3300010375 | Corn Rhizosphere | GAATAEERAAANQFDAAGRQLLNVVNRLTEVLLLMRTTE* |
| Ga0105239_134670611 | 3300010375 | Corn Rhizosphere | GAAKAEDLAAANQFDKAGRALLDVVNHLTDVLLAMR* |
| Ga0134124_109261382 | 3300010397 | Terrestrial Soil | QPYYIKLAGVAAGAAAAEERAAANKFDDAGRQLLNVVNRLTDVLLLMRTTE* |
| Ga0134127_101877711 | 3300010399 | Terrestrial Soil | ATAEELANANQFDAAGRTLLNVINRLADVLVIMRQ* |
| Ga0134122_112325482 | 3300010400 | Terrestrial Soil | VAAGAATAEQQATNNQFDAAGRQLLLVVNRLADVLVVMRM* |
| Ga0134122_118198371 | 3300010400 | Terrestrial Soil | KLAGVAAGAATAEEQAAANQFDRAGRTLLDVIGRLADVLVIMRQ* |
| Ga0134121_106897612 | 3300010401 | Terrestrial Soil | GVAARAASAEELAAANQFDKAGRSLLEVVNQLTDVLLEMR* |
| Ga0134121_108350462 | 3300010401 | Terrestrial Soil | DFRTTPALQRYYIKLAGVAAGAAKAEDLAAANQFDKAGRALLDVVNHLTDVLLAMR* |
| Ga0134121_110205582 | 3300010401 | Terrestrial Soil | KLAGVAAGAAAAEQQATNNQFDAAGRSLLLVVNRLADVLVVMRM* |
| Ga0137392_108840281 | 3300011269 | Vadose Zone Soil | ANAEAQAAAGHFDQAGRTLLGVVNRLTDVLVLMR* |
| Ga0126317_103418022 | 3300011332 | Soil | YIKLAGVAAGAATAEEQAAKNQFDASGRTLLNVINRLTDVLLLMRTTT* |
| Ga0137364_112643541 | 3300012198 | Vadose Zone Soil | LNRYYIPLAGVASGAARAEEQAGANQFDQAGRTLLEVVNRLTDVLLEMTR* |
| Ga0137363_110461421 | 3300012202 | Vadose Zone Soil | ATAEDQAAAGHFDQAGRTMLGVVNRLTDVLLVMR* |
| Ga0137361_111991141 | 3300012362 | Vadose Zone Soil | AAGAADAEQQAAANQFDRAGRSLLNVVNRLTDVLLAMR* |
| Ga0137390_102558131 | 3300012363 | Vadose Zone Soil | VAESAAIAEDQAAANKFDQAGRSLLGVVNRLTDVLLAMR* |
| Ga0137390_113581682 | 3300012363 | Vadose Zone Soil | SGAADSEAQAGAGHFDQAGRTLLGVVNRLTDVLVLMR* |
| Ga0150984_1138296321 | 3300012469 | Avena Fatua Rhizosphere | LRYYTTLAGVAAGAATAEDQAAAGQYEQAGRSLLGVVNRLTDVLLAMR* |
| Ga0136613_105474192 | 3300012681 | Polar Desert Sand | DFRTKPELLRYYTKLAGAASGAAAAEEQAAASQFDQAGRSLLGVVNRLTDVLLEIGK* |
| Ga0137419_107535371 | 3300012925 | Vadose Zone Soil | ERRRTRAAAAVSPADAEAQAAAGHFDQAGRTMLGVVNRLTDVLLVMR* |
| Ga0137416_108036681 | 3300012927 | Vadose Zone Soil | GVAAEAAAAEEQAAQNQFDKAGRTLLGVVNHLTDALLEMH* |
| Ga0157378_110838101 | 3300013297 | Miscanthus Rhizosphere | KLAGVAAGAATAEEQANAGQFDASGRTLLNVINRLADVLVVMRQ* |
| Ga0157378_116780361 | 3300013297 | Miscanthus Rhizosphere | YYIKLAGVAAGAADAEQKATTEQFDAAGRSLLGVVNRLTDVLLLMRY* |
| Ga0157375_116628601 | 3300013308 | Miscanthus Rhizosphere | IKLAGSAAGAAKAEDLAAANQFDKAGRALLDVVNHLTDVLLAMR* |
| Ga0163163_109333111 | 3300014325 | Switchgrass Rhizosphere | AGTATAEQQAGNNQFDAAGRSLLNVVNRLTDVLFAMRQ* |
| Ga0157380_111058062 | 3300014326 | Switchgrass Rhizosphere | PELQPFYIKLAGVAAGAATAEEQANANQFDAAGRTLLNVINRLADVLVIMRQ* |
| Ga0157380_116735611 | 3300014326 | Switchgrass Rhizosphere | AGVAAGAADAEQKAAANQFDPAARSLLQVVNRLSDVLALM* |
| Ga0180086_10033323 | 3300014883 | Soil | RTTPELQRHYIKLAGVALGAATAEDQAAADQFDKAGRTLLEVVNHLTDVLLEMR* |
| Ga0157379_103727351 | 3300014968 | Switchgrass Rhizosphere | IKLAGVAAGAAAAEEQAAANQFDRSGRTLLDVVNRLADVLVIMRQ* |
| Ga0137411_12027832 | 3300015052 | Vadose Zone Soil | TTPELQRYYIKLAGVAAGAATAEEEAAANQFDKAGRTLLEVVNHLTDVLLEMR* |
| Ga0132258_107366551 | 3300015371 | Arabidopsis Rhizosphere | LAGVAAGTATAEQQAGNNQFDAAGRSLLNVVNRLTDVLFAMRQ* |
| Ga0132258_118371342 | 3300015371 | Arabidopsis Rhizosphere | LQPYYIKLAGVADGAASAEQLAASNQFDAAGRQLLGVVNRLADVLVIMRQ* |
| Ga0132257_1008273981 | 3300015373 | Arabidopsis Rhizosphere | AEGAATAENLAASGRFDQAGRTMLGVANRLTDVLLIMR* |
| Ga0132255_1007816311 | 3300015374 | Arabidopsis Rhizosphere | AAGAATAEEQANGNQFDASGRTLLNVINRLTDVLVIMRQ* |
| Ga0132255_1035646042 | 3300015374 | Arabidopsis Rhizosphere | GVAAGTAKAEDQAAANQFDQAGRTMLEVVNRLTDVLLEMP* |
| Ga0184621_103397182 | 3300018054 | Groundwater Sediment | AGVAARAATAEDLAAANQFDKAGRTLLEVVNHLADVLLEMR |
| Ga0184619_102861452 | 3300018061 | Groundwater Sediment | RYYIKLAGVAAGAASAEDQAAANQFDKAGRTLLDVVNHLTDVLLEMR |
| Ga0190270_122941671 | 3300018469 | Soil | AAGAAKAEELAARNQFDQAGRTLLEVVNRLTDVLLDMR |
| Ga0190274_129139952 | 3300018476 | Soil | AGVAAGAAKAEDLAARNQFDQAGRSLLEVVNRLTDVLLAMR |
| Ga0187894_103664872 | 3300019360 | Microbial Mat On Rocks | QPYYIKLAGSAAGAAKAEEQAAAGQYDAGGRTLLTVINRLTDVLLAMRQ |
| Ga0190267_114034381 | 3300019767 | Soil | TPELQRYYIKLAGSAAGASNADDQAAANQFDKAGRTLLEVVNRLTDVLLEMR |
| Ga0193696_11022971 | 3300020016 | Soil | IDFRTTPELQRYYIKLAGVASGAANAEDLAAANQFDKAGRTLLGVVNQLTDVLLEMR |
| Ga0210404_105623412 | 3300021088 | Soil | QYYLKLAGSAAGAAAAEDQAAAGHFDQAGRTMLGVVNRLTDVLLAMR |
| Ga0182009_107281502 | 3300021445 | Soil | SASGAAAAEEQAAANQFDAAGRTLLNVINRLTDVLLVMRQ |
| Ga0207653_102285612 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | ATPELQRYYIKLAGVAAGAANAEDLAAANQFDKAGRALLEVVNHLTDVLLEMR |
| Ga0207682_104684261 | 3300025893 | Miscanthus Rhizosphere | TRLAGVAAGAAAAEQQAAANQFDRAGRSLLEVVNRLTDVLLEMQR |
| Ga0207680_109920881 | 3300025903 | Switchgrass Rhizosphere | GAANAEDQAAANQFDKAGRTLLEVVNRLTDVLLEMR |
| Ga0207645_100664003 | 3300025907 | Miscanthus Rhizosphere | AAGAASAEEKAAANQFDEAGRLLLNVINRLADVLVVMRQ |
| Ga0207654_112356382 | 3300025911 | Corn Rhizosphere | LAGVAAGAAKAEDLAAANQFDKAGRALLEVVNHLTDVLLAMR |
| Ga0207671_100492184 | 3300025914 | Corn Rhizosphere | AGAAAAEEKAGANQFDAAGRQLLNVVNRLTDVLLLMRTTD |
| Ga0207646_115346602 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | GSAAGAATAEDQAAAGHFDQAGRTLLDVVTRLTDVLLAMR |
| Ga0207646_118359041 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | AATAEDQAAAGHFDQAGRTMLGVVNRLTDVLLVMR |
| Ga0207687_100445411 | 3300025927 | Miscanthus Rhizosphere | AADAEQKATTEQFDAAGRSLLGVVNRLTDVLLLMRY |
| Ga0207670_105646071 | 3300025936 | Switchgrass Rhizosphere | LQPYYIKLAGVAAGAADAEQKATTEQFDAAGRSLLGVVNRLTDVLLLMRY |
| Ga0207689_103226541 | 3300025942 | Miscanthus Rhizosphere | GVAAGAATAADLAAKNQFDAAGRQLLNVINKLTDVLLLMRTTA |
| Ga0207689_106903942 | 3300025942 | Miscanthus Rhizosphere | AGAATAEELAAANQFDRAGRSLLGVINRLTDVLLLMRTIE |
| Ga0207651_116277712 | 3300025960 | Switchgrass Rhizosphere | YIKLAGVASGAATAEDLAAKNQFDAAGRQLLNVINRLTDVLLLMRTTT |
| Ga0207640_120095182 | 3300025981 | Corn Rhizosphere | AAGAATAEEQAAANQFDASGRTLLNVINRLTDVLLLMRTTA |
| Ga0207677_102659261 | 3300026023 | Miscanthus Rhizosphere | AAGAADAEQKATTEQFDAAGRSLLGVVNRLTDVLLLMRY |
| Ga0207639_100260921 | 3300026041 | Corn Rhizosphere | ADGAATAEQQAAANQFDAAGRSLLNVISRLTDVLVVMRQ |
| Ga0208656_10203992 | 3300026063 | Natural And Restored Wetlands | ATAEEQAAVNQFDAAGRSLLNVIGRLADVLVVMRQ |
| Ga0207641_124135371 | 3300026088 | Switchgrass Rhizosphere | QPFYIKLAGVAAGAATAEEQANANQFDAAGRTLLNVINRLADVLVIMRQ |
| Ga0207648_105127532 | 3300026089 | Miscanthus Rhizosphere | ATAEEQANANQFDAAGRTLLTVINRLADVLVIMRQ |
| Ga0207676_103930422 | 3300026095 | Switchgrass Rhizosphere | PYYIKLAGVAAGAATAEEQANANQFDAAGRTLLSVINRLADVLVIMRQ |
| Ga0207676_122876542 | 3300026095 | Switchgrass Rhizosphere | LAGSAAGAAKAEELAAGAQYDAGGRTLLTVINRLTDVLVIMRQ |
| Ga0207675_1023604821 | 3300026118 | Switchgrass Rhizosphere | ELTIHYTQLAGVAAAAAKAEDLAARNQFDQAGRTLLGVVNQLTDVLLDMR |
| Ga0207675_1023814552 | 3300026118 | Switchgrass Rhizosphere | LSGVALQAGNAEDQAASNQFDKAGRTLLEVVNQLTDALLDIR |
| Ga0209687_10966452 | 3300026322 | Soil | AATAEQQAAANQFDASGRTLLNVINRLTDVLVVMRQ |
| Ga0209011_11868731 | 3300027678 | Forest Soil | FRATPELQRYYIKLAGVAAGAASAEDQASANQFDKAGRTLLDVVNHLTDVLLEMR |
| Ga0209682_100449601 | 3300027716 | Wetland Sediment | FRATPTLVAYYYKLAGVADGAAKAEQLAAANQFDQAGRTLLNVVNRLTDVLLDMK |
| Ga0209464_101409431 | 3300027778 | Wetland Sediment | YYKLAGVADGAAKAEQLAAANQFDQAGRTLLNVVNRLTDVLLDMK |
| Ga0209797_102109231 | 3300027831 | Wetland Sediment | LQRYYISLAGVAQGASTAEEQAAENKFDQAGRSLLSVVNRLTDVLLGMR |
| Ga0209683_103367591 | 3300027840 | Wetland Sediment | RLAGSAQGAATAEDEAAAGQFDKSGRTLLTVVNRLTDVLLEMR |
| Ga0209814_100514023 | 3300027873 | Populus Rhizosphere | LAGMAAGAATAEEQAAANQFDRSGRTLLDVVNRLADVLVIMRQ |
| Ga0268264_102772963 | 3300028381 | Switchgrass Rhizosphere | AGAASAEEKAAANQFDEAGRLLLNVINRLADVLVVMRQ |
| Ga0268264_104460612 | 3300028381 | Switchgrass Rhizosphere | AEEQAAANQFDRAGRSLLGVINRLTDVLLLMRTTE |
| Ga0137415_103815714 | 3300028536 | Vadose Zone Soil | GVAAEAAAAEEQAAQNQFDKAGRTLLGVVNHLTDALLEMH |
| Ga0272482_101772701 | 3300028578 | Soil | NLEIDFRTKPELLRYYTKLAGVAAGAAAAEEQAAANQFDQAGRLLLNVVNRLTDVLLEMR |
| Ga0307405_117839351 | 3300031731 | Rhizosphere | AAGAATAETQAANNQFDAAGRTLLGVVNRLTDVLLIIR |
| Ga0307468_1016935361 | 3300031740 | Hardwood Forest Soil | SGVALEAGNAEDQAAANQFDKAGRTLLEVVNQLTDTLLDMH |
| Ga0307412_109698382 | 3300031911 | Rhizosphere | GSAAGAATAEEQAAQSQFERSGRTLLGVINRLTDVLLLMRTTE |
| Ga0214473_100668864 | 3300031949 | Soil | AGVASGAATAEEQAAANQFDKAGRTLLEVVNHLTDVLLEMR |
| Ga0307415_1000430344 | 3300032126 | Rhizosphere | GVAAGAASAEEQAAANQFDAAGRTLLNVINRLTDVLVVMRQ |
| Ga0310810_109976262 | 3300033412 | Soil | YYIKLAGVAAGAAKAEDLAAANQFDKAGRALLDVVNHLTDVLLAMR |
| Ga0334932_098208_359_514 | 3300034174 | Sub-Biocrust Soil | PDLLRYYTKLAGVAAGAANAEEQAAANQFDQAGRSLLGVVNRLTDVLLEMR |
| Ga0334923_015430_1406_1576 | 3300034376 | Hypolithic Biocrust | HFRTTPELERFSLRLSGVALGAANAEQQASANRLDAAGRSLLEVINRLTDVLQEMH |
| Ga0334923_131892_2_115 | 3300034376 | Hypolithic Biocrust | AGAATAEEQANAGRYDQAGRSLISVVNRLTDVLLEMR |
| ⦗Top⦘ |