


| Basic Information | |
|---|---|
| Family ID | F049531 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 146 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MTSYGTQFRLVARGLVDYLAGIDPSAVGLVAALLLLIRSRGA |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 146 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 23.29 % |
| % of genes near scaffold ends (potentially truncated) | 45.89 % |
| % of genes from short scaffolds (< 2000 bps) | 75.34 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.890 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (32.877 % of family members) |
| Environment Ontology (ENVO) | Unclassified (60.959 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (70.548 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.29% β-sheet: 0.00% Coil/Unstructured: 45.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 146 Family Scaffolds |
|---|---|---|
| PF13361 | UvrD_C | 17.81 |
| PF00248 | Aldo_ket_red | 5.48 |
| PF00069 | Pkinase | 5.48 |
| PF03704 | BTAD | 4.79 |
| PF13432 | TPR_16 | 4.11 |
| PF01804 | Penicil_amidase | 3.42 |
| PF13437 | HlyD_3 | 2.74 |
| PF00873 | ACR_tran | 2.05 |
| PF13191 | AAA_16 | 1.37 |
| PF00892 | EamA | 1.37 |
| PF06127 | Mpo1-like | 1.37 |
| PF09365 | DUF2461 | 1.37 |
| PF14685 | Tricorn_PDZ | 0.68 |
| PF00072 | Response_reg | 0.68 |
| PF07729 | FCD | 0.68 |
| PF03795 | YCII | 0.68 |
| PF08546 | ApbA_C | 0.68 |
| PF00127 | Copper-bind | 0.68 |
| PF01641 | SelR | 0.68 |
| PF08532 | Glyco_hydro_42M | 0.68 |
| PF16576 | HlyD_D23 | 0.68 |
| PF03572 | Peptidase_S41 | 0.68 |
| PF00486 | Trans_reg_C | 0.68 |
| PF13302 | Acetyltransf_3 | 0.68 |
| PF13401 | AAA_22 | 0.68 |
| PF00355 | Rieske | 0.68 |
| PF13517 | FG-GAP_3 | 0.68 |
| PF05988 | DUF899 | 0.68 |
| PF13181 | TPR_8 | 0.68 |
| PF02738 | MoCoBD_1 | 0.68 |
| PF07690 | MFS_1 | 0.68 |
| PF13669 | Glyoxalase_4 | 0.68 |
| PF14310 | Fn3-like | 0.68 |
| PF09948 | DUF2182 | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 146 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 21.92 |
| COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 4.79 |
| COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 4.79 |
| COG2366 | Acyl-homoserine lactone (AHL) acylase PvdQ | Secondary metabolites biosynthesis, transport and catabolism [Q] | 3.42 |
| COG4539 | 2-hydroxy fatty acid dioxygenase MPO1 (alpha-oxidation of fatty acids) | Lipid transport and metabolism [I] | 1.37 |
| COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 0.68 |
| COG0793 | C-terminal processing protease CtpA/Prc, contains a PDZ domain | Posttranslational modification, protein turnover, chaperones [O] | 0.68 |
| COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.68 |
| COG1874 | Beta-galactosidase GanA | Carbohydrate transport and metabolism [G] | 0.68 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.68 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.68 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.68 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.89 % |
| Unclassified | root | N/A | 4.11 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002557|JGI25381J37097_1001173 | All Organisms → cellular organisms → Bacteria | 4112 | Open in IMG/M |
| 3300002557|JGI25381J37097_1035578 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300002560|JGI25383J37093_10175985 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300002562|JGI25382J37095_10066154 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
| 3300002562|JGI25382J37095_10263061 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300002908|JGI25382J43887_10000644 | All Organisms → cellular organisms → Bacteria | 12420 | Open in IMG/M |
| 3300002908|JGI25382J43887_10088930 | All Organisms → cellular organisms → Bacteria | 1648 | Open in IMG/M |
| 3300002911|JGI25390J43892_10019315 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1634 | Open in IMG/M |
| 3300002915|JGI25387J43893_1015847 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Zavarzinella → unclassified Zavarzinella → Zavarzinella sp. | 1034 | Open in IMG/M |
| 3300005166|Ga0066674_10004963 | All Organisms → cellular organisms → Bacteria | 5158 | Open in IMG/M |
| 3300005166|Ga0066674_10395209 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 642 | Open in IMG/M |
| 3300005166|Ga0066674_10542357 | Not Available | 518 | Open in IMG/M |
| 3300005171|Ga0066677_10097836 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
| 3300005172|Ga0066683_10091917 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1835 | Open in IMG/M |
| 3300005172|Ga0066683_10306617 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300005174|Ga0066680_10479079 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300005175|Ga0066673_10249836 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1027 | Open in IMG/M |
| 3300005175|Ga0066673_10487796 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300005176|Ga0066679_10073100 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2032 | Open in IMG/M |
| 3300005177|Ga0066690_10046535 | All Organisms → cellular organisms → Bacteria | 2623 | Open in IMG/M |
| 3300005180|Ga0066685_10289789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1132 | Open in IMG/M |
| 3300005180|Ga0066685_10843735 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300005181|Ga0066678_10362443 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300005186|Ga0066676_10458723 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 864 | Open in IMG/M |
| 3300005406|Ga0070703_10090335 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300005406|Ga0070703_10350726 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300005434|Ga0070709_11333243 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300005440|Ga0070705_100324797 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300005440|Ga0070705_100344574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1084 | Open in IMG/M |
| 3300005445|Ga0070708_100048235 | All Organisms → cellular organisms → Bacteria | 3764 | Open in IMG/M |
| 3300005450|Ga0066682_10833143 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 554 | Open in IMG/M |
| 3300005451|Ga0066681_10010388 | All Organisms → cellular organisms → Bacteria | 4515 | Open in IMG/M |
| 3300005451|Ga0066681_10062725 | All Organisms → cellular organisms → Bacteria | 2058 | Open in IMG/M |
| 3300005451|Ga0066681_10146614 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1384 | Open in IMG/M |
| 3300005536|Ga0070697_100703878 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300005553|Ga0066695_10012733 | All Organisms → cellular organisms → Bacteria | 4471 | Open in IMG/M |
| 3300005555|Ga0066692_10285350 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1045 | Open in IMG/M |
| 3300005555|Ga0066692_10756009 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300005557|Ga0066704_10041555 | All Organisms → cellular organisms → Bacteria | 2866 | Open in IMG/M |
| 3300005558|Ga0066698_10261599 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1195 | Open in IMG/M |
| 3300005561|Ga0066699_10042235 | All Organisms → cellular organisms → Bacteria | 2741 | Open in IMG/M |
| 3300005561|Ga0066699_10240803 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300005566|Ga0066693_10078168 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1159 | Open in IMG/M |
| 3300005586|Ga0066691_10351847 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300005586|Ga0066691_10514853 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300005587|Ga0066654_10005498 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 4420 | Open in IMG/M |
| 3300005587|Ga0066654_10012918 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3177 | Open in IMG/M |
| 3300006034|Ga0066656_10102470 | All Organisms → cellular organisms → Bacteria | 1741 | Open in IMG/M |
| 3300006046|Ga0066652_100021839 | All Organisms → cellular organisms → Bacteria | 4415 | Open in IMG/M |
| 3300006046|Ga0066652_100237790 | All Organisms → cellular organisms → Bacteria | 1588 | Open in IMG/M |
| 3300006046|Ga0066652_101364280 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 665 | Open in IMG/M |
| 3300006791|Ga0066653_10367185 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 732 | Open in IMG/M |
| 3300006796|Ga0066665_10414631 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300006797|Ga0066659_10265298 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1293 | Open in IMG/M |
| 3300006797|Ga0066659_10359881 | Not Available | 1132 | Open in IMG/M |
| 3300006800|Ga0066660_10344154 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 3300006804|Ga0079221_10183261 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300006804|Ga0079221_10286104 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300006806|Ga0079220_10005893 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4457 | Open in IMG/M |
| 3300006806|Ga0079220_10279052 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
| 3300006806|Ga0079220_11452432 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 585 | Open in IMG/M |
| 3300006806|Ga0079220_11548308 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300006854|Ga0075425_100428581 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1523 | Open in IMG/M |
| 3300006914|Ga0075436_100134774 | All Organisms → cellular organisms → Bacteria | 1733 | Open in IMG/M |
| 3300006954|Ga0079219_12083809 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300007255|Ga0099791_10010732 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3831 | Open in IMG/M |
| 3300009088|Ga0099830_10127753 | All Organisms → cellular organisms → Bacteria | 1931 | Open in IMG/M |
| 3300009137|Ga0066709_100032982 | All Organisms → cellular organisms → Bacteria | 5533 | Open in IMG/M |
| 3300009137|Ga0066709_104093166 | Not Available | 530 | Open in IMG/M |
| 3300010078|Ga0127487_113657 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Zavarzinella → unclassified Zavarzinella → Zavarzinella sp. | 774 | Open in IMG/M |
| 3300010081|Ga0127457_1015878 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Zavarzinella → unclassified Zavarzinella → Zavarzinella sp. | 815 | Open in IMG/M |
| 3300010111|Ga0127491_1019574 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 562 | Open in IMG/M |
| 3300010133|Ga0127459_1042418 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 752 | Open in IMG/M |
| 3300010142|Ga0127483_1172235 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 592 | Open in IMG/M |
| 3300010303|Ga0134082_10433722 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 566 | Open in IMG/M |
| 3300010321|Ga0134067_10007491 | All Organisms → cellular organisms → Bacteria | 2998 | Open in IMG/M |
| 3300010322|Ga0134084_10030566 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1504 | Open in IMG/M |
| 3300010323|Ga0134086_10325894 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 602 | Open in IMG/M |
| 3300010325|Ga0134064_10035941 | All Organisms → cellular organisms → Bacteria | 1472 | Open in IMG/M |
| 3300011269|Ga0137392_10254900 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Zavarzinella → unclassified Zavarzinella → Zavarzinella sp. | 1444 | Open in IMG/M |
| 3300011270|Ga0137391_10558025 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300012198|Ga0137364_10378900 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300012199|Ga0137383_10032144 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3688 | Open in IMG/M |
| 3300012200|Ga0137382_11068169 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 578 | Open in IMG/M |
| 3300012200|Ga0137382_11299886 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 513 | Open in IMG/M |
| 3300012201|Ga0137365_10028549 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 4298 | Open in IMG/M |
| 3300012203|Ga0137399_10130269 | All Organisms → cellular organisms → Bacteria | 1987 | Open in IMG/M |
| 3300012205|Ga0137362_10618947 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300012210|Ga0137378_10009632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 8382 | Open in IMG/M |
| 3300012211|Ga0137377_10750077 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 910 | Open in IMG/M |
| 3300012211|Ga0137377_11718181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300012350|Ga0137372_10793747 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 680 | Open in IMG/M |
| 3300012351|Ga0137386_11260668 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 514 | Open in IMG/M |
| 3300012360|Ga0137375_11455391 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 506 | Open in IMG/M |
| 3300012362|Ga0137361_10389644 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
| 3300012371|Ga0134022_1103014 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300012373|Ga0134042_1085705 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 620 | Open in IMG/M |
| 3300012379|Ga0134058_1211971 | Not Available | 551 | Open in IMG/M |
| 3300012403|Ga0134049_1181338 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 654 | Open in IMG/M |
| 3300012923|Ga0137359_11006693 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300012925|Ga0137419_10032766 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3201 | Open in IMG/M |
| 3300012944|Ga0137410_10522274 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 973 | Open in IMG/M |
| 3300012972|Ga0134077_10312189 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 662 | Open in IMG/M |
| 3300012972|Ga0134077_10537045 | Not Available | 522 | Open in IMG/M |
| 3300012976|Ga0134076_10509650 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 551 | Open in IMG/M |
| 3300014154|Ga0134075_10015132 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3014 | Open in IMG/M |
| 3300015054|Ga0137420_1254079 | All Organisms → cellular organisms → Bacteria | 1477 | Open in IMG/M |
| 3300015264|Ga0137403_10138553 | All Organisms → cellular organisms → Bacteria | 2409 | Open in IMG/M |
| 3300017657|Ga0134074_1386217 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 520 | Open in IMG/M |
| 3300017659|Ga0134083_10066487 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Zavarzinella → unclassified Zavarzinella → Zavarzinella sp. | 1380 | Open in IMG/M |
| 3300018433|Ga0066667_10032627 | All Organisms → cellular organisms → Bacteria | 2949 | Open in IMG/M |
| 3300018433|Ga0066667_11747447 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300018433|Ga0066667_12025723 | Not Available | 530 | Open in IMG/M |
| 3300018468|Ga0066662_10872391 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 881 | Open in IMG/M |
| 3300020170|Ga0179594_10004393 | All Organisms → cellular organisms → Bacteria | 3492 | Open in IMG/M |
| 3300021080|Ga0210382_10047003 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1686 | Open in IMG/M |
| 3300021086|Ga0179596_10592170 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300024182|Ga0247669_1000614 | All Organisms → cellular organisms → Bacteria | 13376 | Open in IMG/M |
| 3300024330|Ga0137417_1007937 | All Organisms → cellular organisms → Bacteria | 1801 | Open in IMG/M |
| 3300025885|Ga0207653_10011078 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2816 | Open in IMG/M |
| 3300025910|Ga0207684_10124506 | All Organisms → cellular organisms → Bacteria | 2211 | Open in IMG/M |
| 3300025922|Ga0207646_10050387 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3727 | Open in IMG/M |
| 3300025922|Ga0207646_10249251 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1604 | Open in IMG/M |
| 3300026296|Ga0209235_1199550 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 695 | Open in IMG/M |
| 3300026297|Ga0209237_1009592 | All Organisms → cellular organisms → Bacteria | 5798 | Open in IMG/M |
| 3300026298|Ga0209236_1314734 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300026300|Ga0209027_1107048 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 993 | Open in IMG/M |
| 3300026309|Ga0209055_1142546 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 850 | Open in IMG/M |
| 3300026310|Ga0209239_1133293 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300026312|Ga0209153_1000202 | All Organisms → cellular organisms → Bacteria | 32080 | Open in IMG/M |
| 3300026313|Ga0209761_1202727 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 868 | Open in IMG/M |
| 3300026314|Ga0209268_1012279 | All Organisms → cellular organisms → Bacteria | 3388 | Open in IMG/M |
| 3300026316|Ga0209155_1030685 | All Organisms → cellular organisms → Bacteria | 2182 | Open in IMG/M |
| 3300026316|Ga0209155_1040987 | All Organisms → cellular organisms → Bacteria | 1836 | Open in IMG/M |
| 3300026318|Ga0209471_1242405 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 629 | Open in IMG/M |
| 3300026323|Ga0209472_1019855 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3227 | Open in IMG/M |
| 3300026323|Ga0209472_1267293 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 545 | Open in IMG/M |
| 3300026326|Ga0209801_1152935 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 971 | Open in IMG/M |
| 3300026335|Ga0209804_1089979 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1425 | Open in IMG/M |
| 3300026542|Ga0209805_1236226 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300026547|Ga0209156_10042496 | All Organisms → cellular organisms → Bacteria | 2471 | Open in IMG/M |
| 3300026547|Ga0209156_10229475 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 873 | Open in IMG/M |
| 3300027671|Ga0209588_1142064 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 763 | Open in IMG/M |
| 3300027787|Ga0209074_10076345 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1085 | Open in IMG/M |
| 3300031720|Ga0307469_11716109 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300032180|Ga0307471_100999298 | All Organisms → cellular organisms → Bacteria → FCB group | 1003 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 32.88% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.49% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 14.38% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 13.70% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.53% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 5.48% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.42% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.37% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.37% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002915 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010078 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010081 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010111 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010133 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010142 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012371 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012373 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012379 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012403 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25381J37097_10011733 | 3300002557 | Grasslands Soil | MSPYGVQFRLVARGLVDYLAGIDPSGAGLVGTLLTLIRSRGVPXRRDXAAAPDQRAERP* |
| JGI25381J37097_10355782 | 3300002557 | Grasslands Soil | MTPYGTQFRLIARGLVDYLAGIDPSAVGLVGAVLLLIRSRGVTKRRAGRS* |
| JGI25383J37093_101759852 | 3300002560 | Grasslands Soil | MIAYGAHFRLIARGLADYLAGIDPSALGLAGALLTLIRSRGAAGGH* |
| JGI25382J37095_100661542 | 3300002562 | Grasslands Soil | MTPYGTQFRLIARGLVDYLAGIDPSAVGLVGALLVLMRSRGDPKRRDDTVP* |
| JGI25382J37095_102630611 | 3300002562 | Grasslands Soil | MLPYGVQFRLVARGLLDYLAGVDPSAVGLVGALLTLIRSPRRPR* |
| JGI25382J43887_100006447 | 3300002908 | Grasslands Soil | MTSYGTQFRLVARGLVDYLAGVDPSAVGLAGALLLLIRSRGVRGR* |
| JGI25382J43887_100889303 | 3300002908 | Grasslands Soil | MARYGTQFRLVAQGLVDYLAGIDPSAVGLVAALHILVRSRRG* |
| JGI25390J43892_100193152 | 3300002911 | Grasslands Soil | MTPYGTHFRLVARGLVDYLAGIDPSAVGLVAALLLLIRSRGAAGG |
| JGI25387J43893_10158472 | 3300002915 | Grasslands Soil | IMTAYGTQVRLVARGLVDYLAGIDPSAVGLVTALLTLIRRRSS* |
| Ga0066674_100049633 | 3300005166 | Soil | MTSYGTQFRLVARGLVDYLAGIDPSAVGLAGALLLLIRSRGIRGR* |
| Ga0066674_103952092 | 3300005166 | Soil | MTSYGTQFRLVARGLVDYLAGIDPSAVGLVGALLVLIRTRGVPKRRDDTVPPA* |
| Ga0066674_105423571 | 3300005166 | Soil | MTPYGTQVRLVARGLVDYLAGIDPSAVGLVTALLTLIRRRSS* |
| Ga0066677_100978362 | 3300005171 | Soil | MNSYGTQFRLVARGLVDYLAGIDPSAVGLVGALLTLIRSRGVPGGR* |
| Ga0066683_100919171 | 3300005172 | Soil | MTAYGAHFRLIARGLADYLAGIDPSAVGLVGALLILIRSRGRP* |
| Ga0066683_103066173 | 3300005172 | Soil | GTQFRLIARGLVDYLAGIDPSAVGLVGALLVLIRSRGDPKRRDDTVP* |
| Ga0066680_104790792 | 3300005174 | Soil | MTPYGTQFRLIARGLVDYLAGIDPSAVGLVGALLVLIRSRGDPKRRDDTVP* |
| Ga0066673_102498362 | 3300005175 | Soil | MNSYGTQFRLVARGLVDYLAGIDPSAVGLVGALLVLIRTRGVPKRRD |
| Ga0066673_104877961 | 3300005175 | Soil | MVPYGTQFRLVARGLVDYLAGIDPSAVGLVAALVVLIRSRGK* |
| Ga0066679_100731002 | 3300005176 | Soil | VHAGDYRNMSPYRTQFRLVARGLFDYLTGIDPSAVGLVGTLLTLIRSRGVSHRDD* |
| Ga0066690_100465351 | 3300005177 | Soil | MTAYGAHFRLIARGLADYLAGIDPSAVGLVGALLILIRAEGGLS |
| Ga0066685_102897893 | 3300005180 | Soil | VSAQFRLVARGLLDYLAGVDPSAVVLTGALLTLIPSRGVPKRHGESAAGDQRAERL* |
| Ga0066685_108437352 | 3300005180 | Soil | MVPYSTQFRLVARGLLDYLAGVDPSAVGLVGALLILIRSRGAPRG* |
| Ga0066678_103624433 | 3300005181 | Soil | MTVYGAQFRLVARGLVDYLAGIDPSATGLVGTLLTLIRSPRVPGRR |
| Ga0066676_104587232 | 3300005186 | Soil | MTPYGTQFRLIARGLVDYLAGIDPSAVGLVGALLVLIRSRGDPKRRD |
| Ga0070703_100903351 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRYGTQFGLVARGLVDYLAGIDPSAVGLVTAVLTLIRRRGS* |
| Ga0070703_103507262 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | AQFRLVARGLVDYLAGIDPSAVGLVAALLILVRSRGPTRRS* |
| Ga0070709_113332432 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSYRTQFRMVARGLVDYVAGIDPSAVGLVGALLMLIRSGRSPKP* |
| Ga0070705_1003247972 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MTAYGAQFRLVARGLVDYLAGIDPSAVGLVAALLILVRSRGPTRRS* |
| Ga0070705_1003445742 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MTAYSAQFRLLARGLVDYVAGIDPSAVGLTNALLSLIRSRGRSPSK* |
| Ga0070708_1000482356 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVYGAQFRLVARGLVDYLAGIDPSAAGLVGTLLTLFRSPRVPGRRDDTTGPSERD* |
| Ga0066682_108331431 | 3300005450 | Soil | MTSYGTQFRLVARGLVDYLAGVDPSAVGLVGALLLLIRSRGVRGR* |
| Ga0066681_100103881 | 3300005451 | Soil | MTAYGAHFRLIARGLADYLAGIDPSAVGLVGALLILIRAEGGLV* |
| Ga0066681_100627253 | 3300005451 | Soil | MTPYGTQFRLIARGLVDYLAGIDPSAVGLVGALLVLIRSRGDPKRRDETVP* |
| Ga0066681_101466142 | 3300005451 | Soil | MTPYGTQFRLIARGLVDYLAGIDPSAVGLVGAVLLLIRSRGVTKGRAGRS* |
| Ga0070697_1007038782 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MTAYGAQFRLVARGLVDYLAGIDPSAVGLVAALLMLVRSRGPTRRS* |
| Ga0066695_100127332 | 3300005553 | Soil | MTAYGAHFRLIARGLADYLAGIDPSAVGLVEHCSY* |
| Ga0066692_102853501 | 3300005555 | Soil | MTPYGTQFRLIARGLVDYLAGIDPSAVGLVGAVLLLIRSR |
| Ga0066692_107560092 | 3300005555 | Soil | MIAYGAHFRLIARGLADYLAGIDPSALGLVGALLTLIRSRGAAGGH* |
| Ga0066704_100415553 | 3300005557 | Soil | MTPYGTQFRLIARGLVDYLAGIDPSAVGLVGAVLLLIRSRAVTKRRAGRS* |
| Ga0066698_102615992 | 3300005558 | Soil | MTAYGAHFRLIARGLADYLAGIDPSAVGLVGALLN* |
| Ga0066699_100422351 | 3300005561 | Soil | MTAYGAHFRLIARGLADYLAGIDPSAVGLVGALLILIRAEGGLSL |
| Ga0066699_102408032 | 3300005561 | Soil | MTPYGAQFRLVARGVVDYLTGIDPSGAGLMGTLLTLIRR |
| Ga0066693_100781682 | 3300005566 | Soil | MTAYGAHFRLIARGLADYLAGIDPSAVGLVGALLILIR |
| Ga0066691_103518472 | 3300005586 | Soil | MARYGTQFRLVAQGLVDYLAGIDPSAVGLVAALHILVRSRGGTRD* |
| Ga0066691_105148532 | 3300005586 | Soil | MVARGLVDYVAGIDPSAVGLVGALLMLIRSGRSAKP* |
| Ga0066654_100054983 | 3300005587 | Soil | MTAYGAQFRLVARGLVDYLAGIDPSAVGLVGALLN* |
| Ga0066654_100129183 | 3300005587 | Soil | TAYGTQVRLVARGLVDYLAGIDPSAVGLVTALLTLIRRRSS* |
| Ga0066656_101024701 | 3300006034 | Soil | QFRLVARGLVDYLAGVDPSAVGLVGALLLLIRSRGVRGR* |
| Ga0066652_1000218393 | 3300006046 | Soil | FRLIARGLADYLAGIDPSAVGLVGALLILIRSRGRP* |
| Ga0066652_1002377902 | 3300006046 | Soil | MTSYGAQFRLVARGLVDYLAGIDPSAVGLVGALLVLIRTRGVPKRRDDTVPPA* |
| Ga0066652_1013642802 | 3300006046 | Soil | MTAYGTQVRLVARGLVDYLAGIDPSAVGLVTALLTLIRRRSS* |
| Ga0066653_103671851 | 3300006791 | Soil | FRLVARGLVDYLAGIDPSAVGLVGALLVLIRTRGVPKRRDDTVPPA* |
| Ga0066665_104146312 | 3300006796 | Soil | MTPYGTQFRLIARGLVDYLAGIDPSAVGLVGALLVLIRSRGDPKRRDDTGP* |
| Ga0066659_102652982 | 3300006797 | Soil | MTPYGTHFRLVARGLVDYLAGIDPSAVGLVAALLLLIRSRGAAGGR* |
| Ga0066659_103598811 | 3300006797 | Soil | HFRLIARGLADYLAGIDPSAVGLVGALLILIRSRGRP* |
| Ga0066660_103441542 | 3300006800 | Soil | MSPYGVQFGLVARGLVDYLAGIDPSGAGLVGTLLTLMRSRGVPGRRDDPAAPDQRAERP* |
| Ga0079221_101832612 | 3300006804 | Agricultural Soil | MTSYGTQFRMVARGLVDYVAGIDPSAVGLLGALLTLSERQGL* |
| Ga0079221_102861043 | 3300006804 | Agricultural Soil | MTAYSAQFRLLARGLVDYVAGIDPSAVGLTNALLALLRSRGRSPSK* |
| Ga0079220_100058937 | 3300006806 | Agricultural Soil | MTAYSAQFRLLARGLVDYVAGIDPSAVGLTNALLTLIRSRGRSPSK* |
| Ga0079220_102790522 | 3300006806 | Agricultural Soil | VEAFFIIGGMTSYRTQFRMVARGLVDYVAGIDPSAVGLVGALLMLIRSGRSPKP* |
| Ga0079220_114524322 | 3300006806 | Agricultural Soil | QLRLIARGLVDYIAGIDPSAVGLVGALPILIRSRTRR* |
| Ga0079220_115483081 | 3300006806 | Agricultural Soil | YRTQFRMVARGLVDYVAGIDPSAVGLVGALLMLIRSGRSPKA* |
| Ga0075425_1004285811 | 3300006854 | Populus Rhizosphere | MARYGTQFRLVAQGLVDYLAGIDPSALGLVAALQILVRS |
| Ga0075436_1001347743 | 3300006914 | Populus Rhizosphere | MVARGLVDYVAGIDPSAVGLVGALLMLIRSGRSPKP* |
| Ga0079219_120838092 | 3300006954 | Agricultural Soil | MTSYGTQFRMVARGLVDYVAGIDPSAVGLLGALLTLIRSGKGSKP* |
| Ga0099791_100107321 | 3300007255 | Vadose Zone Soil | MTAYGTQFRLVARGLVDYLAGIDPSAVGLVAALLTLIPSRGVSRRRDEAPVVTTESTRPKA* |
| Ga0099830_101277532 | 3300009088 | Vadose Zone Soil | MARYSTQFRLVAQGLVDYLAGIDPSAVGLIAALHILVRSRGADGRNVR* |
| Ga0066709_1000329823 | 3300009137 | Grasslands Soil | MTPYGTHFRLVARGLVDYLTGIDPSAVGLVAALLLLIRSRGAAGGR* |
| Ga0066709_1040931661 | 3300009137 | Grasslands Soil | MMAYGTQVRLVARGLVDYLAGIDPSAVGLVTALLTLIRRRSS* |
| Ga0127487_1136571 | 3300010078 | Grasslands Soil | GTQVRLVARGLVDYLAGIDPSAVGLVTALLTLIRRRSS* |
| Ga0127457_10158781 | 3300010081 | Grasslands Soil | QVRLVARGLVDYLAGIDPSAVGLVTALLTLIRRRSS* |
| Ga0127491_10195742 | 3300010111 | Grasslands Soil | MTPYGTQFRLIARGLVDYLAGIDPSAIGLVGALLVLIRSR |
| Ga0127459_10424182 | 3300010133 | Grasslands Soil | VRLVARGLVDYLAGIDPSAVGLVTALLTLIRRRSS* |
| Ga0127483_11722351 | 3300010142 | Grasslands Soil | RLVARGLVDYLAGIDPSAVGLVTALLTLIRRRSS* |
| Ga0134082_104337222 | 3300010303 | Grasslands Soil | MTPYGTQFRLIARGLVDYLAGIDPSAVGLVGALLVL |
| Ga0134067_100074911 | 3300010321 | Grasslands Soil | MTAYGAHFRLIARGLADYLAGIDPSAVGLVGALLIL |
| Ga0134084_100305661 | 3300010322 | Grasslands Soil | MTPYGAQFRLVARGLVDYLAGIDPSGAGLMGTLLTL |
| Ga0134086_103258942 | 3300010323 | Grasslands Soil | AYGTKVRLVARGLVDYLAGIDPSAVGLVTALLTLIRRRSS* |
| Ga0134064_100359412 | 3300010325 | Grasslands Soil | YGTQFRLVARGLVDYLAGIDPSAVGLVGALLVLIRTRGVPKRRDDTVPPA* |
| Ga0137392_102549002 | 3300011269 | Vadose Zone Soil | MTAYDTQLRLVARGLVDYLAGIDPSAVGLVTALTMLIRRRGS* |
| Ga0137391_105580252 | 3300011270 | Vadose Zone Soil | MARYATQFRLVAQGLVDYLAGIDPSAVGLVAALHILVRSRGADKRNAR* |
| Ga0137364_103789002 | 3300012198 | Vadose Zone Soil | MTPYGTQFRLIARGLVDYLAGIDPSAVGLVGALLVLIRSRGDPKRRDEPQA* |
| Ga0137383_100321442 | 3300012199 | Vadose Zone Soil | MTSYGTQFRLVARGLVDYLAGIDPSAVGLVGALLVLIRTRGVPKRRDDAVPPA* |
| Ga0137382_110681692 | 3300012200 | Vadose Zone Soil | YGTQVRLVARGLVDYLAGIDPSAVGLVTALLTLIRRRSS* |
| Ga0137382_112998862 | 3300012200 | Vadose Zone Soil | MTPYGTQFRLVARGLVDYLAGIDPSAVGLVAALLLLIRSRGAAGGR* |
| Ga0137365_100285493 | 3300012201 | Vadose Zone Soil | MTRYGTQFRLVARGLVDYLAGIDPSAVGLVAALLILIRSRGVPRRRDED* |
| Ga0137399_101302692 | 3300012203 | Vadose Zone Soil | MARYGTQFRLVAQGLVDYLAGIDPSAVGLVAALHILVRSAGATRK* |
| Ga0137362_106189471 | 3300012205 | Vadose Zone Soil | MTRYGTHFRLVARGLVDYLAGIDPSAVGLVGALLVLIRSRGVLKRRDRTVPPA* |
| Ga0137378_100096327 | 3300012210 | Vadose Zone Soil | MTSYGTQFRLVARGLVDYLAGIDPSAVGLVGALLVLIRTRGVPKRRDNAVPPA* |
| Ga0137377_107500771 | 3300012211 | Vadose Zone Soil | MTSYGTQFRLIARGLADYLAGIDPSAVGLVGALLILIR |
| Ga0137377_117181811 | 3300012211 | Vadose Zone Soil | MTSYGAQFRLVARGLVDYLAGIDPSGAGLMGTLLTL |
| Ga0137372_107937472 | 3300012350 | Vadose Zone Soil | RLVARGLVDYLAGIDPSAVGLVAALLILIRSRDVPSRHDGS* |
| Ga0137386_112606682 | 3300012351 | Vadose Zone Soil | MTSYGTQFRLIARGLADYLAGIDPSAVGLVGALLTLIRSR |
| Ga0137375_114553912 | 3300012360 | Vadose Zone Soil | VHYWSMTPYGAQVRLVARGLVDYLAGIDPSAVGLVAALLILIRSRDVPSRHDGS* |
| Ga0137361_103896443 | 3300012362 | Vadose Zone Soil | MTRYGTHFRLVARGLVDYLAGIDPSAVGLVGALLVLIRSRGVLKRWDRTVPPA* |
| Ga0134022_11030142 | 3300012371 | Grasslands Soil | TQFRLVARGLVDYLAGVDPSAVGLVGALLLLIRSRGIRGR* |
| Ga0134042_10857052 | 3300012373 | Grasslands Soil | AHFRLIARGLADYLAGIDPSAVGLVGALLILIRSRGRP* |
| Ga0134058_12119711 | 3300012379 | Grasslands Soil | TQVRLVARGLVDYLAGIDPSAVGLVTALLTLIRRRSS* |
| Ga0134049_11813382 | 3300012403 | Grasslands Soil | GAHFRLIARGLADYLAGIDPSAVGLVGALLILIRSRGRP* |
| Ga0137359_110066931 | 3300012923 | Vadose Zone Soil | MARYGTQFRLVAQGLVDYLAGIDPSAVGLVAALHILVRSRSTRSRN* |
| Ga0137419_100327661 | 3300012925 | Vadose Zone Soil | MLAYSAQFRLIARGLADYLAGIDPSAVGLVAALLTLVPSRGVPRHHAEDTTPNQPT* |
| Ga0137410_105222742 | 3300012944 | Vadose Zone Soil | MTAYGTQFRLVARGLVDYLAGIDPSALGLVAALLTLIPSRGVSRRRDEAPVVTTE |
| Ga0134077_103121891 | 3300012972 | Grasslands Soil | MIAYGAHFRLIARGLADYLAGIDPSALGLVGALLTLIRSRGADGGH* |
| Ga0134077_105370451 | 3300012972 | Grasslands Soil | MTAYGTQVRLVARGLVDYLAGIDPSAVGLVTALLTLIRKRSS* |
| Ga0134076_105096501 | 3300012976 | Grasslands Soil | MTAYGTQVRLVARGLVDYLAGIDPSAVGLVTALLTLIRRRGS* |
| Ga0134075_100151323 | 3300014154 | Grasslands Soil | MIAYGAHFRLIARGLADYLAGIDPSAVGLVGALLTLIRSRGAAGGH* |
| Ga0137420_12540791 | 3300015054 | Vadose Zone Soil | MTAYGVQFRFVARGLVDYLAGIDPSALGLVAALRILLR |
| Ga0137403_101385532 | 3300015264 | Vadose Zone Soil | MRAYGAQLRLVARGLVDYLAGIDPSAVGLVAALLILVRSRGPSRRR* |
| Ga0134074_13862172 | 3300017657 | Grasslands Soil | MTSYGTQFRLVARGLVDYLAGIDPSAVGLVAALLLLIRSRGA |
| Ga0134083_100664871 | 3300017659 | Grasslands Soil | GTQVRLVARGLEDYLAGIDPSAVELVTALLTLIRRRSS |
| Ga0066667_100326271 | 3300018433 | Grasslands Soil | MTAYGAHFRLIARGLADYLAGIDPSAVGLVGALLILIRSRGRP |
| Ga0066667_117474471 | 3300018433 | Grasslands Soil | MTPYGAQFRLVARGLVDYLAGIDPSGAGLMGTLLT |
| Ga0066667_120257231 | 3300018433 | Grasslands Soil | MMAYGTQVRLVARGLVDYLAGIDPSAVGLVTALLTLIRRRSS |
| Ga0066662_108723912 | 3300018468 | Grasslands Soil | MIAYGAHFRLIARGLADYLAGIDPSALGLVGALLTLIRSRGAAGGH |
| Ga0179594_100043933 | 3300020170 | Vadose Zone Soil | MARYGTQFRLVAQGLVDYLAGIDPSAVGLVAALHILVRSRGGTRD |
| Ga0210382_100470034 | 3300021080 | Groundwater Sediment | KTMTAYGAQFRLVARGLVDYLAGIDPSALGLVAALLMLVRSRSPTQRR |
| Ga0179596_105921702 | 3300021086 | Vadose Zone Soil | MTRYATQFRLVAQGLVDYLAGIDPSAVGLVAALHILVRSRGGDRRNA |
| Ga0247669_10006141 | 3300024182 | Soil | SYGTQFRMVARGLVDYVAGIDPSAVGLVGALLMLIRSGRPKP |
| Ga0137417_10079372 | 3300024330 | Vadose Zone Soil | MARYGTQFRLVAQGLVDYLAGIDPSAVGLVAALHILVRSAGATRK |
| Ga0207653_100110782 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVYGAQFRLVARGLVDYLAGIDPSAAGLVGTLLTLIRSPRVSGRRDDATGPSERD |
| Ga0207684_101245066 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVYGAQFRLVARGLVDYLAGIDPSAAGLVGTLLTLIRSP |
| Ga0207646_100503872 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVYGAQFRLVARGLVDYLAGIDPSATGLVGTLLTLIRSPRVPGRRDEATGPSERD |
| Ga0207646_102492514 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVYGAQFRLVARGLVDYLAGIDPSAAGLVGTLLTLFRSPRVPGRRDDTTGPSERD |
| Ga0209235_11995502 | 3300026296 | Grasslands Soil | MIAYGAHFRLIARGLADYLAGIDPSALGLAGALLTLIRSRGAAGGH |
| Ga0209237_10095923 | 3300026297 | Grasslands Soil | MTAYGTQVRLVARGLVDYLAGIDPSAVGLVTALLTLIRRRSS |
| Ga0209236_13147341 | 3300026298 | Grasslands Soil | MTRYGTHFRLVARGLVDYLAGIDPSAVGLVGALLVLIRSRGVLKRRDRTVPPA |
| Ga0209027_11070481 | 3300026300 | Grasslands Soil | MTPYGTHFRLVARGLVDYLAGIDPSAVGLVAALLLLIRSRGAAGGR |
| Ga0209055_11425463 | 3300026309 | Soil | VSAQLRLIARGLVDYIAGIDPSAVGLVGALTILIRSR |
| Ga0209239_11332931 | 3300026310 | Grasslands Soil | SYGTQFRLVARGLVDYLAGIDPSAVGLVGALLTLIRSRGVPGGR |
| Ga0209153_10002023 | 3300026312 | Soil | MNSYGTQFRLVARGLVDYLAGIDPSAVGLVGALLTLIRSRGVPGGR |
| Ga0209761_12027271 | 3300026313 | Grasslands Soil | MTPYGAQFRLVARGLVDYLAGIDPSAVGLVGALLILIRSRSAPRGHDEATVAL |
| Ga0209268_10122792 | 3300026314 | Soil | MTPYGTQFRLIARGLVDYLAGIDPSAVGLVGALLVLIRSRGDPKRRDDTVP |
| Ga0209155_10306853 | 3300026316 | Soil | MTPYGTQFRLIARGLVDYLAGIDPSAVGLVGALLVLIRSRGDPKRRDETVP |
| Ga0209155_10409871 | 3300026316 | Soil | TQVRLVARGLVDYLAGIDPSAVGLVTALLTLIRRRSS |
| Ga0209471_12424052 | 3300026318 | Soil | MTVYGAQFRLVARGLVDYLAGIDPSATGLVGTLLTLIRSPRVPGRRDDATGPSERD |
| Ga0209472_10198552 | 3300026323 | Soil | MTPYGTQFRLIARGLVDYLAGIDPSAVGLVGAVLL |
| Ga0209472_12672932 | 3300026323 | Soil | MTAYGTQVRLVARGLVDYLAGIDPSAVGLVTALLTL |
| Ga0209801_11529351 | 3300026326 | Soil | MTVYGAQFRLVARGLVDYLAGIDPSATGLVGTLLTLIRSPRVPGRRDD |
| Ga0209804_10899792 | 3300026335 | Soil | AYGAHFRLIARGLADYLAGIDPSAVGLVGALLILIRSRGRP |
| Ga0209805_12362262 | 3300026542 | Soil | MTPYGTQFRLIARGLVDYLAGIDPSAVGLVGAVLLLIRSRGVTKRRAGRS |
| Ga0209156_100424963 | 3300026547 | Soil | GAHFRLIARGLADYLAGIDPSAVGLVGALLILIRSRGRP |
| Ga0209156_102294754 | 3300026547 | Soil | AYGAQFRLVARGLVDYLAGIDPSAVGLVGALLILIRSRGRP |
| Ga0209588_11420641 | 3300027671 | Vadose Zone Soil | MTAYGTQFRLVARGLVDYLAGIDPSAVGLVAALHILVRSRGADRRNAR |
| Ga0209074_100763451 | 3300027787 | Agricultural Soil | GMTAYSAQFRLLARGLVDYVAGIDPSAVGLTNALLALLRSRGRSPSK |
| Ga0307469_117161091 | 3300031720 | Hardwood Forest Soil | QFRLVARGLVDYLAGIDPSAVGLVAALLILVRSRGPTRRS |
| Ga0307471_1009992982 | 3300032180 | Hardwood Forest Soil | MTSYRTQFRMVARGLVDYVAGIDPSAVGLVGALLMLIR |
| ⦗Top⦘ |