


| Basic Information | |
|---|---|
| Family ID | F049758 |
| Family Type | Metagenome |
| Number of Sequences | 146 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MYHIILWLSLIFGSVFSIINNEIYLSLSLFLIFAVNVAYNFTK |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 146 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 75.34 % |
| % of genes near scaffold ends (potentially truncated) | 32.19 % |
| % of genes from short scaffolds (< 2000 bps) | 81.51 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (63.014 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (39.726 % of family members) |
| Environment Ontology (ENVO) | Unclassified (80.137 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (93.836 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.75% β-sheet: 0.00% Coil/Unstructured: 42.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 146 Family Scaffolds |
|---|---|---|
| PF03237 | Terminase_6N | 5.48 |
| PF11171 | DUF2958 | 2.05 |
| PF08401 | ArdcN | 0.68 |
| PF13385 | Laminin_G_3 | 0.68 |
| PF13173 | AAA_14 | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 146 Family Scaffolds |
|---|---|---|---|
| COG4227 | Antirestriction protein ArdC | Replication, recombination and repair [L] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 63.01 % |
| All Organisms | root | All Organisms | 36.99 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10023286 | All Organisms → Viruses → Predicted Viral | 3559 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10098052 | Not Available | 1228 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10216149 | Not Available | 630 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10185135 | Not Available | 590 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10221922 | Not Available | 515 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10016095 | Not Available | 3739 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10095617 | Not Available | 1134 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10144879 | Not Available | 822 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10211819 | Not Available | 614 | Open in IMG/M |
| 3300000148|SI47jul10_100mDRAFT_c1042873 | Not Available | 610 | Open in IMG/M |
| 3300000149|LPaug09P1610mDRAFT_c1006563 | All Organisms → Viruses | 1687 | Open in IMG/M |
| 3300000265|LP_A_09_P04_10DRAFT_1031103 | Not Available | 893 | Open in IMG/M |
| 3300001354|JGI20155J14468_10174225 | Not Available | 666 | Open in IMG/M |
| 3300001450|JGI24006J15134_10062457 | All Organisms → Viruses → Predicted Viral | 1466 | Open in IMG/M |
| 3300001450|JGI24006J15134_10091738 | Not Available | 1109 | Open in IMG/M |
| 3300001450|JGI24006J15134_10130887 | Not Available | 850 | Open in IMG/M |
| 3300001450|JGI24006J15134_10160079 | Not Available | 727 | Open in IMG/M |
| 3300001460|JGI24003J15210_10056128 | Not Available | 1290 | Open in IMG/M |
| 3300001460|JGI24003J15210_10073144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → unclassified Pelagivirus → Pelagibacter phage HTVC031P | 1061 | Open in IMG/M |
| 3300001460|JGI24003J15210_10087125 | Not Available | 928 | Open in IMG/M |
| 3300001460|JGI24003J15210_10163324 | Not Available | 556 | Open in IMG/M |
| 3300001472|JGI24004J15324_10060740 | Not Available | 1086 | Open in IMG/M |
| 3300001472|JGI24004J15324_10107096 | Not Available | 707 | Open in IMG/M |
| 3300001472|JGI24004J15324_10117766 | Not Available | 655 | Open in IMG/M |
| 3300001472|JGI24004J15324_10130661 | Not Available | 603 | Open in IMG/M |
| 3300001963|GOS2229_1013137 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → unclassified Pelagivirus → Pelagibacter phage HTVC031P | 1749 | Open in IMG/M |
| 3300002482|JGI25127J35165_1122341 | Not Available | 514 | Open in IMG/M |
| 3300004448|Ga0065861_1107805 | Not Available | 806 | Open in IMG/M |
| 3300004457|Ga0066224_1003752 | All Organisms → Viruses → Predicted Viral | 4613 | Open in IMG/M |
| 3300005239|Ga0073579_1673884 | Not Available | 881 | Open in IMG/M |
| 3300005427|Ga0066851_10017052 | All Organisms → Viruses | 2750 | Open in IMG/M |
| 3300006027|Ga0075462_10039590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → unclassified Pelagivirus → Pelagibacter phage HTVC031P | 1508 | Open in IMG/M |
| 3300006090|Ga0082015_1046527 | Not Available | 696 | Open in IMG/M |
| 3300006191|Ga0075447_10242999 | Not Available | 584 | Open in IMG/M |
| 3300006735|Ga0098038_1029390 | Not Available | 2056 | Open in IMG/M |
| 3300006735|Ga0098038_1039576 | Not Available | 1733 | Open in IMG/M |
| 3300006735|Ga0098038_1169479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → unclassified Pelagivirus → Pelagibacter phage HTVC031P | 719 | Open in IMG/M |
| 3300006736|Ga0098033_1195811 | Not Available | 560 | Open in IMG/M |
| 3300006737|Ga0098037_1050593 | Not Available | 1496 | Open in IMG/M |
| 3300006738|Ga0098035_1017616 | All Organisms → Viruses → Predicted Viral | 2831 | Open in IMG/M |
| 3300006751|Ga0098040_1005624 | All Organisms → Viruses → Predicted Viral | 4590 | Open in IMG/M |
| 3300006752|Ga0098048_1189263 | Not Available | 609 | Open in IMG/M |
| 3300006789|Ga0098054_1324007 | Not Available | 549 | Open in IMG/M |
| 3300006916|Ga0070750_10478503 | Not Available | 512 | Open in IMG/M |
| 3300006920|Ga0070748_1096400 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1130 | Open in IMG/M |
| 3300006921|Ga0098060_1038231 | All Organisms → Viruses → Predicted Viral | 1445 | Open in IMG/M |
| 3300006921|Ga0098060_1097649 | Not Available | 833 | Open in IMG/M |
| 3300006925|Ga0098050_1096795 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → unclassified Pelagivirus → Pelagibacter phage HTVC031P | 756 | Open in IMG/M |
| 3300007276|Ga0070747_1053486 | All Organisms → Viruses → Predicted Viral | 1544 | Open in IMG/M |
| 3300007555|Ga0102817_1157012 | All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → unclassified Candidatus Omnitrophica → Candidatus Omnitrophica bacterium | 510 | Open in IMG/M |
| 3300009026|Ga0102829_1193765 | Not Available | 659 | Open in IMG/M |
| 3300009071|Ga0115566_10116952 | Not Available | 1697 | Open in IMG/M |
| 3300009193|Ga0115551_1506718 | Not Available | 514 | Open in IMG/M |
| 3300009436|Ga0115008_10132183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → unclassified Pelagivirus → Pelagibacter phage HTVC031P | 1829 | Open in IMG/M |
| 3300009495|Ga0115571_1445637 | Not Available | 500 | Open in IMG/M |
| 3300009498|Ga0115568_10179478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → unclassified Pelagivirus → Pelagibacter phage HTVC031P | 989 | Open in IMG/M |
| 3300009512|Ga0115003_10629594 | Not Available | 625 | Open in IMG/M |
| 3300009526|Ga0115004_10516554 | Not Available | 707 | Open in IMG/M |
| 3300009593|Ga0115011_10086020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → unclassified Pelagivirus → Pelagibacter phage HTVC031P | 2198 | Open in IMG/M |
| 3300009593|Ga0115011_10177302 | Not Available | 1562 | Open in IMG/M |
| 3300009593|Ga0115011_10289302 | Not Available | 1242 | Open in IMG/M |
| 3300009785|Ga0115001_10586049 | Not Available | 682 | Open in IMG/M |
| 3300010150|Ga0098056_1173230 | Not Available | 725 | Open in IMG/M |
| 3300010153|Ga0098059_1062050 | Not Available | 1494 | Open in IMG/M |
| 3300010883|Ga0133547_11440988 | Not Available | 1297 | Open in IMG/M |
| 3300011252|Ga0151674_1016025 | Not Available | 2981 | Open in IMG/M |
| 3300017697|Ga0180120_10432873 | Not Available | 514 | Open in IMG/M |
| 3300017702|Ga0181374_1068745 | Not Available | 595 | Open in IMG/M |
| 3300017709|Ga0181387_1001325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 5174 | Open in IMG/M |
| 3300017710|Ga0181403_1024776 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → unclassified Pelagivirus → Pelagibacter phage HTVC031P | 1270 | Open in IMG/M |
| 3300017713|Ga0181391_1044038 | Not Available | 1064 | Open in IMG/M |
| 3300017713|Ga0181391_1067473 | Not Available | 827 | Open in IMG/M |
| 3300017714|Ga0181412_1043371 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → unclassified Pelagivirus → Pelagibacter phage HTVC031P | 1163 | Open in IMG/M |
| 3300017714|Ga0181412_1064128 | All Organisms → Viruses | 907 | Open in IMG/M |
| 3300017714|Ga0181412_1065650 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → unclassified Pelagivirus → Pelagibacter phage HTVC031P | 893 | Open in IMG/M |
| 3300017717|Ga0181404_1015074 | All Organisms → Viruses → Predicted Viral | 2016 | Open in IMG/M |
| 3300017717|Ga0181404_1075631 | Not Available | 834 | Open in IMG/M |
| 3300017720|Ga0181383_1061026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → unclassified Pelagivirus → Pelagibacter phage HTVC031P | 1012 | Open in IMG/M |
| 3300017720|Ga0181383_1185399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → unclassified Pelagivirus → Pelagibacter phage HTVC031P | 554 | Open in IMG/M |
| 3300017724|Ga0181388_1079563 | Not Available | 782 | Open in IMG/M |
| 3300017727|Ga0181401_1038760 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 1341 | Open in IMG/M |
| 3300017731|Ga0181416_1050511 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → unclassified Pelagivirus → Pelagibacter phage HTVC031P | 980 | Open in IMG/M |
| 3300017741|Ga0181421_1022191 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → unclassified Pelagivirus → Pelagibacter phage HTVC031P | 1730 | Open in IMG/M |
| 3300017741|Ga0181421_1089621 | Not Available | 803 | Open in IMG/M |
| 3300017746|Ga0181389_1036238 | Not Available | 1484 | Open in IMG/M |
| 3300017748|Ga0181393_1166901 | Not Available | 543 | Open in IMG/M |
| 3300017751|Ga0187219_1070154 | All Organisms → Viruses | 1114 | Open in IMG/M |
| 3300017753|Ga0181407_1043952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → unclassified Pelagivirus → Pelagibacter phage HTVC031P | 1178 | Open in IMG/M |
| 3300017755|Ga0181411_1003389 | Not Available | 5626 | Open in IMG/M |
| 3300017755|Ga0181411_1015986 | All Organisms → Viruses → Predicted Viral | 2453 | Open in IMG/M |
| 3300017763|Ga0181410_1071730 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → unclassified Pelagivirus → Pelagibacter phage HTVC031P | 1032 | Open in IMG/M |
| 3300017770|Ga0187217_1021706 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 2300 | Open in IMG/M |
| 3300017773|Ga0181386_1183806 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium | 632 | Open in IMG/M |
| 3300017773|Ga0181386_1229185 | Not Available | 553 | Open in IMG/M |
| 3300017776|Ga0181394_1031316 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 1860 | Open in IMG/M |
| 3300017776|Ga0181394_1091916 | Not Available | 975 | Open in IMG/M |
| 3300017779|Ga0181395_1032841 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 1749 | Open in IMG/M |
| 3300017781|Ga0181423_1159572 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → unclassified Pelagivirus → Pelagibacter phage HTVC031P | 866 | Open in IMG/M |
| 3300017782|Ga0181380_1036395 | All Organisms → Viruses → Predicted Viral | 1791 | Open in IMG/M |
| 3300017783|Ga0181379_1107097 | All Organisms → Viruses | 1020 | Open in IMG/M |
| 3300020175|Ga0206124_10043693 | Not Available | 2006 | Open in IMG/M |
| 3300020373|Ga0211660_10041856 | Not Available | 2037 | Open in IMG/M |
| 3300020396|Ga0211687_10071416 | Not Available | 1512 | Open in IMG/M |
| 3300020421|Ga0211653_10034033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → unclassified Pelagivirus → Pelagibacter phage HTVC031P | 2351 | Open in IMG/M |
| 3300020438|Ga0211576_10293757 | Not Available | 846 | Open in IMG/M |
| 3300021957|Ga0222717_10000428 | Not Available | 36309 | Open in IMG/M |
| 3300021957|Ga0222717_10093184 | Not Available | 1889 | Open in IMG/M |
| 3300021964|Ga0222719_10460252 | Not Available | 775 | Open in IMG/M |
| 3300022061|Ga0212023_1057108 | Not Available | 542 | Open in IMG/M |
| 3300022068|Ga0212021_1000594 | Not Available | 3605 | Open in IMG/M |
| 3300024262|Ga0210003_1141930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → unclassified Pelagivirus → Pelagibacter phage HTVC031P | 1039 | Open in IMG/M |
| 3300024320|Ga0233398_1095793 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 703 | Open in IMG/M |
| 3300025078|Ga0208668_1004016 | Not Available | 3539 | Open in IMG/M |
| 3300025078|Ga0208668_1014970 | Not Available | 1626 | Open in IMG/M |
| 3300025086|Ga0208157_1030792 | All Organisms → Viruses → Predicted Viral | 1550 | Open in IMG/M |
| 3300025099|Ga0208669_1018831 | Not Available | 1800 | Open in IMG/M |
| 3300025120|Ga0209535_1006213 | All Organisms → Viruses | 7216 | Open in IMG/M |
| 3300025120|Ga0209535_1025373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → unclassified Pelagivirus → Pelagibacter phage HTVC031P | 2903 | Open in IMG/M |
| 3300025120|Ga0209535_1051536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → unclassified Pelagivirus → Pelagibacter phage HTVC031P | 1750 | Open in IMG/M |
| 3300025120|Ga0209535_1062965 | Not Available | 1500 | Open in IMG/M |
| 3300025120|Ga0209535_1064507 | All Organisms → Viruses → Predicted Viral | 1474 | Open in IMG/M |
| 3300025120|Ga0209535_1117906 | Not Available | 910 | Open in IMG/M |
| 3300025120|Ga0209535_1133274 | Not Available | 819 | Open in IMG/M |
| 3300025127|Ga0209348_1030894 | Not Available | 1923 | Open in IMG/M |
| 3300025133|Ga0208299_1196909 | Not Available | 600 | Open in IMG/M |
| 3300025138|Ga0209634_1019972 | Not Available | 3753 | Open in IMG/M |
| 3300025138|Ga0209634_1121934 | Not Available | 1111 | Open in IMG/M |
| 3300025138|Ga0209634_1129784 | Not Available | 1061 | Open in IMG/M |
| 3300025138|Ga0209634_1148020 | Not Available | 962 | Open in IMG/M |
| 3300025645|Ga0208643_1018226 | All Organisms → Viruses → Predicted Viral | 2502 | Open in IMG/M |
| 3300025849|Ga0209603_1323288 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → unclassified Pelagivirus → Pelagibacter phage HTVC031P | 531 | Open in IMG/M |
| 3300025881|Ga0209309_10130944 | Not Available | 1300 | Open in IMG/M |
| 3300027672|Ga0209383_1023984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → unclassified Pelagivirus → Pelagibacter phage HTVC031P | 2562 | Open in IMG/M |
| 3300027833|Ga0209092_10357425 | Not Available | 775 | Open in IMG/M |
| 3300027906|Ga0209404_10009244 | All Organisms → cellular organisms → Bacteria | 5442 | Open in IMG/M |
| 3300027906|Ga0209404_10284964 | Not Available | 1050 | Open in IMG/M |
| 3300028129|Ga0228634_1080183 | Not Available | 754 | Open in IMG/M |
| 3300029448|Ga0183755_1045086 | Not Available | 1155 | Open in IMG/M |
| 3300031519|Ga0307488_10572360 | Not Available | 661 | Open in IMG/M |
| 3300031566|Ga0307378_11209576 | Not Available | 597 | Open in IMG/M |
| 3300031569|Ga0307489_10059162 | Not Available | 2128 | Open in IMG/M |
| 3300031569|Ga0307489_10482947 | Not Available | 840 | Open in IMG/M |
| 3300032277|Ga0316202_10067010 | All Organisms → Viruses → Predicted Viral | 1670 | Open in IMG/M |
| 3300032277|Ga0316202_10569947 | Not Available | 533 | Open in IMG/M |
| 3300032360|Ga0315334_10391073 | Not Available | 1176 | Open in IMG/M |
| 3300033742|Ga0314858_078861 | Not Available | 824 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 39.73% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 21.92% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 6.16% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.79% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 4.79% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 4.11% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 2.05% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.05% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 1.37% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 1.37% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.37% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.37% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.37% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.37% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.68% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.68% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.68% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.68% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.68% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.68% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.68% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000148 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 47 07/07/10 100m | Environmental | Open in IMG/M |
| 3300000149 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 10m | Environmental | Open in IMG/M |
| 3300000265 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_10 | Environmental | Open in IMG/M |
| 3300001354 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001963 | Marine microbial communities from Nags Head, North Carolina, USA - GS013 | Environmental | Open in IMG/M |
| 3300002482 | Marine viral communities from the Pacific Ocean - ETNP_2_30 | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004457 | Marine viral communities from Newfoundland, Canada MC-1 | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005427 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV65 | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006090 | Marine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP124 | Environmental | Open in IMG/M |
| 3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006736 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300011252 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeate | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017702 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_10 viral metaG | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020373 | Marine microbial communities from Tara Oceans - TARA_B100000959 (ERX555949-ERR598946) | Environmental | Open in IMG/M |
| 3300020396 | Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122) | Environmental | Open in IMG/M |
| 3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024320 | Seawater microbial communities from Monterey Bay, California, United States - 38D | Environmental | Open in IMG/M |
| 3300025078 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300025881 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes) | Environmental | Open in IMG/M |
| 3300027672 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027833 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028129 | Seawater microbial communities from Monterey Bay, California, United States - 42D | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100232863 | 3300000101 | Marine | MYYIILWLSLIFGSVFSIINNEIYLSLSLFLIFAVNVAYNFNK* |
| DelMOSum2010_100980522 | 3300000101 | Marine | MLIAFWLSLILGSVISIVNNEIYLGLSIFLIFAVNVAYNFNK* |
| DelMOSum2010_102161493 | 3300000101 | Marine | KDRMLIFLWVSLLLGSIISIVNNEIYLGLSLFLLFSLNVAYNFTK* |
| DelMOSum2011_101851351 | 3300000115 | Marine | MYHIILWLTLILGSVISIINNEIYLSLSLFLIFAINVAYNFTR* |
| DelMOSum2011_102219221 | 3300000115 | Marine | MYHIILWLTLILSSVISIVNNEIFLAMSLFLIFAVNVAYNFNK* |
| DelMOSpr2010_100160953 | 3300000116 | Marine | MYHIILWLSLIFGSVFSIINNEIYLSLSLFLIFAVNVAYNFTR* |
| DelMOSpr2010_100956173 | 3300000116 | Marine | MLIFFWVSLILGSVISIVNNEIFLAMSLFLVFAVNVAYN |
| DelMOSpr2010_101448794 | 3300000116 | Marine | LIFLWVSLLLGSIISIVNNEIYLGLSLFLLFSLNVAYNFTK* |
| DelMOSpr2010_102118192 | 3300000116 | Marine | MLIFLWVSLLLGSIISIVNNEIYLGLSLFLLFAVNVAYNFTK* |
| SI47jul10_100mDRAFT_10428731 | 3300000148 | Marine | MLIAFWLSLILGSVISIVNNEIYLGLSLFLLFSLNVMYNFNK* |
| LPaug09P1610mDRAFT_10065635 | 3300000149 | Marine | MLIAFWVSLILGSVISIVNNEIYLGLSIFLIFAVNVAYNFTR* |
| LP_A_09_P04_10DRAFT_10311034 | 3300000265 | Marine | MLIAFWLSLILGSVISIVNNEIFLAMSLFLIFAVNVAYNFNK* |
| JGI20155J14468_101742252 | 3300001354 | Pelagic Marine | MYHIILWLTLILSSVISIVNNEIFLAMSIFLIFAVNVAYNFSK* |
| JGI24006J15134_100624572 | 3300001450 | Marine | MYHIILWLTLILSSVISIVNNEIFLAMSIFLIFAVNVAYNFTR* |
| JGI24006J15134_100917383 | 3300001450 | Marine | MLIFFWVSLILGSVISIVNNEIFLAMSLFLVFALNVMYNFNK* |
| JGI24006J15134_101308872 | 3300001450 | Marine | MYHIILWLSLIFGSVFSIINNEIYLSLSLFLIFAINVAYNFNK* |
| JGI24006J15134_101600792 | 3300001450 | Marine | MLIAFWLSLILGSVISIVNNEIYLGLSLFLLFSLNVAYNFNK* |
| JGI24003J15210_100561283 | 3300001460 | Marine | MLIAFWLSLILGSVISIVNNEIYLGLSIFLIFAVNVAYNFTR* |
| JGI24003J15210_100731444 | 3300001460 | Marine | LNLTTGGRMYHIILWLSLIFGSVFSIINNEIYLAMSLFLIFAVNVAYNFSK* |
| JGI24003J15210_100871252 | 3300001460 | Marine | MLIFFWVSLILGSVISIVNNEIYLGLSIFLIFAVNVAYNFTR* |
| JGI24003J15210_101633242 | 3300001460 | Marine | MLIAFWLSLILGSIISIVNNEIYLGLSLFLLFSLNVMYNFNK* |
| JGI24004J15324_100607403 | 3300001472 | Marine | MLIAFWVSLILGSVISIVNNEIYLGLSIFLIFAVNVAYNFNK* |
| JGI24004J15324_101070962 | 3300001472 | Marine | MLIAFWLSLILGSVISIVNNEIYLGLSXFLIFAVNVAYNFTR* |
| JGI24004J15324_101177662 | 3300001472 | Marine | MLIFFWLSLILGSVISIVNNEIFLAMSLFLVFALNVAYNFNK* |
| JGI24004J15324_101306611 | 3300001472 | Marine | MYHIILWLSLIFGSVISIVNNEIYLGLSIFLIFAVNVAYNFNK* |
| GOS2229_10131373 | 3300001963 | Marine | MLTTGGRMYHIILWLSLIFGSVFSMINNEIYLSLSLFLIFAVNVAYNFSK* |
| JGI25127J35165_11223411 | 3300002482 | Marine | MYYLILWLSLIFGSVITGFIFHNIFLSLLLFLIFAINVAYNFTK* |
| Ga0065861_11078051 | 3300004448 | Marine | MLIFLWVSLLLGSIISIVNNEIYLGLSLFLLFSLNVAYNFTK* |
| Ga0066224_10037529 | 3300004457 | Marine | MLIFFWVSLILGSVISIVNNEIFLAMSLFLVFALNVAYNFNK* |
| Ga0073579_16738841 | 3300005239 | Marine | MYHIILWLSLIFGSVFSIINNEIYLSLSLFLIFAINVAYNFTR* |
| Ga0066851_100170525 | 3300005427 | Marine | MYHLILWLSLILTSVFTMVNNEIYLSMSLFLIFAVNVAYNFSK* |
| Ga0075462_100395902 | 3300006027 | Aqueous | MYHIILWLSLIFGSVLSVVIFQNIFLSLLLFLIFSINVAYNFSK* |
| Ga0082015_10465273 | 3300006090 | Marine | MYHLILWLSLILGSVFALVNNEIYLSMNLFLIFAVNVAYNFSK* |
| Ga0075447_102429992 | 3300006191 | Marine | MLIAFWLSLILGSVISMVNNEIFLSMSLFLVFAVNVAYNFNK* |
| Ga0098038_10293902 | 3300006735 | Marine | MYHIILWLSLIFTSVFSLINNEIYLSLSLFLIFAINIAYNFTR* |
| Ga0098038_10395762 | 3300006735 | Marine | MYHIILWLSLIFGSVFSIINNEIYLALSLFLIFAVNIAYNFTR* |
| Ga0098038_11694791 | 3300006735 | Marine | KMYHIILWLSLIFTSIFAIINNEIYLSLSLFLIFAINVAYNFTR* |
| Ga0098033_11958113 | 3300006736 | Marine | MYHLILWLSLIFGSLISIVNNEIYLGMSLFLIFAVNVAYNFSK* |
| Ga0098037_10505932 | 3300006737 | Marine | MYHIILWLSLIFTSVFSLINNEIYLSLSLFLIFAINVAYNFTR* |
| Ga0098035_10176162 | 3300006738 | Marine | MYHLILWLSLILTSVFAMVNNEIYLSMSLFLIFAVNVAYNFSK* |
| Ga0098040_10056241 | 3300006751 | Marine | KMYHLILWLSLILTSVFAMVNNEIYLSMSLFLIFAVNVAYNFSK* |
| Ga0098048_11892633 | 3300006752 | Marine | MYHIILWLSLIFTSVFSIINNEIYLSLSLFLIFAINVAYNFTR* |
| Ga0098054_13240071 | 3300006789 | Marine | MYHIILWLSLIFTSIFAIINNEIYLSLSLFLIFAINVAYNFTR* |
| Ga0070750_104785032 | 3300006916 | Aqueous | MYHIILWLSLIFGSVLSVVIFQNIFLSLLLFLIFSINVAY |
| Ga0070748_10964002 | 3300006920 | Aqueous | MLIFFWVSLILGSVISIVNNEIYLGLSLFLLFSLNVAYNFNK* |
| Ga0098060_10382312 | 3300006921 | Marine | MYHIILWLTLIFGSVISIVNNEIYLSLSLFLIFAVNVAYNFSK* |
| Ga0098060_10976494 | 3300006921 | Marine | LWLSLIFTSVFSLINNEIYLSLSLFLIFAINVAYNFTR* |
| Ga0098050_10967953 | 3300006925 | Marine | HIILWLSLIFTSVFSLINNEIYLSLSLFLIFAINVAYNFTR* |
| Ga0070747_10534862 | 3300007276 | Aqueous | MYHIILWLTLVLGSVISIVNNEIFLAMSIFLIFAVNVAYNFNK* |
| Ga0102817_11570122 | 3300007555 | Estuarine | GGRMLIAFWVSLILGSVISIVNNEIYLGLSIFLIFAVNVAYNFTR* |
| Ga0102829_11937652 | 3300009026 | Estuarine | MLIAFWLSLILGSVISIVNNEIFLAMSLFLIFTVNVAYNFNK* |
| Ga0115566_101169524 | 3300009071 | Pelagic Marine | MLIFFWVSLILGSVISIVNNEIFLAMSLFLVFAVNVAYNFNK* |
| Ga0115551_15067182 | 3300009193 | Pelagic Marine | MLIFFWVSLILGSVISIVNNEIYLSLSLFLIFAVNVAYNFTR* |
| Ga0115008_101321835 | 3300009436 | Marine | MLIAFWLSLILGSVISIVNNEIFLAMSLFLVFALNVAYNFNK* |
| Ga0115571_14456371 | 3300009495 | Pelagic Marine | SLLLGSIISIVNNEIYLGLSLFLLFSLNVAYNFTK* |
| Ga0115568_101794783 | 3300009498 | Pelagic Marine | MLIAFWLSLILGSVISIVNNEIFLAMSLFLVFAVNVAYNFNK* |
| Ga0115003_106295941 | 3300009512 | Marine | MLIFFWVSLILGSVISIVNNEIFLGLSLFLLFSLNVMYNFNK* |
| Ga0115004_105165542 | 3300009526 | Marine | MLIFFWVSLILGSVISIVNNEIYLGLSLFLLFSLNVMYNFNK* |
| Ga0115011_100860207 | 3300009593 | Marine | MYHIILWLSLIFGSVLSVVIFQNVFLSLLLFLIFSINVAYNFSK* |
| Ga0115011_101773024 | 3300009593 | Marine | MYHIILWLSLIFASVFAMVNNEIYLSLSLFLIFAVNVAYNFTR* |
| Ga0115011_102893022 | 3300009593 | Marine | MYHIILWLSLILASVFAMVNNEIYLSLSLFLIFAVNVAYNFTR* |
| Ga0115001_105860492 | 3300009785 | Marine | MLIAFWVSLILGSVISIVNNEIYLGLSLFLLFSLNVMYNFNK* |
| Ga0098056_11732302 | 3300010150 | Marine | MYHIILWLSLIFGSVFSIINNEIYLSLSLFLIFAINVAY |
| Ga0098059_10620501 | 3300010153 | Marine | MYHIILWVSLIFGSVFSMINNEIYLAMSLFLIFAVNVAYNFTR* |
| Ga0133547_114409882 | 3300010883 | Marine | MYHIILWLTLILTSIISIVNNEIFLAMSIFLIFAVNVAYNFNK* |
| Ga0151674_10160256 | 3300011252 | Marine | MYHIILWLSLIFGSVFSIINNEIYLSLSLFLIFAINIAYNFTR* |
| Ga0180120_104328731 | 3300017697 | Freshwater To Marine Saline Gradient | TTGGRMYHIILWLTLILGSVISIINNEIYLSLSLFLIFAINVAYNFTR |
| Ga0181374_10687452 | 3300017702 | Marine | MYHLILWLSLILGSVFALVNNEIYLGMSLFLIFAVNVAYNFSK |
| Ga0181387_10013251 | 3300017709 | Seawater | MYHIILWLSLIFGSVFSMINNEIYLSLSLFLIFAVNVAYNFSE |
| Ga0181403_10247765 | 3300017710 | Seawater | MYHIILWLSVIFGSVFSIINNEIYLAMSLFLIFAVNVAYNFTR |
| Ga0181391_10440384 | 3300017713 | Seawater | LFETITTGGXMLIAFWLSLILGSVISIVNNEIFLSLSLFLVFALNVAYNFNK |
| Ga0181391_10674731 | 3300017713 | Seawater | MYHIILWLSLIFASVFAMVNNEIYLSLSLFLIFAINVAY |
| Ga0181412_10433711 | 3300017714 | Seawater | HIILWLSLIFGSVFSIINNEIYLALSLFLIFAVNVAYNFSK |
| Ga0181412_10641284 | 3300017714 | Seawater | IILWLSLIFGSVFSIINNEIYLSLSLFLIFAINVAYNFSK |
| Ga0181412_10656501 | 3300017714 | Seawater | TTGGRMYHIILWLSLIFGSVFSIINNEIYLSLSLFLIFAINVAYNFTR |
| Ga0181404_10150741 | 3300017717 | Seawater | FHLIGLIFVITTGGRMYHIILWLSLIFGSVFSIINNEIYLAMSLFLIFAVNVAYNFNK |
| Ga0181404_10756311 | 3300017717 | Seawater | MYHIILWLSLIFGSVLSVVIFQNIFLSLLLFLIFSIN |
| Ga0181383_10610262 | 3300017720 | Seawater | MYHIILWLSLIFGSVFSIINNEIYLALSLFLIFAVNVAYNFSE |
| Ga0181383_11853991 | 3300017720 | Seawater | TTGGRMYHIILWLSLIFGSVFSIINNEIYLSLSLFLIFAINVAYNFTK |
| Ga0181388_10795631 | 3300017724 | Seawater | TGGRMYHIILWLSLIFGSVFSIINNEIYLSLSLFLIFAINVAYNFSK |
| Ga0181401_10387602 | 3300017727 | Seawater | MYHIILWLTLILSSVISIVNNEIYLAMSLFLIFAVNVAYNFNK |
| Ga0181416_10505114 | 3300017731 | Seawater | WRLKMYHIILWLSLIFGSVFSIINHEIYLALSLFLIFAVNVAYNFSK |
| Ga0181421_10221912 | 3300017741 | Seawater | MYYIILWLSLIFASVFAMVNNEIYLSLSLFLIFAINVAYNFTK |
| Ga0181421_10896212 | 3300017741 | Seawater | MYHIILWLSLIFASVFAMVNNEIYLSLSLFLIFAINVAYNFTR |
| Ga0181389_10362384 | 3300017746 | Seawater | MYHIILWLSLIFGSVFSIINNEIYLSLSLFLIFAINVAYNFSK |
| Ga0181393_11669012 | 3300017748 | Seawater | MYHIILWLSLIFGSVFSIINNEIYLSLSLFLIFAINLAYNFT |
| Ga0187219_10701541 | 3300017751 | Seawater | YHIILWLSLIFGSVFSIINNEIYLSLSLFLIFAINVAYNFSK |
| Ga0181407_10439521 | 3300017753 | Seawater | NWRLKMYHIILWLSLIFGSVFSIINNEIYLALSLFLIFAVNVAYNFSK |
| Ga0181411_10033894 | 3300017755 | Seawater | MYYIILWLSLIFGSVFSIINNEIYLSLSLFLIFAINVAYNFTK |
| Ga0181411_10159861 | 3300017755 | Seawater | MYHIILWLSLIFGSVFSIINNEIYLALILILIFAVNVAYNYSK |
| Ga0181410_10717304 | 3300017763 | Seawater | LSLIFGSVFSIINNEIYLALSLFLIFAVNVAYNFSK |
| Ga0187217_10217066 | 3300017770 | Seawater | MYHIILWLSLIFGSVFSIINNEIYLAMSLFLIFAVNVAYNFTR |
| Ga0181386_11838061 | 3300017773 | Seawater | HIILWLSLIFGSVFSIINNEIYLSLSLFLIFAVNVAYNFSK |
| Ga0181386_12291851 | 3300017773 | Seawater | WLSLIFGSVFSIINNEIYLSLSLFLIFAINVAYNFNK |
| Ga0181394_10313164 | 3300017776 | Seawater | MYHIILWLSLIFGSVFSIINNEIYLAMSLFLIFAVNVAYNFNK |
| Ga0181394_10919161 | 3300017776 | Seawater | MYHIILWLSLIFGSVFSIINNEIYLSLSLFLIFAINVAYN |
| Ga0181395_10328411 | 3300017779 | Seawater | IGLIFVITTGGRMYHIILWLSLIFGSVFSIINNEIYLAMSLFLIFAVNVAYNFNK |
| Ga0181423_11595724 | 3300017781 | Seawater | IILWLSLIFGSVFSIINNEIYLSLSLFLIFAINVAYNFTK |
| Ga0181380_10363956 | 3300017782 | Seawater | TTGGRMYHIILWLSLIFGSVFSIINNEIYLSLSLFLIFAINVAYNFSK |
| Ga0181379_11070974 | 3300017783 | Seawater | SYHIILWLRLSFGSVFSIINNEIYLSLSLFLIFAINVAYNFSK |
| Ga0206124_100436932 | 3300020175 | Seawater | MYHIILWLSLIFGSVFSIINNEIYLSLSLFLIFAVNVAYNFTR |
| Ga0211660_100418566 | 3300020373 | Marine | MYHLILWLSLILTSVFAMVNNEIYLSMSLFLIFAVNVAYNFSK |
| Ga0211687_100714163 | 3300020396 | Marine | MLIAFWLSLILGSVISIVNNEIFLAMGLFLIFAVNVAYNFNK |
| Ga0211653_100340333 | 3300020421 | Marine | MYYIILWLSLIFGSVLSVVIFQNIFLSLLLFLIFSINVAYNFSK |
| Ga0211576_102937573 | 3300020438 | Marine | MLIAFWLSLILGSVISIVNNEIFLSLSLFLVFALNVMYNFNK |
| Ga0222717_1000042820 | 3300021957 | Estuarine Water | MYHIILWLSLIFGSVFSIINNEIYLSLSLFLIFAINVAYNFTK |
| Ga0222717_100931842 | 3300021957 | Estuarine Water | MLIAFWLSLILGSVISIVNNEIFLSLSLFLVFALNVAYNFNK |
| Ga0222719_104602522 | 3300021964 | Estuarine Water | MLIFLWVSLLLGSIISIVNNEIYLGLSLFLLFAVNVAYNFTK |
| Ga0212023_10571081 | 3300022061 | Aqueous | MLIFFWVSLILGSVISIVNNEIYLGLSLFLLFSLNVAY |
| Ga0212021_10005945 | 3300022068 | Aqueous | MYHIILWLSLIFGSVLSVVIFQNIFLSLLLFLIFSINVAYNFSK |
| Ga0210003_11419302 | 3300024262 | Deep Subsurface | MLIFLWVSLLLGSIISIVNNEIYLGLSLFLLFSLNVAYNFTK |
| Ga0233398_10957933 | 3300024320 | Seawater | NLTTGGRMYHIILWLSLIFGSVFSIINNEIYLSLSLFLIFAINVAYNFSK |
| Ga0208668_10040163 | 3300025078 | Marine | MYHLILWLSLIFGSLISIVNNEIYLGMSLFLIFAVNVAYNFSK |
| Ga0208668_10149702 | 3300025078 | Marine | MYHLILWLSLILGSVFALVNNEIYLSMNLFLIFAVNVAYNFSK |
| Ga0208157_10307924 | 3300025086 | Marine | MYHIILWLSLIFTSVFSLINNEIYLSLSLFLIFAINVAYNFTR |
| Ga0208669_10188312 | 3300025099 | Marine | MYHIILWLTLIFGSVISIVNNEIYLSLSLFLIFAVNVAYNFSK |
| Ga0209535_10062133 | 3300025120 | Marine | MLIAFWLSLILGSVISIVNNEIYLGLSLFLLFSLNVMYNFNK |
| Ga0209535_10253739 | 3300025120 | Marine | MYHIILWLSLIFGSVFSIINNEIYLAMSLFLIFAVNVAYNFSK |
| Ga0209535_10515362 | 3300025120 | Marine | MYHIILWLSLIFGSVFSIINNEIYLSLSLFLIFAINVAYNFNK |
| Ga0209535_10629653 | 3300025120 | Marine | MYHIILWLTLILSSVISIVNNEIFLAMSIFLIFAVNVAYNFTR |
| Ga0209535_10645071 | 3300025120 | Marine | MYHIILWLTLILSSVISVVNNEIFLGLSIFLIFAVNVAYNFTR |
| Ga0209535_11179062 | 3300025120 | Marine | MLIAFWLSLILGSVISIVNNEIYLGLSLFLLFSLNVAYNFNK |
| Ga0209535_11332742 | 3300025120 | Marine | MLIFFWVSLILGSVISIVNNEIYLGLSIFLIFAVNVAYNFTR |
| Ga0209348_10308942 | 3300025127 | Marine | MYYLILWLSLIFGSVITGFIFHNIFLSLLLFLIFAINVAYNFTK |
| Ga0208299_11969092 | 3300025133 | Marine | LSLIFGSLISIVNNEIYLGMSLFLIFAVNVAYNFSR |
| Ga0209634_10199722 | 3300025138 | Marine | MLIAFWLSLILGSVISIVNNEIYLGLSIFLIFAVNVAYNFNK |
| Ga0209634_11219343 | 3300025138 | Marine | MLIFFWVSLILGSVISIVNNEIFLAMSLFLVFALNVMYNFNK |
| Ga0209634_11297843 | 3300025138 | Marine | MIQAQINLLILGSVISIVNNEIFLSLSLFLVFAVNVAYNFNK |
| Ga0209634_11480203 | 3300025138 | Marine | MLIAFWVSLILGSVISIVNNEIYLGLSIFLIFAVNVAYNFNK |
| Ga0208643_10182263 | 3300025645 | Aqueous | MLIFFWVSLILGSVISIVNNEIYLGLSLFLLFSLNVAYNFNK |
| Ga0209603_13232881 | 3300025849 | Pelagic Marine | MLIFLWVSLLLGSIISIVNNEIYLGLSLFLLFSLNVAYNFT |
| Ga0209309_101309443 | 3300025881 | Pelagic Marine | MLIFFWVSLILGSVISIVNNEIFLAMSLFLVFAVNVAYNFNK |
| Ga0209383_10239848 | 3300027672 | Marine | MLIAFWLSLILGSVISMVNNEIFLSMSLFLVFAVNVAYNFNK |
| Ga0209092_103574251 | 3300027833 | Marine | SLILGSVISIVNNEIFLAMSLFLVFALNVAYNFNK |
| Ga0209404_1000924420 | 3300027906 | Marine | MYHIILWLSLIFASVFAMVNNEIYLSLSLFLIFAVNVAYNFTR |
| Ga0209404_102849642 | 3300027906 | Marine | MYHIILWLSLIFASVFAMINNEIYLSLSLFLIFAVNVAYNFTR |
| Ga0228634_10801831 | 3300028129 | Seawater | MYHIILWLSLIFGSVFSIINNEIYLSLSLFLIFAINVAYNF |
| Ga0183755_10450863 | 3300029448 | Marine | MYHIILWVSLILASVFAMVNNEIYLSLSLFLIFAVNVAYNFSE |
| Ga0307488_105723603 | 3300031519 | Sackhole Brine | MLIFFWVSLLLGSIISIVNNEIYLGLSLFLLFAVNV |
| Ga0307378_112095761 | 3300031566 | Soil | MLIFFWVSLLLGSIISIVNNEIYLGLSLFLLFSLNVAYNFTK |
| Ga0307489_100591626 | 3300031569 | Sackhole Brine | MLIAFWLSLILGSIISIVNNEIYLGLSLFLLFSLNVMYNFNK |
| Ga0307489_104829471 | 3300031569 | Sackhole Brine | MLIFFWVSLILGSVISIVNNEIYLGLSLFLLFSLNVMYN |
| Ga0316202_100670104 | 3300032277 | Microbial Mat | VWLENNNNTTGGRMYHIILWLTLILSSVISIVNNEIFLAMSIFLIFAVNVAYNFNK |
| Ga0316202_105699472 | 3300032277 | Microbial Mat | MYHIILWLSLIFGSVFSIINNEIYLSLSLFLIFAVNVAYNFTK |
| Ga0315334_103910731 | 3300032360 | Seawater | MYHIILWLSLIFGSLISIVNNEIYLGMSLFLIFAVNVAYNFSK |
| Ga0314858_078861_693_824 | 3300033742 | Sea-Ice Brine | RMLIFLWVSLLLGSIISIVNNEIYLGLSLFLLFSLNVAYNFTK |
| ⦗Top⦘ |