


| Basic Information | |
|---|---|
| Family ID | F049638 |
| Family Type | Metagenome |
| Number of Sequences | 146 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MKAKEIMEKYNITRNTLSNWVKKGWIKVEKTPSGRYIYIDKK |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 146 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 18.49 % |
| % of genes from short scaffolds (< 2000 bps) | 56.85 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (44.521 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (15.753 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.726 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (66.438 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.71% β-sheet: 14.29% Coil/Unstructured: 60.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 146 Family Scaffolds |
|---|---|---|
| PF07460 | NUMOD3 | 10.27 |
| PF01541 | GIY-YIG | 6.85 |
| PF13307 | Helicase_C_2 | 2.05 |
| PF13469 | Sulfotransfer_3 | 2.05 |
| PF05343 | Peptidase_M42 | 2.05 |
| PF01555 | N6_N4_Mtase | 1.37 |
| PF00149 | Metallophos | 1.37 |
| PF01743 | PolyA_pol | 1.37 |
| PF13589 | HATPase_c_3 | 1.37 |
| PF05265 | DUF723 | 1.37 |
| PF00773 | RNB | 0.68 |
| PF04984 | Phage_sheath_1 | 0.68 |
| PF04536 | TPM_phosphatase | 0.68 |
| PF04851 | ResIII | 0.68 |
| PF01121 | CoaE | 0.68 |
| PF00499 | Oxidored_q3 | 0.68 |
| PF13783 | DUF4177 | 0.68 |
| PF02709 | Glyco_transf_7C | 0.68 |
| PF12651 | RHH_3 | 0.68 |
| PF13597 | NRDD | 0.68 |
| PF13385 | Laminin_G_3 | 0.68 |
| PF02086 | MethyltransfD12 | 0.68 |
| PF05731 | TROVE | 0.68 |
| PF07068 | Gp23 | 0.68 |
| PF13528 | Glyco_trans_1_3 | 0.68 |
| PF13671 | AAA_33 | 0.68 |
| PF00004 | AAA | 0.68 |
| PF16898 | TOPRIM_C | 0.68 |
| PF00685 | Sulfotransfer_1 | 0.68 |
| PF02146 | SIR2 | 0.68 |
| PF00291 | PALP | 0.68 |
| PF01583 | APS_kinase | 0.68 |
| PF03641 | Lysine_decarbox | 0.68 |
| PF01844 | HNH | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 146 Family Scaffolds |
|---|---|---|---|
| COG1362 | Aspartyl aminopeptidase | Amino acid transport and metabolism [E] | 2.05 |
| COG1363 | Putative aminopeptidase FrvX | Carbohydrate transport and metabolism [G] | 2.05 |
| COG2195 | Di- or tripeptidase | Amino acid transport and metabolism [E] | 2.05 |
| COG0617 | tRNA nucleotidyltransferase/poly(A) polymerase | Translation, ribosomal structure and biogenesis [J] | 1.37 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 1.37 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 1.37 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 1.37 |
| COG0237 | Dephospho-CoA kinase | Coenzyme transport and metabolism [H] | 0.68 |
| COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 0.68 |
| COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 0.68 |
| COG0557 | Exoribonuclease R | Transcription [K] | 0.68 |
| COG0839 | NADH:ubiquinone oxidoreductase subunit 6 (chain J) | Energy production and conversion [C] | 0.68 |
| COG0846 | NAD-dependent protein deacetylase, SIR2 family | Posttranslational modification, protein turnover, chaperones [O] | 0.68 |
| COG1611 | Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family | Nucleotide transport and metabolism [F] | 0.68 |
| COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 0.68 |
| COG3497 | Phage tail sheath protein FI | Mobilome: prophages, transposons [X] | 0.68 |
| COG4776 | Exoribonuclease II | Transcription [K] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 55.48 % |
| Unclassified | root | N/A | 44.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000230|TB_GS10_10DRAFT_10047873 | All Organisms → Viruses → Predicted Viral | 1971 | Open in IMG/M |
| 3300000439|TBL_comb48_EPIDRAFT_1043086 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 1705 | Open in IMG/M |
| 3300002141|M3t6BS1_1772085 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
| 3300002835|B570J40625_100420290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1290 | Open in IMG/M |
| 3300002835|B570J40625_101570363 | Not Available | 538 | Open in IMG/M |
| 3300003852|Ga0031655_10391840 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300005582|Ga0049080_10035501 | All Organisms → cellular organisms → Bacteria | 1736 | Open in IMG/M |
| 3300005584|Ga0049082_10133430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 865 | Open in IMG/M |
| 3300006056|Ga0075163_10001360 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 32779 | Open in IMG/M |
| 3300006056|Ga0075163_11111207 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 799 | Open in IMG/M |
| 3300006117|Ga0007818_1035160 | Not Available | 972 | Open in IMG/M |
| 3300006484|Ga0070744_10000209 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 15924 | Open in IMG/M |
| 3300006484|Ga0070744_10001823 | All Organisms → cellular organisms → Bacteria | 6426 | Open in IMG/M |
| 3300006805|Ga0075464_10026342 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 3059 | Open in IMG/M |
| 3300006805|Ga0075464_10060326 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 2117 | Open in IMG/M |
| 3300006805|Ga0075464_10186599 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1228 | Open in IMG/M |
| 3300006805|Ga0075464_10600505 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300007169|Ga0102976_1028873 | All Organisms → cellular organisms → Bacteria | 1633 | Open in IMG/M |
| 3300007516|Ga0105050_10001203 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 39268 | Open in IMG/M |
| 3300007559|Ga0102828_1167536 | Not Available | 555 | Open in IMG/M |
| 3300008114|Ga0114347_1000545 | All Organisms → Viruses | 46186 | Open in IMG/M |
| 3300008119|Ga0114354_1102185 | Not Available | 1134 | Open in IMG/M |
| 3300008999|Ga0102816_1272943 | Not Available | 535 | Open in IMG/M |
| 3300009068|Ga0114973_10002759 | Not Available | 12599 | Open in IMG/M |
| 3300009068|Ga0114973_10049386 | Not Available | 2487 | Open in IMG/M |
| 3300009151|Ga0114962_10000918 | All Organisms → Viruses | 25525 | Open in IMG/M |
| 3300009151|Ga0114962_10004367 | Not Available | 11263 | Open in IMG/M |
| 3300009151|Ga0114962_10049150 | Not Available | 2785 | Open in IMG/M |
| 3300009151|Ga0114962_10069773 | Not Available | 2254 | Open in IMG/M |
| 3300009155|Ga0114968_10040881 | Not Available | 3041 | Open in IMG/M |
| 3300009159|Ga0114978_10059347 | All Organisms → Viruses → Predicted Viral | 2607 | Open in IMG/M |
| 3300009159|Ga0114978_10085547 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2104 | Open in IMG/M |
| 3300009163|Ga0114970_10439047 | Not Available | 720 | Open in IMG/M |
| 3300009169|Ga0105097_10324749 | Not Available | 851 | Open in IMG/M |
| 3300009183|Ga0114974_10084561 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 2062 | Open in IMG/M |
| 3300009184|Ga0114976_10007916 | All Organisms → cellular organisms → Bacteria | 6610 | Open in IMG/M |
| 3300009480|Ga0127405_1210904 | Not Available | 524 | Open in IMG/M |
| 3300009502|Ga0114951_10000404 | Not Available | 61400 | Open in IMG/M |
| 3300009502|Ga0114951_10056035 | All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon | 2360 | Open in IMG/M |
| 3300009502|Ga0114951_10069240 | Not Available | 2071 | Open in IMG/M |
| 3300009648|Ga0116175_1102777 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 1000 | Open in IMG/M |
| 3300009648|Ga0116175_1108315 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 968 | Open in IMG/M |
| 3300009666|Ga0116182_1008816 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 7908 | Open in IMG/M |
| 3300009696|Ga0116177_10389200 | Not Available | 735 | Open in IMG/M |
| 3300009710|Ga0116192_1012860 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 3955 | Open in IMG/M |
| 3300009710|Ga0116192_1024939 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 2498 | Open in IMG/M |
| 3300009710|Ga0116192_1078136 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Myoviridae sp. ctNQV2 | 1171 | Open in IMG/M |
| 3300009710|Ga0116192_1100974 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus | 994 | Open in IMG/M |
| 3300009716|Ga0116191_1022653 | All Organisms → cellular organisms → Bacteria | 3546 | Open in IMG/M |
| 3300009769|Ga0116184_10310777 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 673 | Open in IMG/M |
| 3300010338|Ga0116245_10314319 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 823 | Open in IMG/M |
| 3300010340|Ga0116250_10088583 | All Organisms → Viruses → Predicted Viral | 2067 | Open in IMG/M |
| 3300010340|Ga0116250_10563104 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 638 | Open in IMG/M |
| 3300010357|Ga0116249_10198041 | All Organisms → Viruses → Predicted Viral | 1868 | Open in IMG/M |
| 3300010412|Ga0136852_10166933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Myoviridae sp. ctNQV2 | 2218 | Open in IMG/M |
| 3300010885|Ga0133913_10243014 | All Organisms → Viruses | 4782 | Open in IMG/M |
| 3300010885|Ga0133913_13631056 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1001 | Open in IMG/M |
| 3300012533|Ga0138256_10165360 | Not Available | 2016 | Open in IMG/M |
| 3300012533|Ga0138256_10308975 | Not Available | 1344 | Open in IMG/M |
| 3300012533|Ga0138256_10618604 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 857 | Open in IMG/M |
| 3300012956|Ga0154020_10567748 | Not Available | 935 | Open in IMG/M |
| 3300013093|Ga0164296_1329294 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 569 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10006949 | Not Available | 13114 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10008023 | Not Available | 11910 | Open in IMG/M |
| 3300014204|Ga0172381_10015766 | Not Available | 7006 | Open in IMG/M |
| 3300014204|Ga0172381_11009175 | Not Available | 614 | Open in IMG/M |
| 3300017754|Ga0181344_1000267 | Not Available | 21221 | Open in IMG/M |
| 3300017788|Ga0169931_10497055 | Not Available | 861 | Open in IMG/M |
| 3300017788|Ga0169931_10933522 | Not Available | 544 | Open in IMG/M |
| 3300017989|Ga0180432_11171939 | Not Available | 516 | Open in IMG/M |
| 3300020048|Ga0207193_1001088 | Not Available | 48999 | Open in IMG/M |
| 3300020048|Ga0207193_1049887 | All Organisms → cellular organisms → Bacteria | 4405 | Open in IMG/M |
| 3300020048|Ga0207193_1108033 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 2500 | Open in IMG/M |
| 3300020048|Ga0207193_1762810 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 626 | Open in IMG/M |
| 3300020159|Ga0211734_10487734 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus | 1587 | Open in IMG/M |
| 3300020160|Ga0211733_10686444 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 23640 | Open in IMG/M |
| 3300020162|Ga0211735_11209086 | Not Available | 20052 | Open in IMG/M |
| 3300020205|Ga0211731_10451437 | All Organisms → Viruses | 59377 | Open in IMG/M |
| 3300021139|Ga0214166_1009230 | All Organisms → cellular organisms → Bacteria | 2887 | Open in IMG/M |
| 3300021140|Ga0214168_1089906 | Not Available | 669 | Open in IMG/M |
| 3300021142|Ga0214192_1050876 | Not Available | 1282 | Open in IMG/M |
| 3300021963|Ga0222712_10667370 | Not Available | 590 | Open in IMG/M |
| 3300022555|Ga0212088_10000625 | Not Available | 80460 | Open in IMG/M |
| 3300022555|Ga0212088_10105891 | Not Available | 2557 | Open in IMG/M |
| 3300022555|Ga0212088_10494960 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300023174|Ga0214921_10490419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium → Clostridium cuniculi | 589 | Open in IMG/M |
| 3300023174|Ga0214921_10551460 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 530 | Open in IMG/M |
| 3300023184|Ga0214919_10018350 | All Organisms → cellular organisms → Bacteria | 7975 | Open in IMG/M |
| 3300023184|Ga0214919_10153270 | Not Available | 1824 | Open in IMG/M |
| 3300023184|Ga0214919_10687328 | Not Available | 583 | Open in IMG/M |
| 3300024346|Ga0244775_10000416 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 52910 | Open in IMG/M |
| 3300024346|Ga0244775_10015426 | Not Available | 7093 | Open in IMG/M |
| 3300025383|Ga0208250_1064116 | Not Available | 513 | Open in IMG/M |
| 3300025451|Ga0208426_1003932 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 2090 | Open in IMG/M |
| 3300025597|Ga0208825_1006963 | Not Available | 5441 | Open in IMG/M |
| 3300025597|Ga0208825_1025514 | All Organisms → Viruses → Predicted Viral | 1963 | Open in IMG/M |
| 3300025597|Ga0208825_1080743 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus | 807 | Open in IMG/M |
| 3300025678|Ga0208695_1001030 | Not Available | 25087 | Open in IMG/M |
| 3300025678|Ga0208695_1016033 | All Organisms → cellular organisms → Bacteria | 3579 | Open in IMG/M |
| 3300025713|Ga0208195_1029469 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 2601 | Open in IMG/M |
| 3300025877|Ga0208460_10175235 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 841 | Open in IMG/M |
| 3300025896|Ga0208916_10044072 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 1820 | Open in IMG/M |
| 3300025896|Ga0208916_10098320 | Not Available | 1236 | Open in IMG/M |
| 3300025896|Ga0208916_10216634 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 830 | Open in IMG/M |
| 3300027320|Ga0208923_1011474 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 1553 | Open in IMG/M |
| 3300027586|Ga0208966_1113962 | Not Available | 735 | Open in IMG/M |
| 3300027608|Ga0208974_1141044 | Not Available | 618 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1137901 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1315142 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300027732|Ga0209442_1305119 | Not Available | 547 | Open in IMG/M |
| 3300027734|Ga0209087_1069753 | Not Available | 1550 | Open in IMG/M |
| 3300027734|Ga0209087_1184721 | Not Available | 811 | Open in IMG/M |
| 3300027736|Ga0209190_1035866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2621 | Open in IMG/M |
| 3300027749|Ga0209084_1031457 | All Organisms → cellular organisms → Bacteria | 2721 | Open in IMG/M |
| 3300027749|Ga0209084_1043945 | Not Available | 2194 | Open in IMG/M |
| 3300027749|Ga0209084_1066764 | Not Available | 1672 | Open in IMG/M |
| 3300027759|Ga0209296_1002714 | Not Available | 12476 | Open in IMG/M |
| 3300027759|Ga0209296_1151410 | Not Available | 1043 | Open in IMG/M |
| 3300027772|Ga0209768_10268523 | Not Available | 731 | Open in IMG/M |
| 3300027817|Ga0209112_10072851 | Not Available | 1078 | Open in IMG/M |
| 3300027896|Ga0209777_10057618 | All Organisms → cellular organisms → Bacteria | 3471 | Open in IMG/M |
| 3300027963|Ga0209400_1085574 | All Organisms → cellular organisms → Bacteria → PVC group | 1507 | Open in IMG/M |
| 3300027976|Ga0209702_10001555 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 43573 | Open in IMG/M |
| (restricted) 3300028564|Ga0255344_1096995 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 1345 | Open in IMG/M |
| (restricted) 3300028567|Ga0255342_1033795 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 3050 | Open in IMG/M |
| 3300028633|Ga0302236_1098627 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 620 | Open in IMG/M |
| (restricted) 3300028677|Ga0255346_1129060 | Not Available | 1099 | Open in IMG/M |
| 3300028734|Ga0302206_1000004 | All Organisms → Viruses → Varidnaviria → Bamfordvirae → Nucleocytoviricota → Megaviricetes → Imitervirales → Mimiviridae | 185695 | Open in IMG/M |
| 3300028738|Ga0302292_1275857 | Not Available | 530 | Open in IMG/M |
| 3300028864|Ga0302215_10280642 | Not Available | 615 | Open in IMG/M |
| (restricted) 3300029268|Ga0247842_10194957 | Not Available | 1142 | Open in IMG/M |
| 3300029288|Ga0265297_10007939 | Not Available | 14430 | Open in IMG/M |
| 3300029983|Ga0302284_1106238 | Not Available | 877 | Open in IMG/M |
| 3300030019|Ga0311348_11150152 | Not Available | 577 | Open in IMG/M |
| 3300031209|Ga0307955_1001571 | All Organisms → Viruses | 9953 | Open in IMG/M |
| 3300031521|Ga0311364_10097356 | Not Available | 3083 | Open in IMG/M |
| 3300031521|Ga0311364_10268351 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → unclassified Ignavibacteriota → Ignavibacteria bacterium ADurb.Bin266 | 1742 | Open in IMG/M |
| 3300031726|Ga0302321_103492441 | Not Available | 511 | Open in IMG/M |
| 3300032046|Ga0315289_10677480 | Not Available | 940 | Open in IMG/M |
| 3300032053|Ga0315284_10682156 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 1210 | Open in IMG/M |
| 3300032053|Ga0315284_11124280 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon ADurb.Bin336 | 871 | Open in IMG/M |
| 3300032117|Ga0316218_1101560 | Not Available | 1127 | Open in IMG/M |
| 3300032177|Ga0315276_11660020 | Not Available | 661 | Open in IMG/M |
| 3300034022|Ga0335005_0461296 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 715 | Open in IMG/M |
| 3300034073|Ga0310130_0021757 | All Organisms → cellular organisms → Bacteria | 2040 | Open in IMG/M |
| 3300034105|Ga0335035_0022367 | All Organisms → cellular organisms → Bacteria | 4219 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 15.75% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 14.38% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.27% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.48% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 5.48% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.79% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.11% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.74% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.74% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 2.74% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.74% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 2.05% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 2.05% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.05% |
| Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 2.05% |
| Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 2.05% |
| Wastewater | Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater | 2.05% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.37% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.37% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.37% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 1.37% |
| Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 1.37% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.68% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.68% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.68% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater | 0.68% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.68% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.68% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.68% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.68% |
| Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 0.68% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.68% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.68% |
| Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 0.68% |
| Activated Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Activated Sludge | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000230 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- GS10_10 | Environmental | Open in IMG/M |
| 3300000439 | Trout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
| 3300002141 | M3t6BS1 (103f) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003852 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300006056 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 1A DNA | Engineered | Open in IMG/M |
| 3300006117 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE08Jun09 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007169 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projects | Environmental | Open in IMG/M |
| 3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
| 3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009480 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 10m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
| 3300009648 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC125_MetaG | Engineered | Open in IMG/M |
| 3300009666 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG | Engineered | Open in IMG/M |
| 3300009696 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC10_MetaG | Engineered | Open in IMG/M |
| 3300009710 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC113_MetaG | Engineered | Open in IMG/M |
| 3300009716 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC111_MetaG | Engineered | Open in IMG/M |
| 3300009769 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA5_MetaG | Engineered | Open in IMG/M |
| 3300010338 | AD_JPMRca | Engineered | Open in IMG/M |
| 3300010340 | AD_USOAca | Engineered | Open in IMG/M |
| 3300010357 | AD_USSTca | Engineered | Open in IMG/M |
| 3300010412 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10 | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012533 | Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MG | Engineered | Open in IMG/M |
| 3300012956 | Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MG | Engineered | Open in IMG/M |
| 3300013093 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300014204 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 64-88 metaG | Engineered | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300017989 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_2 metaG | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300021139 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300021140 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
| 3300021142 | Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 epilimnion | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025383 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025451 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025597 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC113_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025678 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC111_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025713 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025877 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC10_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027320 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300028564 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant18 | Engineered | Open in IMG/M |
| 3300028567 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant14 | Engineered | Open in IMG/M |
| 3300028633 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Gly | Engineered | Open in IMG/M |
| 3300028677 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant22 | Engineered | Open in IMG/M |
| 3300028734 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_1 | Environmental | Open in IMG/M |
| 3300028738 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_1 | Environmental | Open in IMG/M |
| 3300028864 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_1 | Environmental | Open in IMG/M |
| 3300029268 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_19m | Environmental | Open in IMG/M |
| 3300029288 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 137-91 | Engineered | Open in IMG/M |
| 3300029983 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_1 | Environmental | Open in IMG/M |
| 3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031209 | Saline water microbial communities from Organic Lake, Antarctica - #439 | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032117 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB_GS10_10DRAFT_100478734 | 3300000230 | Groundwater | MKTKEILEKYKITRNTLCNWVKRGWIEVELTPSGRYIYIDKIKKSDE* |
| TBL_comb48_EPIDRAFT_10430863 | 3300000439 | Freshwater | MKAKDIMKKYQITRNTLCNWVKKGWIKVEKTPSGRYIYLEKTNDKHEI* |
| M3t6BS1_17720851 | 3300002141 | Marine | MKAKEVMEKYSITRNTLSNWVKKGYIKVEKTLSGRYIYLVDSDKKESQNDVGK* |
| B570J40625_1004202902 | 3300002835 | Freshwater | MKAKEVMKKYNITRNTLSNWVKKGYIKVEKTLSGRYIYIIENKDNI* |
| B570J40625_1015703632 | 3300002835 | Freshwater | MKAKEIMEKYNITRNTLSNWVKKGWIKVETLPSGRYIYIDIKNDNK* |
| Ga0031655_103918402 | 3300003852 | Freshwater Lake Sediment | KEVMLKYNISRRTLCNWVKKGVINFEKTPTGRYIYIIKEKESN* |
| Ga0049080_100355012 | 3300005582 | Freshwater Lentic | MKAKEVMKKYNITRNTLSNWVKKGYIKVEKTLSGRYIYLDSEKKESQNDV* |
| Ga0049082_101334302 | 3300005584 | Freshwater Lentic | MKAKEIMGKYNITRNTLSNWVKKGWIKVETLPSGRYIYIDIKNDNRNENL* |
| Ga0075163_100013603 | 3300006056 | Wastewater Effluent | MKAKEVMSKYNITRRTLSNWVKKGVITVELTPTGRYIYIEKNKVSDEKL* |
| Ga0075163_111112071 | 3300006056 | Wastewater Effluent | MKAKDVMLKYSITRRTLSNWVKKGIIEVELTPTGRYIYIEKKKEI* |
| Ga0007818_10351602 | 3300006117 | Freshwater | MKAKEVMEKYQISRNTLCTWVKKGWIKVDKIPSGRYIYIDKKEDTKDEKTN* |
| Ga0070744_1000020918 | 3300006484 | Estuarine | MKAKDIMEKYNITRRTLHNWVKKGVIEVELTPTGRYIYIEKNKKSDEKL* |
| Ga0070744_100018235 | 3300006484 | Estuarine | MKAKEVMEKYKITRNTLSNWVKRGWIVVEKMPSGRYIYFEKNIDRDEC* |
| Ga0075464_100263421 | 3300006805 | Aqueous | MKAKEILEKYKITRNTLCNWVKKGLIEVEKTPSGRYIYIDKIKKSDE* |
| Ga0075464_100603263 | 3300006805 | Aqueous | MKAKEILEKYKITRNTLCNWVKKGWIEVKLTPSGRYIYIDKINNKVDE* |
| Ga0075464_101865993 | 3300006805 | Aqueous | MKAKEVMEKYSITRRTLHNWVKKGVILVKLTPTGRYIYIEKNDKSNENL* |
| Ga0075464_106005052 | 3300006805 | Aqueous | MKAKEIMEKYKITRNTLSNWVKKGWIEVELMPSGRYIYIEKVRNI* |
| Ga0102976_10288733 | 3300007169 | Freshwater Lake | MKAKEIMEKYNITRNTLSNWVKKGWIKVETLPSGRYIYIDIKNDKK* |
| Ga0105050_1000120331 | 3300007516 | Freshwater | MKAKDIMEKYQITRRTLSNWVKKGTIGTKLTPSGRYIYFEKETVRDEEV* |
| Ga0102828_11675362 | 3300007559 | Estuarine | MKAKDIMEKYNITRRTLHNWVKKGVIEVELTPTGRYI |
| Ga0114347_100054511 | 3300008114 | Freshwater, Plankton | MKAKEIMEKYKITRNTLSNWVKRGWIEVEILPSGRYIYHEVKIIKNNEC* |
| Ga0114354_11021851 | 3300008119 | Freshwater, Plankton | KEIIEKYKITRNTLSNWVKRGWIEVEVLPSGRYIYHEIKIIKK* |
| Ga0102816_12729431 | 3300008999 | Estuarine | KYNITRRTLHNWVKKGVIEVELTPTGRYIYIEKNKKSDEKL* |
| Ga0114973_100027593 | 3300009068 | Freshwater Lake | MKAKDVMKKFDISRNTLSNWVKMGYIKVEKTLSGRYIYLIEENKDKNDITGTG* |
| Ga0114973_100493865 | 3300009068 | Freshwater Lake | MKAKEVMEKYSITRNTLSNWVKRGYIKVEKTLSGRYIYLDSEKKESQDNEK* |
| Ga0114962_1000091810 | 3300009151 | Freshwater Lake | MKAKEVMKKYNITRNTLSNWVKKGYIKIEKTLSGRYIYLESEKKESRDEN* |
| Ga0114962_100043671 | 3300009151 | Freshwater Lake | MKAKEIMEKYKITRNTLSNWVKRGWIEVEVLPSGRYLYFDKNNDDK* |
| Ga0114962_100491504 | 3300009151 | Freshwater Lake | MKAKEIMKKYNITRNTLSNWVKRGWIEVELMPSGRYIYIDIKNDIKQ* |
| Ga0114962_100697733 | 3300009151 | Freshwater Lake | MKAKEIMRKYNITRNTLSNWVKRGWIKVELMPSGRYIYIDKNNLEDEKM* |
| Ga0114968_100408813 | 3300009155 | Freshwater Lake | MKAKDVMKKFDISRNTLSNWVKMGYIKVEKTLSGRYIYLIEENKDKNDNTGTG* |
| Ga0114978_100593475 | 3300009159 | Freshwater Lake | MKAKEIMEKYNITRNTLSNWVKRGWIKVETLPSGRYIYIDKNETKNEKM* |
| Ga0114978_100855473 | 3300009159 | Freshwater Lake | MKAKEVMEKYSITRNTLSNWVKRGYIKVEKTLSGRYIYLDSEKKESQNDVEK* |
| Ga0114970_104390472 | 3300009163 | Freshwater Lake | KKFDISRNTLSNWVKMGYIKVEKTLSGRYIYLIEENKDKNDNTGTG* |
| Ga0105097_103247492 | 3300009169 | Freshwater Sediment | MKAKEIMEKYKITRNTLSNWVKRGWIEVELTPSGRYLYLDKINKKNENM* |
| Ga0114974_100845612 | 3300009183 | Freshwater Lake | MKAKEIMEKYKITRNTLCNWVKRGWIEVDKTPSGRYIYIDKNEIKNEIK* |
| Ga0114976_100079163 | 3300009184 | Freshwater Lake | MKAKQIMEKYNITRNTLSNWVKNGWIEVEKLPSGRYVYNDIKNDNKQ* |
| Ga0127405_12109042 | 3300009480 | Meromictic Pond | MKAKEVLEKYKITRNTLCNWVKRGWIKVEKTPSGRYIYFEKDN* |
| Ga0114951_1000040418 | 3300009502 | Freshwater | MKAKEIMDKYQITRNTLCNWVKKGLIKIDKTPSGRYIYFDKIKGKNEKIDN* |
| Ga0114951_100560355 | 3300009502 | Freshwater | MKAKEIMDKYQITRNTLCNWVKKGWIKIDKTPSGRYIYFDKIKGDDEKEN* |
| Ga0114951_100692403 | 3300009502 | Freshwater | MKAKEIISKYQISRNTLCNWVKKGSIKIEKTPSGRYIYLELEKIKKDEK* |
| Ga0116175_11027772 | 3300009648 | Anaerobic Digestor Sludge | MKAKDIMTKYNITRRTLHNWVKKGIIKVELTPSGRYIYIDKNNSSLDESL* |
| Ga0116175_11083152 | 3300009648 | Anaerobic Digestor Sludge | MKAKEVLEKYKITRNTLSNWVKKGWIKVERTPSGRYIYIDKNNKNNE* |
| Ga0116182_10088163 | 3300009666 | Anaerobic Digestor Sludge | MKAKEILEKYKITRNTLCNWVKRGWIEVKLTPSGRYIYIDKINNKVDE* |
| Ga0116177_103892002 | 3300009696 | Anaerobic Digestor Sludge | MKAKEVMEKYKITRNTLSNWVKKGLIGVKLTPSGRYIY |
| Ga0116192_10128606 | 3300009710 | Anaerobic Digestor Sludge | MKAKDIMIKYGITRRTLHNWVKKGIIKVELTPSGRYIYIDKNSSSSYESL* |
| Ga0116192_10249394 | 3300009710 | Anaerobic Digestor Sludge | MKAKEIMEKYKITRNTLSNWVKRGWIKVEILPSGRYIYIDIKNNDSYENM* |
| Ga0116192_10781364 | 3300009710 | Anaerobic Digestor Sludge | MKAKEIMEKYKITRNTLSNWVKKGWIKVEILPSGRYIYIDIKNNDSYENM* |
| Ga0116192_11009742 | 3300009710 | Anaerobic Digestor Sludge | MKAKEIMEKYNITRNTLSNWVKKGWIKVEKTPSGRYIYIDKK* |
| Ga0116191_10226532 | 3300009716 | Anaerobic Digestor Sludge | MKAKEIMSKYNISRNTLSNWVKRGWIEIELMPNGRYIYRDKKKENENR* |
| Ga0116184_103107771 | 3300009769 | Anaerobic Digestor Sludge | KHIFNIYYMKAKDVMLKYSITRRTLSNWVKKGIIEVELTPTGRYIYIEKKKEI* |
| Ga0116245_103143191 | 3300010338 | Anaerobic Digestor Sludge | MKAKEVLEKYKITRNTLSNWVKRGWIKVEKTPSGRYIYID |
| Ga0116250_100885831 | 3300010340 | Anaerobic Digestor Sludge | IYYMKAKDVMLKYSITRRTLSNWVKKGIIEVELTPTGRYIYIEKKKEI* |
| Ga0116250_105631042 | 3300010340 | Anaerobic Digestor Sludge | MKAKEILEKYKITRNTLCNWVKKGWIEVELTPSGRYIYIDKIKKSDE* |
| Ga0116249_101980415 | 3300010357 | Anaerobic Digestor Sludge | MKAKDVMLKYSITRRTLSNWVKKGIIEVELTQTGRYIYIEKKKEI* |
| Ga0136852_101669332 | 3300010412 | Mangrove Sediment | MKAKEIMEKYKITRNTLSNWVKRGWIKVEILPSGRYIYIDIKSSKN* |
| Ga0133913_102430141 | 3300010885 | Freshwater Lake | EKYNITRRTLSNWVKKGVIDIELTPTGRYIYIEKNKKSNEDNKC* |
| Ga0133913_136310561 | 3300010885 | Freshwater Lake | EKYNITRRTLSNWVKKGVIDIELTPTGRYIYIEKNKKSNEEL* |
| Ga0138256_101653604 | 3300012533 | Active Sludge | MKAKEILEKYKISRNTLSTWVKKGWIKVEILPSGRYRYITKDDK* |
| Ga0138256_103089752 | 3300012533 | Active Sludge | MKAKEILNKYKISRNTLSNWVKKGWIEVSKMPSGRYIYTDIKLIKNNEKLL* |
| Ga0138256_106186042 | 3300012533 | Active Sludge | MLKYSITRRTLSNWVKKGIIEVELTPTGRYIYIEKKKEI* |
| Ga0154020_105677482 | 3300012956 | Active Sludge | MKAKEILEKYKISRNTLSNWVKKGWIEVKLTPSGRYIYEEKIDRNAEIK* |
| Ga0164296_13292941 | 3300013093 | Freshwater | QITRNTLCNWVKKGWIKVEKTPSGRYIYLEKTNDKHEI* |
| (restricted) Ga0172367_100069495 | 3300013126 | Freshwater | MKAKEIMKRYQITRNTLSNWVKRGWIKVEKMPSGRYIYLDKKESMENEKV* |
| (restricted) Ga0172367_100080238 | 3300013126 | Freshwater | MKAKEVMEKYGISRNTLCTWVKKGWIEIEIIPSGRYRYKIIERKDGKQ* |
| Ga0172381_100157665 | 3300014204 | Landfill Leachate | MKAKDIMIKFQITRNTLCNWVKRGLIEVDKTPSGRYIYKIINKNE* |
| Ga0172381_110091752 | 3300014204 | Landfill Leachate | MKAKEIMSKYQITRNTLCNWVKKGLIDVIKTPSGRYIYIEKSNK* |
| Ga0181344_10002678 | 3300017754 | Freshwater Lake | MKAKEILKKYKITRNTLCNWVKKGLIEVEKTPSGRYIYIDKTKKSDE |
| Ga0169931_104970552 | 3300017788 | Freshwater | MKAKEVMEKYGISRNTLCTWVKKGWIEIEIIPSGRYRYKIIERKDGKQ |
| Ga0169931_109335222 | 3300017788 | Freshwater | MKAKEIMKRYQITRNTLSNWVKRGWIKVEKMPSGRYIYLDKKESMENEKV |
| Ga0180432_111719392 | 3300017989 | Hypersaline Lake Sediment | MKAKEVMEKYGISRNTLSTWVKKGWIQVEVLPSGRYRYKEIKKYE |
| Ga0207193_100108844 | 3300020048 | Freshwater Lake Sediment | MKAKEIMKKYEISRNTLCTWVKKGLIEVDKTPSGRYIYKIKNVDEKKN |
| Ga0207193_10498877 | 3300020048 | Freshwater Lake Sediment | MKAKEIMEKYNITRNTLSNWVKKGWIKVETLPSGRYIYIDIKNDNK |
| Ga0207193_11080336 | 3300020048 | Freshwater Lake Sediment | MKAKDVMLKYSITRRTLSNWVKKGIIEVELTPTGRYIYIEKKKEI |
| Ga0207193_17628101 | 3300020048 | Freshwater Lake Sediment | MKAKEILEKYKITRNTLCNWVKKGWIEVELTPSGRYIYIDKINKTDE |
| Ga0211734_104877341 | 3300020159 | Freshwater | MKAKEIMEKYNITRNTLSNWVKRGWIQVETLPSGRYIYIDIKNDKN |
| Ga0211733_1068644417 | 3300020160 | Freshwater | MKAKEILEKYKITRNTLCNWVKRGWIEVELTPSGRYIYIDKIKKSDE |
| Ga0211735_1120908627 | 3300020162 | Freshwater | MKAKEVMEKYKITRNTLSNWVKRGWIIVEKMPSGRYIYFEKNIDRDEC |
| Ga0211731_1045143735 | 3300020205 | Freshwater | MKAKEVMEKYKITRNTLSNWVKRGWIEVESLPSGRYIYHEIKITKK |
| Ga0214166_10092301 | 3300021139 | Freshwater | MKAKEVMKKYNITRNTLSNWVKKGYIKIEKTLSGRYIYLESEKKESRDEN |
| Ga0214168_10899062 | 3300021140 | Freshwater | MKAKEIMERYNITRNTLSNWVKKGWIKVEKMPSGRYVYTDIKNENK |
| Ga0214192_10508765 | 3300021142 | Freshwater | MKMKAKDVMKYYGICRETLSNWVKKDLIKYEKTPSGRYIY |
| Ga0222712_106673701 | 3300021963 | Estuarine Water | MKAKDIMTKYNITRRTLHNWVKKGIIKVELTPSGRYIYIDKNNSSLDESL |
| Ga0212088_1000062518 | 3300022555 | Freshwater Lake Hypolimnion | MKAKEIMDKYQITRNTLCNWVKKGLIKIDKTPSGRYIYFDKIKGKNEKIDN |
| Ga0212088_101058914 | 3300022555 | Freshwater Lake Hypolimnion | MFIYKINMKAKEIISKYQISRNTLCNWVKKGSIKIEKTPSGRYIYLELEKIKKDEK |
| Ga0212088_104949602 | 3300022555 | Freshwater Lake Hypolimnion | MKAKEIMDKYQITRNTLCNWVKKGWIKIDKTPSGRYIYFDKIKGDDEKEN |
| Ga0214921_104904192 | 3300023174 | Freshwater | MKAKEVMKKYSITRNTLSNWVKRGYIKVEKTLSGRYIYLDSEKKESQDNEK |
| Ga0214921_105514602 | 3300023174 | Freshwater | MKAKEVMKKYQISRNTLSAWVKKGWIKIEKKPSGRYIYIIEDKKI |
| Ga0214919_1001835010 | 3300023184 | Freshwater | MKAKEVMEKYSITRNTLSNWVKRGYIKVEKTLSGRYIYLDSEKKESQDNEK |
| Ga0214919_101532703 | 3300023184 | Freshwater | MKAKEVMKKYSITRNTLSNWVKRGYIKVEKTLSGRYIYLDSEKKESQNDVEK |
| Ga0214919_106873282 | 3300023184 | Freshwater | MKAKEIMKKYNITRNTLSNWVKKGWIKVETLPSGRYIYFDIKNDKK |
| Ga0244775_1000041644 | 3300024346 | Estuarine | MKAKDIMEKYNITRRTLHNWVKKGVIEVELTPTGRYIYIEKNKKSDEKL |
| Ga0244775_100154268 | 3300024346 | Estuarine | MKAKEVMEKYKITRNTLSNWVKRGWIVVEKMPSGRYIYFEKNIDRDEC |
| Ga0208250_10641162 | 3300025383 | Freshwater | MKAKDIMKKYQITRNTLCNWVKKGWIKVEKTPSGRYIYLEKTNDKHEI |
| Ga0208426_10039322 | 3300025451 | Aqueous | MKAKEVMEKYSITRRTLHNWVKKGVILVKLTPTGRYIYIEKNDKSNENL |
| Ga0208825_10069632 | 3300025597 | Anaerobic Digestor Sludge | MNNSFLIYTNMKAKDIMIKYGITRRTLHNWVKKGIIKVELTPSGRYIYIDKNSSSSYESL |
| Ga0208825_10255143 | 3300025597 | Anaerobic Digestor Sludge | MKAKEIMEKYKITRNTLSNWVKRGWIKVEILPSGRYIYIDIKNNDSYENM |
| Ga0208825_10807432 | 3300025597 | Anaerobic Digestor Sludge | MKAKEIMEKYNITRNTLSNWVKKGWIKVEKTPSGRYIYIDKK |
| Ga0208695_100103021 | 3300025678 | Anaerobic Digestor Sludge | MKAKEIMEKYKITRNTLSNWVKKGWIKVEILPSGRYIYIDIKNNDSYENM |
| Ga0208695_10160337 | 3300025678 | Anaerobic Digestor Sludge | MKAKEIMSKYNISRNTLSNWVKRGWIEIELMPNGRYIYRDKKKENENR |
| Ga0208195_10294694 | 3300025713 | Anaerobic Digestor Sludge | MKAKEILEKYKITRNTLCNWVKRGWIEVKLTPSGRYIYIDKINNKVDE |
| Ga0208460_101752352 | 3300025877 | Anaerobic Digestor Sludge | MKAKEILEKYKITRNTLCNWVKKGWIEVKLTPSGRYIYIDKINNKVDE |
| Ga0208916_100440721 | 3300025896 | Aqueous | MKAKEILEKYKITRNTLCNWVKKGLIEVEKTPSGRYIYIDKIKKSDE |
| Ga0208916_100983202 | 3300025896 | Aqueous | MKAKEIMEKYKITRNTLSNWVKKGWIEVELMPSGRYIYIEKVRNI |
| Ga0208916_102166341 | 3300025896 | Aqueous | MKAKDVMLKYSITRRTLSNWVKKGIIEVELTPTGRYIYIEKIKESNEKL |
| Ga0208923_10114743 | 3300027320 | Estuarine | KDIMEKYNITRRTLHNWVKKGVIEVELTPTGRYIYIEKNKKSDEKL |
| Ga0208966_11139622 | 3300027586 | Freshwater Lentic | MKAKEIMGKYNITRNTLSNWVKKGWIKVETLPSGRYIYIDIKNDNRNENL |
| Ga0208974_11410442 | 3300027608 | Freshwater Lentic | MKAKEVMKKYNITRNTLSNWVKKGYIKVEKTLSGRYIYLDSEKKESQNDV |
| (restricted) Ga0247833_11379012 | 3300027730 | Freshwater | MKAKEVMKKYNITRNTLSNWVKKGYIKIEKTLSGRYIYLVQDWHVVDSDKKESQNVGN |
| (restricted) Ga0247833_13151422 | 3300027730 | Freshwater | MKAKEVMEKYNITRNTLSNWVKKGWIIVEILPSGRYIYKEIKKI |
| Ga0209442_13051192 | 3300027732 | Freshwater Lake | MKAKEIMEKYNITRNTLSNWVKRGWIKVETLPSGRYT |
| Ga0209087_10697533 | 3300027734 | Freshwater Lake | MKAKEVMEKYSITRNTLSNWVKRGYIKVEKTLSGRYIYLDSEKKESQNDVEK |
| Ga0209087_11847211 | 3300027734 | Freshwater Lake | MKAKQIMEKYNITRNTLSNWVKNGWIEVEKLPSGRYVYNDIKNDNKQ |
| Ga0209190_10358663 | 3300027736 | Freshwater Lake | MKAKDVMKKFDISRNTLSNWVKMGYIKVEKTLSGRYIYLIEENKDKNDITGTG |
| Ga0209084_10314574 | 3300027749 | Freshwater Lake | MKAKEVMKKYNITRNTLSNWVKKGYIKVEKTLSGRYIYIIENKDNI |
| Ga0209084_10439452 | 3300027749 | Freshwater Lake | MKAKEIMRKYNITRNTLSNWVKRGWIKVELMPSGRYIYIDKNNLEDEKM |
| Ga0209084_10667641 | 3300027749 | Freshwater Lake | MKAKEIMKKYNITRNTLSNWVKRGWIEVELMPSGRYIYIDIKNDIKQ |
| Ga0209296_100271411 | 3300027759 | Freshwater Lake | MKAKEIMEKYNITRNTLSNWVKRGWIKVETLPSGRYIYIDKNETKNEKM |
| Ga0209296_11514102 | 3300027759 | Freshwater Lake | MKAKEIMEKYKITRNTLCNWVKRGWIEVDKTPSGRYIYIDKNEIKNEIK |
| Ga0209768_102685232 | 3300027772 | Freshwater Lake | MKAKEIMEKYNITRNTLSNWVKRGWIKVETLPSGRYIYIDIKNDNRNENL |
| Ga0209112_100728512 | 3300027817 | Forest Soil | MKAKEIMLKYNITRRTLSNWVKKGIIKVEKTLSGRYIYLDKKEDNT |
| Ga0209777_100576182 | 3300027896 | Freshwater Lake Sediment | MKAKEVMKKYNITRNTLSNWVKKGYIKIEKTLSGRYIYLESEKKESRDNEN |
| Ga0209400_10855743 | 3300027963 | Freshwater Lake | MKAKDVMKKFDISRNTLSNWVKMGYIKVEKTLSGRYIYLIEENKDKNDNTGTG |
| Ga0209702_1000155531 | 3300027976 | Freshwater | MKAKDIMEKYQITRRTLSNWVKKGTIGTKLTPSGRYIYFEKETVRDEEV |
| (restricted) Ga0255344_10969951 | 3300028564 | Wastewater | MKAKDVMLKYSITRRTLSNWVKKGIIEVELTPTGRYI |
| (restricted) Ga0255342_10337952 | 3300028567 | Wastewater | MKAKEVLEKYKITRRTLSNWVKKGWITVEIMPSGRYIYHDKKDSIDKKNKIKDGII |
| Ga0302236_10986272 | 3300028633 | Activated Sludge | IEYFNIYYMKAKEILEKYKITRNTLCNWVKKGWIEVKLTPSGRYIYIDKINNKVDE |
| (restricted) Ga0255346_11290601 | 3300028677 | Wastewater | MKAKEVLEKYKITRRTLSNWVKKGWITVKIMPSGRYIYHDKKDSIDKKNKIK |
| Ga0302206_100000415 | 3300028734 | Fen | MKAKEILDKYKISRNTLCNWVKKGLIEVDKTPSGRYIYIDGK |
| Ga0302292_12758571 | 3300028738 | Fen | MKAKEIMDKYQITRNTLCNWVKKGLIKIDKTPSGRYIYLDKIKDNKKT |
| Ga0302215_102806421 | 3300028864 | Fen | MKAKEIMDKYQITRNTLCNWVKKGLIKIDKTPSGRYIYLDKIKD |
| (restricted) Ga0247842_101949572 | 3300029268 | Freshwater | MKAKEIMNKYQITRNTLCNWVKKGLIKVDKTPSGRYVYIEKKEKNEKEN |
| Ga0265297_100079393 | 3300029288 | Landfill Leachate | MKAKEILNKYQITRNTLCNWVKKGLIKVEKTPSGRYIYIDKIKKKDEK |
| Ga0302284_11062382 | 3300029983 | Fen | MKAKEIMNKYQITRNTLCNWVKKGLIIVEKTPSGRYIYYDKIKNNNEN |
| Ga0311348_111501523 | 3300030019 | Fen | MKAKEIMDKYQITRNTLCKWVKNGLIKIDKTPSGIYI |
| Ga0307955_10015712 | 3300031209 | Saline Water | MKAKEVMEKYSITRRTLHNWVKNGIIDYEKTPSGRYNYKIKNASR |
| Ga0311364_100973565 | 3300031521 | Fen | MKAKEIMDKYQITRNTLCNWVKKGTIKIDKTPSGRYIYFDKKISESEKTNN |
| Ga0311364_102683511 | 3300031521 | Fen | MKAKEIMNKYQITRNTLCNWVKRGLIKVDKTPSGRYVYYDKNEEKKNEK |
| Ga0302321_1034924412 | 3300031726 | Fen | MKAKEIMDKYQITRNTLCNWVKKGLIKIDKTPSGRYIYLDKIKDNNNEKEN |
| Ga0315289_106774803 | 3300032046 | Sediment | MKAKEIMNKYQITRNTLCNWVKKGLIKVDRTPSGRYIYIDKIINKSEV |
| Ga0315284_106821562 | 3300032053 | Sediment | MKAKEVMMKYNITRNTLSNWVQKGWIEVQKLPSGRYIYLDLKSNNENENM |
| Ga0315284_111242801 | 3300032053 | Sediment | IMDKYQITRNTLCNWVKRGWIKIDKTPSGRYIYFDKIKDNNEK |
| Ga0316218_11015604 | 3300032117 | Freshwater | MKMKAKDVMKYYGICRETLSNWVKKDLIKYEKTPSGR |
| Ga0315276_116600203 | 3300032177 | Sediment | MKAKEIMDKYQITRNTLCNWVKRGWIKIDKTPSGRYIYFDKIKDNNEK |
| Ga0335005_0461296_591_713 | 3300034022 | Freshwater | MKAKEILEKYKITRNTLCNWVKKGLIEVEKTPSGRYIYIDK |
| Ga0310130_0021757_909_1064 | 3300034073 | Fracking Water | MKAKEIMKKYSITRNTLSNWVKKGWIKVEILPSGRYIYIDIKNKIGNEDNM |
| Ga0335035_0022367_3527_3679 | 3300034105 | Freshwater | MKAKEIMEKYKITRNTLCNWVKKGWIKVETLPSGRYIYFDLKINNGDESM |
| ⦗Top⦘ |