


| Basic Information | |
|---|---|
| Family ID | F049584 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 146 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MHQIGVVGLSYRHAGVDEVARFAVPRAEVPARLPALRALLK |
| Number of Associated Samples | 130 |
| Number of Associated Scaffolds | 146 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 19.86 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 86.30 % |
| Associated GOLD sequencing projects | 125 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.671 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.918 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.233 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.945 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.99% β-sheet: 0.00% Coil/Unstructured: 71.01% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 146 Family Scaffolds |
|---|---|---|
| PF11695 | DUF3291 | 6.85 |
| PF00326 | Peptidase_S9 | 5.48 |
| PF07687 | M20_dimer | 4.79 |
| PF03576 | Peptidase_S58 | 4.11 |
| PF00593 | TonB_dep_Rec | 4.11 |
| PF05957 | DUF883 | 4.11 |
| PF01075 | Glyco_transf_9 | 2.74 |
| PF14329 | DUF4386 | 2.74 |
| PF13676 | TIR_2 | 2.74 |
| PF02781 | G6PD_C | 2.74 |
| PF07715 | Plug | 2.05 |
| PF08240 | ADH_N | 2.05 |
| PF00196 | GerE | 0.68 |
| PF14403 | CP_ATPgrasp_2 | 0.68 |
| PF01569 | PAP2 | 0.68 |
| PF02423 | OCD_Mu_crystall | 0.68 |
| PF00107 | ADH_zinc_N | 0.68 |
| PF01546 | Peptidase_M20 | 0.68 |
| PF04168 | Alpha-E | 0.68 |
| PF12706 | Lactamase_B_2 | 0.68 |
| PF01883 | FeS_assembly_P | 0.68 |
| PF00144 | Beta-lactamase | 0.68 |
| PF07589 | PEP-CTERM | 0.68 |
| PF04828 | GFA | 0.68 |
| PF08352 | oligo_HPY | 0.68 |
| PF00999 | Na_H_Exchanger | 0.68 |
| PF12697 | Abhydrolase_6 | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 146 Family Scaffolds |
|---|---|---|---|
| COG3191 | L-aminopeptidase/D-esterase | Amino acid transport and metabolism [E] | 8.22 |
| COG4575 | Membrane-anchored ribosome-binding protein ElaB, inhibits growth in stationary phase, YqjD/DUF883 family | Translation, ribosomal structure and biogenesis [J] | 4.11 |
| COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 2.74 |
| COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 2.74 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.68 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.68 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.68 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.68 |
| COG2307 | Uncharacterized conserved protein, Alpha-E superfamily | Function unknown [S] | 0.68 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.68 |
| COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 0.68 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.68 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.68 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.68 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.41 % |
| Unclassified | root | N/A | 9.59 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918007|ConsensusfromContig93468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 665 | Open in IMG/M |
| 3300001084|JGI12648J13191_1007393 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1098 | Open in IMG/M |
| 3300001593|JGI12635J15846_10190687 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1364 | Open in IMG/M |
| 3300004091|Ga0062387_101747991 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
| 3300005178|Ga0066688_10881374 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300005437|Ga0070710_11383578 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300005455|Ga0070663_101999803 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 521 | Open in IMG/M |
| 3300005531|Ga0070738_10144605 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300005533|Ga0070734_10766457 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
| 3300005541|Ga0070733_10498822 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300005542|Ga0070732_10370005 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300005559|Ga0066700_10419480 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300005576|Ga0066708_10050823 | All Organisms → cellular organisms → Bacteria | 2319 | Open in IMG/M |
| 3300005610|Ga0070763_10567482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 655 | Open in IMG/M |
| 3300005614|Ga0068856_101060375 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300005614|Ga0068856_101333790 | Not Available | 732 | Open in IMG/M |
| 3300005618|Ga0068864_101073753 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 800 | Open in IMG/M |
| 3300006638|Ga0075522_10587856 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300007788|Ga0099795_10074609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1286 | Open in IMG/M |
| 3300009012|Ga0066710_100395148 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2059 | Open in IMG/M |
| 3300009545|Ga0105237_11012421 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 838 | Open in IMG/M |
| 3300009551|Ga0105238_11345234 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 741 | Open in IMG/M |
| 3300010043|Ga0126380_11098782 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 678 | Open in IMG/M |
| 3300010046|Ga0126384_10879347 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300010152|Ga0126318_10735179 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 586 | Open in IMG/M |
| 3300010303|Ga0134082_10061932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1447 | Open in IMG/M |
| 3300010337|Ga0134062_10067636 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1486 | Open in IMG/M |
| 3300010359|Ga0126376_13078960 | Not Available | 516 | Open in IMG/M |
| 3300010373|Ga0134128_12154269 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 614 | Open in IMG/M |
| 3300010376|Ga0126381_100102554 | All Organisms → cellular organisms → Bacteria | 3656 | Open in IMG/M |
| 3300010396|Ga0134126_12028839 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 629 | Open in IMG/M |
| 3300010396|Ga0134126_12173909 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 605 | Open in IMG/M |
| 3300011119|Ga0105246_10260865 | Not Available | 1380 | Open in IMG/M |
| 3300012212|Ga0150985_106952428 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 643 | Open in IMG/M |
| 3300012285|Ga0137370_10441105 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 792 | Open in IMG/M |
| 3300012351|Ga0137386_10276449 | Not Available | 1208 | Open in IMG/M |
| 3300012582|Ga0137358_10025774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3823 | Open in IMG/M |
| 3300012917|Ga0137395_10188506 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1431 | Open in IMG/M |
| 3300012960|Ga0164301_10868536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis taiwanensis | 697 | Open in IMG/M |
| 3300012960|Ga0164301_11613051 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 539 | Open in IMG/M |
| 3300012977|Ga0134087_10063213 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1485 | Open in IMG/M |
| 3300013059|Ga0154012_147600 | Not Available | 542 | Open in IMG/M |
| 3300013100|Ga0157373_10986762 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 628 | Open in IMG/M |
| 3300013307|Ga0157372_10139792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2789 | Open in IMG/M |
| 3300015374|Ga0132255_102261538 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300016270|Ga0182036_10519015 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 946 | Open in IMG/M |
| 3300016294|Ga0182041_10426068 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300016319|Ga0182033_11360325 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300016341|Ga0182035_10057367 | All Organisms → cellular organisms → Bacteria | 2676 | Open in IMG/M |
| 3300016341|Ga0182035_10176180 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1669 | Open in IMG/M |
| 3300016341|Ga0182035_10254399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia | 1419 | Open in IMG/M |
| 3300017822|Ga0187802_10180942 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 809 | Open in IMG/M |
| 3300017959|Ga0187779_11152038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 544 | Open in IMG/M |
| 3300017961|Ga0187778_10019289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium | 4184 | Open in IMG/M |
| 3300017961|Ga0187778_10724977 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300017972|Ga0187781_10594438 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300017974|Ga0187777_11337489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 527 | Open in IMG/M |
| 3300017975|Ga0187782_11579526 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 518 | Open in IMG/M |
| 3300017999|Ga0187767_10374033 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 507 | Open in IMG/M |
| 3300018058|Ga0187766_11262996 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300018482|Ga0066669_10069135 | All Organisms → cellular organisms → Bacteria | 2325 | Open in IMG/M |
| 3300020069|Ga0197907_10412217 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
| 3300020069|Ga0197907_11059987 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 558 | Open in IMG/M |
| 3300020069|Ga0197907_11271027 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
| 3300020077|Ga0206351_10101256 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 559 | Open in IMG/M |
| 3300020077|Ga0206351_10593389 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
| 3300020080|Ga0206350_10024977 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 567 | Open in IMG/M |
| 3300020082|Ga0206353_10091201 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 691 | Open in IMG/M |
| 3300020082|Ga0206353_11077589 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 543 | Open in IMG/M |
| 3300020579|Ga0210407_11076858 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 610 | Open in IMG/M |
| 3300020579|Ga0210407_11387124 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 522 | Open in IMG/M |
| 3300020581|Ga0210399_10887744 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 724 | Open in IMG/M |
| 3300020582|Ga0210395_10906127 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 655 | Open in IMG/M |
| 3300021178|Ga0210408_11131042 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 601 | Open in IMG/M |
| 3300021181|Ga0210388_11209272 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 641 | Open in IMG/M |
| 3300021374|Ga0213881_10472872 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 567 | Open in IMG/M |
| 3300021401|Ga0210393_10980669 | Not Available | 684 | Open in IMG/M |
| 3300021406|Ga0210386_10930779 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 743 | Open in IMG/M |
| 3300021560|Ga0126371_10069714 | All Organisms → cellular organisms → Bacteria | 3417 | Open in IMG/M |
| 3300022506|Ga0242648_1000210 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3268 | Open in IMG/M |
| 3300022722|Ga0242657_1242086 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
| 3300025505|Ga0207929_1110427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300025544|Ga0208078_1006757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2823 | Open in IMG/M |
| 3300025906|Ga0207699_10332035 | Not Available | 1069 | Open in IMG/M |
| 3300025909|Ga0207705_10726119 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 772 | Open in IMG/M |
| 3300025917|Ga0207660_10034753 | All Organisms → cellular organisms → Bacteria | 3495 | Open in IMG/M |
| 3300025921|Ga0207652_11426393 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 596 | Open in IMG/M |
| 3300025924|Ga0207694_11784610 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 517 | Open in IMG/M |
| 3300025928|Ga0207700_11685006 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 559 | Open in IMG/M |
| 3300025986|Ga0207658_11965866 | Not Available | 532 | Open in IMG/M |
| 3300026078|Ga0207702_11396255 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300026342|Ga0209057_1217772 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300027158|Ga0208725_1067409 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300027633|Ga0208988_1027235 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
| 3300027664|Ga0207873_1106596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 886 | Open in IMG/M |
| 3300027867|Ga0209167_10141961 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
| 3300027894|Ga0209068_10235529 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1014 | Open in IMG/M |
| 3300027908|Ga0209006_11354690 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 547 | Open in IMG/M |
| 3300028380|Ga0268265_12532128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 519 | Open in IMG/M |
| 3300028795|Ga0302227_10252014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 675 | Open in IMG/M |
| 3300028906|Ga0308309_11083118 | Not Available | 693 | Open in IMG/M |
| 3300029910|Ga0311369_10225306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1725 | Open in IMG/M |
| 3300029999|Ga0311339_11665217 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 560 | Open in IMG/M |
| 3300030007|Ga0311338_10017899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 10343 | Open in IMG/M |
| 3300030056|Ga0302181_10446376 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
| 3300030503|Ga0311370_10055519 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5800 | Open in IMG/M |
| 3300030520|Ga0311372_11013188 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1094 | Open in IMG/M |
| 3300030524|Ga0311357_11441039 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
| 3300030618|Ga0311354_10318511 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1600 | Open in IMG/M |
| 3300030737|Ga0302310_10231184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1066 | Open in IMG/M |
| 3300031231|Ga0170824_127022728 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 546 | Open in IMG/M |
| 3300031469|Ga0170819_10327211 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 579 | Open in IMG/M |
| 3300031543|Ga0318516_10400115 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300031545|Ga0318541_10205216 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1091 | Open in IMG/M |
| 3300031680|Ga0318574_10827444 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300031708|Ga0310686_109815480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 744 | Open in IMG/M |
| 3300031713|Ga0318496_10496223 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300031715|Ga0307476_11211329 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
| 3300031736|Ga0318501_10114077 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1361 | Open in IMG/M |
| 3300031753|Ga0307477_10032616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3565 | Open in IMG/M |
| 3300031754|Ga0307475_10525198 | Not Available | 950 | Open in IMG/M |
| 3300031765|Ga0318554_10431470 | Not Available | 747 | Open in IMG/M |
| 3300031768|Ga0318509_10061040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1952 | Open in IMG/M |
| 3300031768|Ga0318509_10639393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 592 | Open in IMG/M |
| 3300031777|Ga0318543_10105460 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1214 | Open in IMG/M |
| 3300031777|Ga0318543_10558905 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300031793|Ga0318548_10192422 | Not Available | 1000 | Open in IMG/M |
| 3300031799|Ga0318565_10076455 | All Organisms → cellular organisms → Bacteria | 1586 | Open in IMG/M |
| 3300031799|Ga0318565_10090127 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1464 | Open in IMG/M |
| 3300031820|Ga0307473_10845299 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 656 | Open in IMG/M |
| 3300031821|Ga0318567_10255702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 984 | Open in IMG/M |
| 3300031823|Ga0307478_10028710 | All Organisms → cellular organisms → Bacteria | 3992 | Open in IMG/M |
| 3300031845|Ga0318511_10133221 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
| 3300031845|Ga0318511_10360437 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 663 | Open in IMG/M |
| 3300031894|Ga0318522_10063765 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1322 | Open in IMG/M |
| 3300031897|Ga0318520_10390308 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 850 | Open in IMG/M |
| 3300031941|Ga0310912_10107793 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2062 | Open in IMG/M |
| 3300031947|Ga0310909_10114324 | Not Available | 2184 | Open in IMG/M |
| 3300031954|Ga0306926_12381680 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300032063|Ga0318504_10130023 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1148 | Open in IMG/M |
| 3300032090|Ga0318518_10099422 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1450 | Open in IMG/M |
| 3300032261|Ga0306920_101688232 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300032261|Ga0306920_104410399 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300032828|Ga0335080_10158639 | All Organisms → cellular organisms → Bacteria | 2503 | Open in IMG/M |
| 3300032892|Ga0335081_10045314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 6944 | Open in IMG/M |
| 3300032898|Ga0335072_10667040 | Not Available | 1027 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.92% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 6.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.16% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.48% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.42% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.42% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.42% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.05% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.05% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.05% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.05% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.05% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.05% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.05% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.05% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.37% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.37% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.37% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.37% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.37% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.37% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.68% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.68% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.68% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.68% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.68% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.68% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Feedstock Adapted Compost | Engineered → Solid Waste → Feedstock → Composting → Unclassified → Feedstock Adapted Compost | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
| 3300001084 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013059 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025505 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025544 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300027158 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027664 | Cellulose adapted compost microbial communities from Newby Island Compost Facility, Milpitas, CA, USA - BGW Initial Compost (SPAdes) | Engineered | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A_all_C_01454030 | 2140918007 | Soil | MDQIGVVGLSYRHASVEDVARFAIPKAEIEARLPELR |
| JGI12648J13191_10073931 | 3300001084 | Forest Soil | MHQIGVVGLSYRHAGVDEVARFAVPRAQIPACLPALRTLLRASEIL |
| JGI12635J15846_101906872 | 3300001593 | Forest Soil | MHQIGVVGLSYRHAGVDEVARFAVPRAQIPACLPALRTLLRASEILYIGT |
| Ga0062387_1017479912 | 3300004091 | Bog Forest Soil | MHQIGVVGLSYRHAGVDEVARFSVPKAEVAARLPGLRDSLGVSEIFYV |
| Ga0066688_108813741 | 3300005178 | Soil | MHQIGVVGLSYRHVGVEEVARFALPRAEIPARLPALRTLL |
| Ga0070710_113835783 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MHQIGVVGLSYRHAGVDQVARFAVPRAELPARLPQLRTQLQAAEVVYVGTC |
| Ga0070663_1019998032 | 3300005455 | Corn Rhizosphere | MHQIGVVGLSYRHVGVDEVARFSVPKTDVAARLPALRDALGVSEVFYVG |
| Ga0070738_101446051 | 3300005531 | Surface Soil | MHQIGVVGLSYRHAGIDDVARLSIPKADLGARLPALRQ |
| Ga0070734_107664571 | 3300005533 | Surface Soil | MHQIGVVGLSYRHADVDEIARFTIPKADVPARLPALRERLGVAEL |
| Ga0070733_104988222 | 3300005541 | Surface Soil | MHQIGVVGLSYRHAGVDAVARFALPRAEVAARLPQLRERLTAGEILYVGTCN |
| Ga0070732_103700051 | 3300005542 | Surface Soil | MHQIGVVGLSYRHAGVEEVARFAVPRAEVPARLPALRALL |
| Ga0066700_104194801 | 3300005559 | Soil | MHQIGVVGLSYRHVGVEEVARFALPRAEIPARLPALRTL |
| Ga0066708_100508231 | 3300005576 | Soil | MHQIGVVGLSYRHAGVDQVARFAVPRTEVPARLPALRTLLK |
| Ga0070763_105674821 | 3300005610 | Soil | MDHIGVVGLSYRHASVEDVARFAIPKADIEARLPEIRAALGADLVF |
| Ga0068856_1010603753 | 3300005614 | Corn Rhizosphere | MHQIGVVGLSYRHVGVDEVARFSVPKTEVAERLPALREALGASEVFYVG |
| Ga0068856_1013337902 | 3300005614 | Corn Rhizosphere | MHHIGVVGLSYRHAGVDEVARFSVPRAEVAPRLALLQSRL |
| Ga0068864_1010737533 | 3300005618 | Switchgrass Rhizosphere | MHQIGVVGLSYRHVGVDEVARFSVPKTEVAARLPALRDALGVS |
| Ga0075522_105878561 | 3300006638 | Arctic Peat Soil | MHQIGVVGLSYRHAGVDEVARFAVPKAEVAARLPALRDALGVAEIFYVGTCN |
| Ga0099795_100746093 | 3300007788 | Vadose Zone Soil | MHQIGVVGLSYRHAGVDQVARFAVPRTEVPARLPALRTL |
| Ga0066710_1003951481 | 3300009012 | Grasslands Soil | MHQIGVVGLSYRHAGVDQVARFAVPKTEVPARLPAL |
| Ga0105237_110124211 | 3300009545 | Corn Rhizosphere | MHQIGVVGLSYRHVGVDEVARFSVPKTEVAARLPALRDALGVSEVFY |
| Ga0105238_113452342 | 3300009551 | Corn Rhizosphere | MHQIGVVGLSYRHVGVDEVARFSVPKTDVAARLPALRDALGVSEVFYVGT |
| Ga0126380_110987821 | 3300010043 | Tropical Forest Soil | MHQIGVVGLSYRHAGVEDVARFSMPRAEVPTRLPGLRAGLKAVELVYVGTCNR |
| Ga0126384_108793472 | 3300010046 | Tropical Forest Soil | MHQIGVVGLSYRHAGVDEVARFSVPRAEVPARLPALRALLK |
| Ga0126318_107351793 | 3300010152 | Soil | MHQIGAVGLSYRHAGIDDVARLTIPKADLETRLPALREALRVSELLYLG |
| Ga0134082_100619323 | 3300010303 | Grasslands Soil | MHQIGVVGLSYRHAGADQVARFAVPRTEVPARLPALRTLLK |
| Ga0134062_100676361 | 3300010337 | Grasslands Soil | MHQIGVVGLSYRHVGVEEVARFALPRAEIPARLPALRTLLKSAEILYVGT |
| Ga0126376_130789602 | 3300010359 | Tropical Forest Soil | MQQIGLVGLSYRHVGVDQVARFAVPRPELAARLPLLRAHLKV |
| Ga0134128_121542691 | 3300010373 | Terrestrial Soil | MHQIGVVGLSYRHAGIDEVARLSLPKAELEARLPALRQALG |
| Ga0126381_1001025543 | 3300010376 | Tropical Forest Soil | MHQIGVVGLSYRHAAVDEVARFAVPRAEVPARLPALRTLLKASE |
| Ga0134126_120288392 | 3300010396 | Terrestrial Soil | MHQIGVVGLSYRHAGIDDVARLSIPKADLEARLPSLRAALGVSELLYLGTC |
| Ga0134126_121739092 | 3300010396 | Terrestrial Soil | MHQIGVVGLSYRHAGIDDVARLSIPKADLEARLPALR |
| Ga0105246_102608651 | 3300011119 | Miscanthus Rhizosphere | MHQIGVVGLSYRHVGVDEVARFSVPKTDVAARLPALRDA |
| Ga0150985_1069524281 | 3300012212 | Avena Fatua Rhizosphere | MHQIGVVGLSYRHVGVDEVARFSVPKTDVAARLPALRDALGVSEVFYV |
| Ga0137370_104411052 | 3300012285 | Vadose Zone Soil | MHQIGVVGLSYRHAGVEQVARFAVPRTEGPSRLPALRTLLKA |
| Ga0137386_102764491 | 3300012351 | Vadose Zone Soil | MHQLGVVGLSYRHAGVDEVARFSVPKTEVAARLPALRDTLGVSEV |
| Ga0137358_100257741 | 3300012582 | Vadose Zone Soil | MHQIGVVGLSYRHAGVDQVARFAVPRTEVPARLPALRTLLKAAEILYVGTCN |
| Ga0137395_101885063 | 3300012917 | Vadose Zone Soil | MHQIGVVGLSYRHVGVEEVARFALPRAEIPARLPALRALL |
| Ga0164301_108685362 | 3300012960 | Soil | MHQIGVVGLSYRHAAVEEVARFAVPRAEVPARLPALRALLK |
| Ga0164301_116130512 | 3300012960 | Soil | MHQIGVVGLSYRHAGVDQVARFAVPRVELPARLPQLRT |
| Ga0134087_100632131 | 3300012977 | Grasslands Soil | MHQIGVVGLSYRHAGVDQVARFAVPRTEVPARLPALRT |
| Ga0154012_1476002 | 3300013059 | Corn, Switchgrass And Miscanthus Rhizosphere | MHQIGVVALSYRHSGIDEVARLSIPKADLESRLASLREALQVS |
| Ga0157373_109867621 | 3300013100 | Corn Rhizosphere | MHQIGVVGLSYRHAGVDEVARFALPKAEVAARLPALRDSLRASEILYVGT |
| Ga0157372_101397921 | 3300013307 | Corn Rhizosphere | MHQIGAVGLSYRNAGIDEVARLSIPKGDLEARLPALRDAI |
| Ga0132255_1022615382 | 3300015374 | Arabidopsis Rhizosphere | MHQIGVVGLSYRHAGVDEVARFAVPRADVPARLPALRALLKASEILYLGT |
| Ga0182036_105190152 | 3300016270 | Soil | MQQIGVVGLSYRHAGVDEVARFAVPRAEVPARLPALRALLKASEILYVGT |
| Ga0182041_104260682 | 3300016294 | Soil | MQQIGVVGLSYRHAGVEEVARFAVPRAEVPARLPALRAVLKASEILYVGTC |
| Ga0182033_113603253 | 3300016319 | Soil | MHQIGVVGLSYRHAGVDEVARFAVPRAEVPARLPAL |
| Ga0182035_100573671 | 3300016341 | Soil | MHQIGVVGLSYRHAGVDDVARFAVPRAEVPARLPALRALLKASEI |
| Ga0182035_101761801 | 3300016341 | Soil | MHQIGVVGLSYRHAAVEEVARFAVPRAEVPARLPALRDLLKASETL |
| Ga0182035_102543991 | 3300016341 | Soil | MHQIGVVGLSYRHAGVEEVARFAVPRAEVPARLPA |
| Ga0187802_101809421 | 3300017822 | Freshwater Sediment | MHQIGVVGLSYRHAGVDEVARFAVPRAEVPARLPALRALLK |
| Ga0187779_111520381 | 3300017959 | Tropical Peatland | MHQIGVVGLSYRHAGVDEVARFAVPRAEIAARLPELRVR |
| Ga0187778_100192891 | 3300017961 | Tropical Peatland | MHQIGVVGLSYRHAGVADVARFAVPRAEVPARLPA |
| Ga0187778_107249773 | 3300017961 | Tropical Peatland | MHQIGVVGLSYRHAGVDEVARFAVPRAEVPARLPTLRTLH |
| Ga0187781_105944381 | 3300017972 | Tropical Peatland | MHQIGVVGLSYRHADVADVARFAVPRAEVPARLPA |
| Ga0187777_113374891 | 3300017974 | Tropical Peatland | MHQIGVVGLSYRHAGVDEVARFAVPRAEITARLPELRVRLRA |
| Ga0187782_115795261 | 3300017975 | Tropical Peatland | MHQIGVVGLSYRHAGVEEVARFSIPRAEVGARLPALRALLKASEVLYV |
| Ga0187767_103740331 | 3300017999 | Tropical Peatland | MHQIGVVGLSYRHAGVDDLARFTVPREALSERLAALRALLPAAELLYIGT |
| Ga0187766_112629961 | 3300018058 | Tropical Peatland | MHQIGVVGLSYRHAAVGEVARFALPRGEVPAFLPALRTSLKASEILYVGTCN |
| Ga0066669_100691355 | 3300018482 | Grasslands Soil | MHQIGVVGLSYRHAGVDQVARFAVPRTEVPARLPALRTLLKA |
| Ga0197907_104122172 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | MHQIGVVGLSYRHAGIDEVARLSIPKADLAARLPSLREALQVSELLYLG |
| Ga0197907_110599872 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | MHQIGVVGLSYRHSGIDEVARLSIPKADLESRLASLREALQVSELLYLG |
| Ga0197907_112710272 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | MHQIGVVGLSYRHAGVDDIARFSLPKAEVGARLPSLRDCLGA |
| Ga0206351_101012561 | 3300020077 | Corn, Switchgrass And Miscanthus Rhizosphere | MHQIGVVGLSYRHSGIDEVARLSIPKADLESRLASLREALQVSELLYL |
| Ga0206351_105933892 | 3300020077 | Corn, Switchgrass And Miscanthus Rhizosphere | MHQIGVVGLSYRHAGVDDIARFSLPKAEVGARLPS |
| Ga0206350_100249771 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | MHQIGAVGLSYRHAGIDEVARLSISKDDLEARLPALREALKVSELLYLGTC |
| Ga0206353_100912011 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MHQIGVVGLSYRHAGVDEVARFALPKAEVAARLPALRECLRASEVL |
| Ga0206353_110775892 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQIGVVGLSYRHAGVDDIARFSLPKAQVAERLPRLRDCLGAGE |
| Ga0210407_110768581 | 3300020579 | Soil | MHQIGVVGLSYRHAGVEEVARFAVPRTEVPARLPALR |
| Ga0210407_113871241 | 3300020579 | Soil | MHQIGVVGLSYRHAGVDEVARFALPKAELAARLPALRDFLRA |
| Ga0210399_108877442 | 3300020581 | Soil | MHQIGVVGLSYRHAGVDEVARFAVPRTEVPARLPA |
| Ga0210395_109061272 | 3300020582 | Soil | MHQIGVVGLSYRHAGVEEVARFAVPRAEVAARLPELRSRLNAAEILYV |
| Ga0210408_111310421 | 3300021178 | Soil | MHQIGVVGLSYRHAGVDDIARFSLPKEEVGSRLPALRDWLRAGEVLYVGT |
| Ga0210388_112092721 | 3300021181 | Soil | MHQIGVVGLSYRHVGVDEVARFALPKAEVAARLPA |
| Ga0213881_104728721 | 3300021374 | Exposed Rock | MHQIGVVGLSYRHAGVEDVARFTMPRTEIAARLPALRVALGAAEV |
| Ga0210393_109806692 | 3300021401 | Soil | MHQIGVVGLSYRHAGVDEVARFSLPRADVGARLCALRAHLKAAEILYVGT |
| Ga0210386_109307792 | 3300021406 | Soil | MHQIGVVGLSYRHVGVDEVARFALPKAEVAARLPALRDLL |
| Ga0126371_100697144 | 3300021560 | Tropical Forest Soil | MHQIGVVGLSYRHAGVDEVARFSVPRAEVPARLPALRALL |
| Ga0242648_10002101 | 3300022506 | Soil | MHQIGVVGLSYRHAGVDAVARFALPRAEVAARLPQLRQRLNAAEILYV |
| Ga0242657_12420862 | 3300022722 | Soil | MHQIGVVGLSYRHVGVDEVARFALPKAEIAARLPALR |
| Ga0207929_11104271 | 3300025505 | Arctic Peat Soil | MDHIGVVGLSYRHASAEDVARFAIPKSEIEARLAEL |
| Ga0208078_10067572 | 3300025544 | Arctic Peat Soil | MDQIGVVGLSYRHASVEDVARFAIPKADIEARLPQLRAALRG |
| Ga0207699_103320353 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MHQIGVVGLSYRHAGVDEVARFALPKAEVAARLPALR |
| Ga0207705_107261191 | 3300025909 | Corn Rhizosphere | MHQIGVVGLSYRHVGVDEVARFSVPKTDVAARLPALR |
| Ga0207660_100347535 | 3300025917 | Corn Rhizosphere | MHQIGVVGLSYRHAGVDDIARFSLPKEKVGARLPSLRDCLG |
| Ga0207652_114263932 | 3300025921 | Corn Rhizosphere | MHQIGVVGLSYRHAGVDDIARFSLPKAEVGARLPSL |
| Ga0207694_117846101 | 3300025924 | Corn Rhizosphere | MHQIGVVGLSYRHVGVDEVARFALPKAEVAARLPALRDYL |
| Ga0207700_116850061 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MHQIGVVGLSYRHAGVDEVARFALPKAEVAARLPALRDCLRASEVLY |
| Ga0207658_119658661 | 3300025986 | Switchgrass Rhizosphere | MHQIGVVGVSYRHARVDDVARFALPKADVAARLPALRADL |
| Ga0207702_113962553 | 3300026078 | Corn Rhizosphere | MHQIGVVGLSYRHANVAEVARFAVPRAEVPPRLPALRALL |
| Ga0209057_12177722 | 3300026342 | Soil | MHQIGVVGLSYRHVGVEEVARFALPRAEIPARLPAL |
| Ga0208725_10674091 | 3300027158 | Forest Soil | MHQIGVVGLSYRHAGIDEVARLSIAKVDLEARLQALREALGVSELLYLG |
| Ga0208988_10272353 | 3300027633 | Forest Soil | MHQIGVVGLSYRHAGVDEVARFAVPRTEVPARLPALRTLLKAAE |
| Ga0207873_11065963 | 3300027664 | Feedstock Adapted Compost | MHQIGIVGLSYRHASTDEVARFSIPKADVPARLPELREALGVSELIYL |
| Ga0209167_101419611 | 3300027867 | Surface Soil | MHQIGVVGLSYRHAGVDAVARLAVPRAEVPARLPALRKELKAAEILYVGT |
| Ga0209068_102355291 | 3300027894 | Watersheds | MHQIGVVGLSYRHAGVEEVARFAVPRTEVPVRLPALRTLLKAAEIL |
| Ga0209006_113546902 | 3300027908 | Forest Soil | MHQIGVVGLSYRHAGVDEVARFALPKAEVAARLPALRDSLRA |
| Ga0268265_125321281 | 3300028380 | Switchgrass Rhizosphere | MVSSGPMDQIGVVGLSYRHAGADDIAGFTLPKDDVAARLAALRT |
| Ga0302227_102520142 | 3300028795 | Palsa | MVSFTLMDHIGVVGLSYRHASAEEVARFAIPKADIEVRLPELRAALG |
| Ga0308309_110831181 | 3300028906 | Soil | MHQIGVVGLSYRHAGVEDVARLSLPRAELSARLGHLRARLHA |
| Ga0311369_102253062 | 3300029910 | Palsa | MDHIGVVGLSYRHASVEDVARFAIPRADIEARLPELRVALQGA |
| Ga0311339_116652171 | 3300029999 | Palsa | MHQIGVVGLSYRHAGLEQVARFAVPRTEVPARLPGLRTHLKAAELLYVGT |
| Ga0311338_100178991 | 3300030007 | Palsa | MDHIGVVGLSYRHASVEDVARFAIPRADIEARLPELRVAL |
| Ga0302181_104463761 | 3300030056 | Palsa | MHQIGVVGLSYRHAGLEQVARFAVPRTEVPARLPGLRTHLKAAELLY |
| Ga0311370_100555191 | 3300030503 | Palsa | MVSFTLMDHIGVVGLSYRHASAEEVARFAIPKADIEARLPELRAA |
| Ga0311372_110131881 | 3300030520 | Palsa | MHQIGVVGLSYRHAGLEQVARFAVPRTEVPARLPGLRTHLKAAELLYVG |
| Ga0311357_114410392 | 3300030524 | Palsa | MHQIGVVGLSYRHVGVDEVARFALPKAEIAARLPA |
| Ga0311354_103185111 | 3300030618 | Palsa | MHQIGVVGLSYRHAGVEEVARLSLPRGEVGARLGHLRGELRAAELLYLGTC |
| Ga0302310_102311842 | 3300030737 | Palsa | MDHIGVVGLSYRHASVEDVARFAIPRADIEARLPELRVALQG |
| Ga0170824_1270227281 | 3300031231 | Forest Soil | MHQIGVVGLSYRHVGVDEVARFSVPKTEVAARLPALRDAL |
| Ga0170819_103272111 | 3300031469 | Forest Soil | MHQIGVVGLSYRHVGVDEVARFSVPKTEIAARLPAL |
| Ga0318516_104001151 | 3300031543 | Soil | MHQIGVVGLSYRHAGVDEVARFAVPRAEVPARLPALRALLKASE |
| Ga0318541_102052162 | 3300031545 | Soil | MHQIGVVGLSYRHAGVDEVARFAVPRAEVPARLPALRALLKASEILY |
| Ga0318574_108274441 | 3300031680 | Soil | MHQIGVVGLSYRHAGVDEIARLTLPRAELPQRLPVLRAQLAAAEVVY |
| Ga0310686_1098154801 | 3300031708 | Soil | MDHIGVVGLSYRHASVEDVARFAIPKADIEARLPELRAA |
| Ga0318496_104962231 | 3300031713 | Soil | MHQIGVVGLSYRHAGVDEVARFAMPRAEVPLRLPALRGLLKASEILYV |
| Ga0307476_112113292 | 3300031715 | Hardwood Forest Soil | MHQIGVVGLSYRHAGVDEVARFAVPRAEVPARLPALRALLKA |
| Ga0318501_101140773 | 3300031736 | Soil | MHQIGVVGLSYRHAGVDEVARFAVPRAEVPARLPALRTLLKASEI |
| Ga0307477_100326161 | 3300031753 | Hardwood Forest Soil | MHQIGVVGLSYRHAGVEEVARFAVPRAEVAVRLPELRSR |
| Ga0307475_105251981 | 3300031754 | Hardwood Forest Soil | MHQIGVVGLSYRHAGVEEVARFAVPRAELPARLPALRTLLK |
| Ga0318554_104314701 | 3300031765 | Soil | MHQIGVVGLSYRHVGVDEVARFSLPRADVPLRLPQLRAQLNGAEI |
| Ga0318509_100610401 | 3300031768 | Soil | MHQIGVVGVSYRHAAVEEVARFAVPRTEVAARLPALRA |
| Ga0318509_106393931 | 3300031768 | Soil | MHQIGVVGLSYRHAGVDEIARLTLPRAELPQRLPVLRAQLAAAEVVYLA |
| Ga0318543_101054601 | 3300031777 | Soil | MQQIGVVGLSYRHAGVDEVARFAVPRAEVPARLPALR |
| Ga0318543_105589052 | 3300031777 | Soil | MQQIGVVGLSYRHAGVEEVARFAVPRAEVPARLPALRA |
| Ga0318548_101924221 | 3300031793 | Soil | MDQIGVVGLSYRHAGVDEVARFAVPRAEVPARLSALRALLKASE |
| Ga0318565_100764553 | 3300031799 | Soil | MQQIGVVGLSYRHAGVDEVARFAVPRAEVPARLPALRALLKASEILYVGTSA |
| Ga0318565_100901271 | 3300031799 | Soil | MHQIGVVGLSYRHAGVDEVARFAVPRAEVPARLPALRALLKASEILYVGTCN |
| Ga0307473_108452992 | 3300031820 | Hardwood Forest Soil | MHQIGVVGLSYRHAGVEEVARFAVPRTEVPARLPELR |
| Ga0318567_102557021 | 3300031821 | Soil | MHQIGVVGLSYRHAGVDEIARLTLPRAELPQRLPVLRAQLAAAE |
| Ga0307478_100287105 | 3300031823 | Hardwood Forest Soil | MHQIGVVGLSYRHAGVEEVARFAVPRAEVPARLPALRALLKASEILY |
| Ga0318511_101332211 | 3300031845 | Soil | MHQIGVVGLSYRHAGVDEVARFAVPRAEVPARLPA |
| Ga0318511_103604371 | 3300031845 | Soil | MHQIGVVGLSYRHAGVDEVARFAVPRAEVPARLPALRALLRASEIL |
| Ga0318522_100637651 | 3300031894 | Soil | MHQIGVVGLSYRHAGVDEVARFAVPRAEVPARLPALRALLKASEILYVG |
| Ga0318520_103903081 | 3300031897 | Soil | MHQIGVVGLSYRHAGVDEVARFAVPRAEVPARLPALRALLKASEILYV |
| Ga0310912_101077931 | 3300031941 | Soil | MHQIGVVGLSYRHAGVEEVARFAVPRAEVPARLPAL |
| Ga0310909_101143244 | 3300031947 | Soil | MHQIGVVGLSYRHAGVDEVARFAVPRAEVPARLPALRALLKAAEILYVG |
| Ga0306926_123816802 | 3300031954 | Soil | MHQIGVVGLSHRHAGVDDVARFTLPKAELAARLRALR |
| Ga0318504_101300233 | 3300032063 | Soil | MHQIGVVGLSYRHAGVDEVARFAVPRAEVPARLPALRTLLKASEILYVG |
| Ga0318518_100994221 | 3300032090 | Soil | MQQIGVVGLSYRHAGVDEVARFAVPRAEVPARLPALRALL |
| Ga0306920_1016882321 | 3300032261 | Soil | MHQIGVVGLSYRHAGVDDVARFAVPRAEVPARLPALRGLLKAAEILYVGT |
| Ga0306920_1044103991 | 3300032261 | Soil | MHQIGVVGLSYRHAGVDEVARFAVPRAEVPARLPALRTLLRASEILYVS |
| Ga0335080_101586393 | 3300032828 | Soil | MHQIGVVGLSYRHAGVEEVARFSLPRAEVVSRIIALRSSLG |
| Ga0335081_100453141 | 3300032892 | Soil | MHQIGVVGLSYRHAGVDEVARFAVPRAEIAARLPELRVRLR |
| Ga0335072_106670403 | 3300032898 | Soil | MHQIGVVGLSYRHAGIDDVARLSIPRSDLEARLPSLREALGVSE |
| ⦗Top⦘ |