


| Basic Information | |
|---|---|
| Family ID | F049440 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 146 |
| Average Sequence Length | 43 residues |
| Representative Sequence | VPGTDDPSTPPSSTDSTVDEDRLPRSHRCRSQRLDGFYDREPAARC |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 146 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 97.95 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 82.88 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.13 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (84.932 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment (32.877 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.137 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) (32.877 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.13 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 84.93 % |
| All Organisms | root | All Organisms | 15.07 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300006939|Ga0081244_1525471 | Not Available | 1439 | Open in IMG/M |
| 3300007219|Ga0075025_1330719 | Not Available | 924 | Open in IMG/M |
| 3300007219|Ga0075025_1340115 | Not Available | 525 | Open in IMG/M |
| 3300009580|Ga0115596_1114816 | Not Available | 579 | Open in IMG/M |
| 3300009586|Ga0115591_1122441 | Not Available | 581 | Open in IMG/M |
| 3300010082|Ga0127469_193900 | Not Available | 1018 | Open in IMG/M |
| 3300010085|Ga0127445_1063921 | Not Available | 2272 | Open in IMG/M |
| 3300010090|Ga0127471_1095981 | Not Available | 1195 | Open in IMG/M |
| 3300010103|Ga0127500_1011511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20 | 615 | Open in IMG/M |
| 3300010116|Ga0127466_1117127 | Not Available | 2262 | Open in IMG/M |
| 3300010117|Ga0127449_1106458 | Not Available | 605 | Open in IMG/M |
| 3300010120|Ga0127451_1066414 | Not Available | 2277 | Open in IMG/M |
| 3300010138|Ga0115595_1031015 | Not Available | 2318 | Open in IMG/M |
| 3300010139|Ga0127464_1128033 | Not Available | 2270 | Open in IMG/M |
| 3300010144|Ga0115593_1259006 | Not Available | 564 | Open in IMG/M |
| 3300010147|Ga0126319_1628573 | Not Available | 517 | Open in IMG/M |
| 3300010154|Ga0127503_10233587 | Not Available | 1719 | Open in IMG/M |
| 3300010154|Ga0127503_10554981 | Not Available | 922 | Open in IMG/M |
| 3300010154|Ga0127503_10726791 | Not Available | 510 | Open in IMG/M |
| 3300010861|Ga0126349_1007920 | Not Available | 502 | Open in IMG/M |
| 3300010861|Ga0126349_1065710 | Not Available | 2297 | Open in IMG/M |
| 3300012212|Ga0150985_120023141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20 | 2178 | Open in IMG/M |
| 3300012374|Ga0134039_1203840 | Not Available | 502 | Open in IMG/M |
| 3300012405|Ga0134041_1363357 | Not Available | 696 | Open in IMG/M |
| 3300012469|Ga0150984_100012680 | Not Available | 634 | Open in IMG/M |
| 3300012469|Ga0150984_119415595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20 | 2320 | Open in IMG/M |
| 3300019208|Ga0180110_1015330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20 | 1760 | Open in IMG/M |
| 3300019208|Ga0180110_1195313 | Not Available | 2318 | Open in IMG/M |
| 3300019212|Ga0180106_1070652 | Not Available | 2350 | Open in IMG/M |
| 3300019212|Ga0180106_1128684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20 | 2297 | Open in IMG/M |
| 3300019212|Ga0180106_1276834 | Not Available | 500 | Open in IMG/M |
| 3300019212|Ga0180106_1300660 | Not Available | 647 | Open in IMG/M |
| 3300019228|Ga0180119_1194177 | Not Available | 1421 | Open in IMG/M |
| 3300019228|Ga0180119_1207042 | Not Available | 525 | Open in IMG/M |
| 3300019229|Ga0180116_1076104 | Not Available | 900 | Open in IMG/M |
| 3300019229|Ga0180116_1082901 | Not Available | 575 | Open in IMG/M |
| 3300019229|Ga0180116_1093351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20 | 945 | Open in IMG/M |
| 3300019229|Ga0180116_1123147 | Not Available | 722 | Open in IMG/M |
| 3300019232|Ga0180114_1087274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20 | 612 | Open in IMG/M |
| 3300019233|Ga0184645_1048388 | Not Available | 506 | Open in IMG/M |
| 3300019233|Ga0184645_1307068 | Not Available | 990 | Open in IMG/M |
| 3300019233|Ga0184645_1349867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20 | 1577 | Open in IMG/M |
| 3300019238|Ga0180112_1131593 | Not Available | 2166 | Open in IMG/M |
| 3300019241|Ga0187793_1019595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20 | 1176 | Open in IMG/M |
| 3300019241|Ga0187793_1031182 | Not Available | 2304 | Open in IMG/M |
| 3300019248|Ga0180117_1169207 | Not Available | 905 | Open in IMG/M |
| 3300019248|Ga0180117_1173366 | Not Available | 536 | Open in IMG/M |
| 3300019248|Ga0180117_1191206 | Not Available | 1235 | Open in IMG/M |
| 3300019249|Ga0184648_1295401 | Not Available | 1179 | Open in IMG/M |
| 3300019249|Ga0184648_1310087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20 | 939 | Open in IMG/M |
| 3300019249|Ga0184648_1519492 | Not Available | 614 | Open in IMG/M |
| 3300019254|Ga0184641_1251520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20 | 867 | Open in IMG/M |
| 3300019255|Ga0184643_1132449 | Not Available | 2265 | Open in IMG/M |
| 3300019255|Ga0184643_1203635 | Not Available | 1712 | Open in IMG/M |
| 3300019257|Ga0180115_1006737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20 | 1710 | Open in IMG/M |
| 3300019259|Ga0184646_1220160 | Not Available | 689 | Open in IMG/M |
| 3300019263|Ga0184647_1130129 | Not Available | 1042 | Open in IMG/M |
| 3300019269|Ga0184644_1066896 | Not Available | 648 | Open in IMG/M |
| 3300019279|Ga0184642_1169699 | Not Available | 2021 | Open in IMG/M |
| 3300019279|Ga0184642_1533414 | Not Available | 1377 | Open in IMG/M |
| 3300020063|Ga0180118_1070762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20 | 537 | Open in IMG/M |
| 3300020063|Ga0180118_1336785 | Not Available | 982 | Open in IMG/M |
| 3300020064|Ga0180107_1143380 | Not Available | 2316 | Open in IMG/M |
| 3300020064|Ga0180107_1305080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20 | 1793 | Open in IMG/M |
| 3300020065|Ga0180113_1044189 | Not Available | 2314 | Open in IMG/M |
| 3300020065|Ga0180113_1259260 | Not Available | 873 | Open in IMG/M |
| 3300020065|Ga0180113_1418128 | Not Available | 505 | Open in IMG/M |
| 3300020066|Ga0180108_1238407 | Not Available | 1414 | Open in IMG/M |
| 3300020067|Ga0180109_1030550 | Not Available | 511 | Open in IMG/M |
| 3300020067|Ga0180109_1101740 | Not Available | 901 | Open in IMG/M |
| 3300020067|Ga0180109_1225432 | Not Available | 1780 | Open in IMG/M |
| 3300020067|Ga0180109_1434842 | Not Available | 1796 | Open in IMG/M |
| 3300020068|Ga0184649_1124301 | Not Available | 2297 | Open in IMG/M |
| 3300020068|Ga0184649_1364284 | Not Available | 583 | Open in IMG/M |
| 3300020069|Ga0197907_10224549 | Not Available | 2353 | Open in IMG/M |
| 3300020075|Ga0206349_1077449 | Not Available | 2351 | Open in IMG/M |
| 3300020076|Ga0206355_1160957 | Not Available | 2340 | Open in IMG/M |
| 3300020077|Ga0206351_10080423 | Not Available | 1193 | Open in IMG/M |
| 3300020078|Ga0206352_10036093 | Not Available | 537 | Open in IMG/M |
| 3300020080|Ga0206350_10675852 | Not Available | 516 | Open in IMG/M |
| 3300021257|Ga0210329_142972 | Not Available | 1696 | Open in IMG/M |
| 3300021258|Ga0210345_131042 | Not Available | 1011 | Open in IMG/M |
| 3300021307|Ga0179585_1027069 | Not Available | 524 | Open in IMG/M |
| 3300021307|Ga0179585_1035833 | Not Available | 1501 | Open in IMG/M |
| 3300021307|Ga0179585_1076154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20 | 1173 | Open in IMG/M |
| 3300021315|Ga0179958_1095234 | Not Available | 2243 | Open in IMG/M |
| 3300021315|Ga0179958_1171348 | Not Available | 1321 | Open in IMG/M |
| 3300021853|Ga0210323_1079410 | Not Available | 2353 | Open in IMG/M |
| 3300021856|Ga0213850_1028775 | Not Available | 1206 | Open in IMG/M |
| 3300021858|Ga0213852_1459382 | Not Available | 537 | Open in IMG/M |
| 3300021859|Ga0210334_10269454 | Not Available | 2348 | Open in IMG/M |
| 3300021938|Ga0213847_1065923 | Not Available | 1365 | Open in IMG/M |
| 3300021947|Ga0213856_1024346 | Not Available | 571 | Open in IMG/M |
| 3300021947|Ga0213856_1044674 | Not Available | 898 | Open in IMG/M |
| 3300021947|Ga0213856_1124310 | Not Available | 670 | Open in IMG/M |
| 3300021947|Ga0213856_1127568 | Not Available | 586 | Open in IMG/M |
| 3300022195|Ga0222625_1199274 | Not Available | 580 | Open in IMG/M |
| 3300022195|Ga0222625_1255961 | Not Available | 967 | Open in IMG/M |
| 3300030546|Ga0247646_1004640 | Not Available | 1402 | Open in IMG/M |
| 3300030552|Ga0247654_1106856 | Not Available | 615 | Open in IMG/M |
| 3300030905|Ga0308200_1030495 | Not Available | 921 | Open in IMG/M |
| 3300030987|Ga0308155_1038139 | Not Available | 502 | Open in IMG/M |
| 3300030990|Ga0308178_1022151 | Not Available | 1018 | Open in IMG/M |
| 3300030990|Ga0308178_1127486 | Not Available | 566 | Open in IMG/M |
| 3300030993|Ga0308190_1015445 | Not Available | 1184 | Open in IMG/M |
| 3300030993|Ga0308190_1016741 | Not Available | 1153 | Open in IMG/M |
| 3300030997|Ga0073997_12155605 | Not Available | 548 | Open in IMG/M |
| 3300030997|Ga0073997_12167259 | Not Available | 503 | Open in IMG/M |
| 3300030997|Ga0073997_12232505 | Not Available | 1689 | Open in IMG/M |
| 3300030997|Ga0073997_12260643 | Not Available | 516 | Open in IMG/M |
| 3300031058|Ga0308189_10155064 | Not Available | 790 | Open in IMG/M |
| 3300031082|Ga0308192_1015222 | Not Available | 950 | Open in IMG/M |
| 3300031082|Ga0308192_1018028 | Not Available | 894 | Open in IMG/M |
| 3300031099|Ga0308181_1103471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20 | 618 | Open in IMG/M |
| 3300031100|Ga0308180_1007948 | Not Available | 885 | Open in IMG/M |
| 3300031114|Ga0308187_10125275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20 | 829 | Open in IMG/M |
| 3300031114|Ga0308187_10216026 | Not Available | 679 | Open in IMG/M |
| 3300031114|Ga0308187_10248140 | Not Available | 646 | Open in IMG/M |
| 3300031114|Ga0308187_10406582 | Not Available | 539 | Open in IMG/M |
| 3300031123|Ga0308195_1002586 | Not Available | 1694 | Open in IMG/M |
| 3300031123|Ga0308195_1011006 | Not Available | 992 | Open in IMG/M |
| 3300031231|Ga0170824_114751978 | Not Available | 780 | Open in IMG/M |
| 3300031231|Ga0170824_128045043 | Not Available | 572 | Open in IMG/M |
| 3300031421|Ga0308194_10014216 | Not Available | 1616 | Open in IMG/M |
| 3300031424|Ga0308179_1003257 | Not Available | 1281 | Open in IMG/M |
| 3300031469|Ga0170819_10759496 | Not Available | 816 | Open in IMG/M |
| 3300031677|Ga0307480_1001623 | Not Available | 1127 | Open in IMG/M |
| 3300034447|Ga0370544_01769 | Not Available | 1365 | Open in IMG/M |
| 3300034448|Ga0370540_09335 | Not Available | 607 | Open in IMG/M |
| 3300034643|Ga0370545_002009 | Not Available | 2323 | Open in IMG/M |
| 3300034661|Ga0314782_046926 | Not Available | 848 | Open in IMG/M |
| 3300034662|Ga0314783_019734 | Not Available | 1080 | Open in IMG/M |
| 3300034662|Ga0314783_025341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20 | 989 | Open in IMG/M |
| 3300034662|Ga0314783_031205 | Not Available | 922 | Open in IMG/M |
| 3300034662|Ga0314783_110279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20 | 597 | Open in IMG/M |
| 3300034664|Ga0314786_005184 | Not Available | 1674 | Open in IMG/M |
| 3300034664|Ga0314786_019106 | Not Available | 1080 | Open in IMG/M |
| 3300034665|Ga0314787_033119 | Not Available | 793 | Open in IMG/M |
| 3300034666|Ga0314788_028502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20 | 989 | Open in IMG/M |
| 3300034666|Ga0314788_037876 | Not Available | 901 | Open in IMG/M |
| 3300034666|Ga0314788_198046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20 | 517 | Open in IMG/M |
| 3300034667|Ga0314792_045205 | Not Available | 951 | Open in IMG/M |
| 3300034668|Ga0314793_082708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20 | 644 | Open in IMG/M |
| 3300034671|Ga0314796_005708 | Not Available | 1664 | Open in IMG/M |
| 3300034674|Ga0314799_008432 | Not Available | 963 | Open in IMG/M |
| 3300034680|Ga0370541_057899 | Not Available | 519 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 32.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 10.27% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.85% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 6.16% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 4.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.11% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.42% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 2.74% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 2.74% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.74% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.05% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.37% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.37% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.37% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.68% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.68% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300006939 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A10 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300007219 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaT_SC_2013 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009580 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_11_14_C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009586 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_11_14_A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010082 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010085 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010090 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010103 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010116 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010117 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010120 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010138 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_11_14_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010139 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010144 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_11_14_C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010861 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012374 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012405 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300019208 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT231_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019212 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT25_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019228 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT790_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019229 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_1_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019232 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT530_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019233 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019238 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT466_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019241 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019248 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_2_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019249 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019254 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019257 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019263 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020063 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020064 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT27_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020065 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT499_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020066 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT45_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020067 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT47_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020068 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
| 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021257 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.272 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021258 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.445 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021307 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021315 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_2_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021853 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.189 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021856 | Metatranscriptome of freshwater microbial communities from post-fracked creek in Pennsylvania, United States - LL:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021859 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.306 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021938 | Metatranscriptome of freshwater microbial communities from pre-fracked creek in Pennsylvania, United States - EE:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021947 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - G-2016_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030546 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb11 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030552 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db7 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030905 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030987 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_144 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030997 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031082 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_193 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031100 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_151 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031123 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_196 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031424 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_150 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031677 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034447 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_119 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034448 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_115 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034643 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034661 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034662 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034664 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034665 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034666 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034667 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034668 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034671 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034674 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034680 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_116 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0081244_15254711 | 3300006939 | Tropical Rainforest Soil | MSVSSTSSTVDKDRLPCSHRCQSQRLDGFYNRESVAR |
| Ga0075025_13307191 | 3300007219 | Watersheds | MPPSSTDSAVDEDGLPRSHRCRTQRLDGFYDREFVARC |
| Ga0075025_13401151 | 3300007219 | Watersheds | MPGTDDPSTPPSSTDPTVDEDRLPRSHRCQSQRLDGFYDREPAAR |
| Ga0115596_11148162 | 3300009580 | Wetland | VPGTDDPSTPPSSTDSTVDEDRLPRSHRCQSQRLDGFYDRELAARC |
| Ga0115591_11224411 | 3300009586 | Wetland | VPGTDDPSTPPSSTDSTVDEDRLPRSHRCQSQRLDGFYDRELAARCA |
| Ga0127469_1939001 | 3300010082 | Grasslands Soil | VPGTDDPSTPSSSIDSAVDEDRLPRSHRCRSQRPYGFYDR |
| Ga0127445_10639211 | 3300010085 | Grasslands Soil | VPGTDDPSTPSSSIDSAVDEDRLPRSHRCRSQRPYGFYDREPA |
| Ga0127471_10959812 | 3300010090 | Grasslands Soil | VPGTDDPSTPSSSIDSAVDEDRLPRSHRCRSQRPYGFYDREPAAR |
| Ga0127500_10115111 | 3300010103 | Grasslands Soil | MPPSSTDSAVDENRLSRSHRCQSQRLNGFYDRESVAR |
| Ga0127466_11171271 | 3300010116 | Grasslands Soil | VPGTDDPSTPSSSIDSAVDEDRLPRSHRCRSQRPYGFYD |
| Ga0127449_11064581 | 3300010117 | Grasslands Soil | MPGTDDPSMPARSTDSAVDEDRLPRSHRCQSQRLNGFYDR |
| Ga0127451_10664141 | 3300010120 | Grasslands Soil | VPGTDDPSTPSSSIDSAVDEDRLPRSHRCRSQRPYGFYDREPAA |
| Ga0115595_10310151 | 3300010138 | Wetland | VPGTDDPSTPPSSTDSTVDEDRLPRSHRCQSQRLDGFYDRELAA |
| Ga0127464_11280331 | 3300010139 | Grasslands Soil | VPGTDDPSTPSSSIDSAVDEDRLPRSHRCRSQRLDGCYDRES |
| Ga0115593_12590062 | 3300010144 | Wetland | VPGTDDPSTPPSSTDSTVDEDRLPRSHRCQSQRLDGFYDRE |
| Ga0126319_16285731 | 3300010147 | Soil | VPGTDDPSTPPSSTDSTVDEDRLPRSHRCRTQRLDGFYDRESVARC |
| Ga0127503_102335871 | 3300010154 | Soil | VPRTDDLSTPPSSTDSTVDEDRLPRSHRCRTQRLDGFYDREPAA |
| Ga0127503_105549811 | 3300010154 | Soil | MPPSSTDSAVDEDGLPRSHRCRTQRLDGFYDREFV |
| Ga0127503_107267911 | 3300010154 | Soil | MPGTDDPSTPTSSTSSAVDEVCLPRSHRCQSQRLDGFYDRE |
| Ga0126349_10079201 | 3300010861 | Boreal Forest Soil | VPGADDPSTPPRSIGSAVDEDRLPRSYRYRSQRLDGFYDREL |
| Ga0126349_10657101 | 3300010861 | Boreal Forest Soil | MPGADDPSTPASSTGSTVDEDRLPRSHRCRLQRLDGFYDRELAARCA |
| Ga0150985_1200231413 | 3300012212 | Avena Fatua Rhizosphere | MPGTDDPSTPTSSTDSAVDEDKLPRSHRCRSQRLDGFYDRESAARCA |
| Ga0134039_12038401 | 3300012374 | Grasslands Soil | MPPSSTDSAVDENRLSRSHRCQSQRLNGFYDRESVARC |
| Ga0134041_13633571 | 3300012405 | Grasslands Soil | MPPSSPDSAVDEDGLPRSHRCRTQRLDGFYDREFVA |
| Ga0150984_1000126801 | 3300012469 | Avena Fatua Rhizosphere | VPGTDDPSTPPSSTDSAVDGNRLSRSHRCRTQRLDGFYDREPAAR |
| Ga0150984_1194155954 | 3300012469 | Avena Fatua Rhizosphere | MPGTDDPSTPTSSTDSAVDEDRLPRSHRCRSQRLDGFYDRESAARCA |
| Ga0180110_10153303 | 3300019208 | Groundwater Sediment | VPGTDDPSTPPSSTDLTVDEDRLPRSHQCRTQRLDGFYDREPAARCA |
| Ga0180110_11953131 | 3300019208 | Groundwater Sediment | VPGTDDPSTPVSSPDPAVDEDRLPRSHWCRTQRLDGFYDREPAARCA |
| Ga0180106_10706521 | 3300019212 | Groundwater Sediment | VPGTDDPSTPESSISPAVDENRLSRSHWYRSQRLDGFYNREPAARCA |
| Ga0180106_11286842 | 3300019212 | Groundwater Sediment | VPGTDDPSTPPSSSDSTVDEDRLPRSHRCRTQRLDGFYDREPAA |
| Ga0180106_12768342 | 3300019212 | Groundwater Sediment | VPGTDDPSTPTNSTSAAVDGNRLSRSHLRRSQRPDGFYDREFVARCA |
| Ga0180106_13006602 | 3300019212 | Groundwater Sediment | MPGTDDPSMPPSSTDSTVDEDRLPRSHRCQSQRLDGFYDREPAARCA |
| Ga0180119_11941772 | 3300019228 | Groundwater Sediment | VPGTDDPSTPESSISPAVDENRLSRSHWYRSQRLDGFYNR |
| Ga0180119_12070421 | 3300019228 | Groundwater Sediment | VPGTDDPSTPPSSTDSTVDEDRLPRSHRCRTQRLDGFYDRESVARCAA |
| Ga0180116_10761043 | 3300019229 | Groundwater Sediment | VPGTDDPSTPASSTDLTVDEDRLPRSHQCRTQRLDGFYDREPAARCA |
| Ga0180116_10829012 | 3300019229 | Groundwater Sediment | VPGTDDPSTPPSSTDLTVDEDRLPRSHQCQSQRLDGF |
| Ga0180116_10933511 | 3300019229 | Groundwater Sediment | VPRTDDLSTPPSSTDSAVDEDRLPRSHRCRTQRLDGFYDREPAARCA |
| Ga0180116_11231471 | 3300019229 | Groundwater Sediment | MPGTDDPSNPTSPTGEAVDGDCLLRSHHHQSQRPYGFYDRESAARCA |
| Ga0180114_10872741 | 3300019232 | Groundwater Sediment | VPRTDDLSTPPSSTDSAVDEDRLPRSHRCRTQRLDGFYDREPAARC |
| Ga0184645_10483881 | 3300019233 | Groundwater Sediment | MPPSSTDSAVDENRLSRSHRCQSQRLNGFYDRESVARCA |
| Ga0184645_13070681 | 3300019233 | Groundwater Sediment | VPGTDDPSTPSSSTDSTVDEDRLPRSHRCRSQRLDGFYDREPAARC |
| Ga0184645_13498673 | 3300019233 | Groundwater Sediment | MPGTDDPSTPPSSTDSTVDEDRLPRSHRCQSQRLDGFYDRE |
| Ga0180112_11315934 | 3300019238 | Groundwater Sediment | VPGTDDPSTPPSSTDSTVDEDRLPRSHRCRSQRLDGFYDRESVARCA |
| Ga0187793_10195951 | 3300019241 | Peatland | MSSTDPAVDEDRLPRSHRCRSQRLDGFYDREPAAR |
| Ga0187793_10311821 | 3300019241 | Peatland | VPGTDDPSTEAGSTDPAVDEDRLPRSHRCRSQRLDGFYDREPAARC |
| Ga0180117_11692071 | 3300019248 | Groundwater Sediment | VPGTDDPSTPPSSTDSTVDEDRLPRSHRCRTQRLDGFYDRESVARCA |
| Ga0180117_11733661 | 3300019248 | Groundwater Sediment | MSVSSTNSTVDKDRLPCSHRCQSQRLDGFYNRESVARCA |
| Ga0180117_11912061 | 3300019248 | Groundwater Sediment | VPGTDDPSTPASSTSAAVDGNRLSRSHLRRSQCPDGFYDREFVARCA |
| Ga0184648_12954011 | 3300019249 | Groundwater Sediment | VPGTDDPSTPTSSTDPAVGEDRLPRSHRCRSQRLDGFYDREPAARCA |
| Ga0184648_13100873 | 3300019249 | Groundwater Sediment | MPGTDDPSTPPSSTDKAVDEDRLPRSHRCRSQRLDGFYDRESVARCA |
| Ga0184648_15194921 | 3300019249 | Groundwater Sediment | MPSSSTDSAVDEDGLPRSHRCRTQRLDGFYDREFVARC |
| Ga0184641_12515201 | 3300019254 | Groundwater Sediment | VPGTDDPSTPVGSTGPTVDEDCLPRSHRYRSQRLDGFYDREPAARCA |
| Ga0184643_11324491 | 3300019255 | Groundwater Sediment | VPGTDDPSTPPSSTDPAVDEDRLPRSHRCQSQRLDGFYDREPAARCA |
| Ga0184643_12036351 | 3300019255 | Groundwater Sediment | VPGTDDPSTPPSSTDSAVDEDRLPRSHRCRSQRLDGFYDRESVARC |
| Ga0180115_10067371 | 3300019257 | Groundwater Sediment | VPGTDDPSTPSSSTDSAVDEDRLPRSHRCRSQRLDGFYDREPAAR |
| Ga0184646_12201601 | 3300019259 | Groundwater Sediment | VPGTDDPSTPSSSTDSAVDEDRLPRSHQCRSQRLDGFYDREPAAR |
| Ga0184647_11301292 | 3300019263 | Groundwater Sediment | VPGTDDPSTPPSSTDTAVDEDRLPRSHRCRSQRLDGFYDRE |
| Ga0184644_10668961 | 3300019269 | Groundwater Sediment | VPGTDDPSTPPSSTDSTVDEDRLPRSHRCRSQRLDGFYDREPAARC |
| Ga0184642_11696992 | 3300019279 | Groundwater Sediment | VPGTDDPSTPPSSTDSTVDEDRLPRSHRCQSQRLDGFYDRESVAR |
| Ga0184642_15334141 | 3300019279 | Groundwater Sediment | VPGTDDPSTPPSSTDSAVNEDRLPRSHRCRSQRPYGFYDREPAARCA |
| Ga0180118_10707622 | 3300020063 | Groundwater Sediment | VPGTDDPSTPVGSTGPTVDEDCLPRSHRYRSQRLD |
| Ga0180118_13367851 | 3300020063 | Groundwater Sediment | VPGTDDPSTPPSSTDLAVGEDRLPRSHQCRSQRLDGFYDREPAARCA |
| Ga0180107_11433801 | 3300020064 | Groundwater Sediment | VPGTDDPSTPVSSPDPAVDEDRLPRSHWCRTQRLDGFYDREPAARC |
| Ga0180107_13050802 | 3300020064 | Groundwater Sediment | VPGTDDPSTPPSSSDSTVDEDRLPRSHRCRTQRLDGFYDRESVARCA |
| Ga0180113_10441891 | 3300020065 | Groundwater Sediment | VPGTDDPSTPPSSTDLAVGEDRLPRSHQCRSQRLDGFYDREPAAR |
| Ga0180113_12592601 | 3300020065 | Groundwater Sediment | VPGTDDPSTPPSSTDLAVGEDRLPRSHQCRSQRLDGFYD |
| Ga0180113_14181281 | 3300020065 | Groundwater Sediment | MPPSSPSSAVDEDCLPRSHRCRTQRLDGFYDREFVARCA |
| Ga0180108_12384071 | 3300020066 | Groundwater Sediment | VPGTDDPSTPPSSTDSTVDEDRLPRSHRCRSQRLDGFYDRE |
| Ga0180109_10305501 | 3300020067 | Groundwater Sediment | VPGTDDPSTPPSSTDLAVDEDRLPRSHQCRSQRLDGFYDREPAA |
| Ga0180109_11017402 | 3300020067 | Groundwater Sediment | MPGTDDPSNPTSPTGEAVDGDYLLRSHHHQSQRPYGFYDRESA |
| Ga0180109_12254322 | 3300020067 | Groundwater Sediment | VPGTDDPSTPPSSTDPAVDEDRLPRSHRCRSQRLDGFYDREPAARCA |
| Ga0180109_14348423 | 3300020067 | Groundwater Sediment | MPGTDDPSMPPSSTDSTVDENRLSRSHRCQSQRLNGFYDRESVAR |
| Ga0184649_11243011 | 3300020068 | Groundwater Sediment | VPGTDDPSTPPSSTDSTVDEDRLPRSHRCQSQRLNGFYDRESVARCA |
| Ga0184649_13642841 | 3300020068 | Groundwater Sediment | MEIVPGTDDPSTPSSSTGSAVDEDRLPRSHRYRSQRPYGFYDRELAA |
| Ga0197907_102245491 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | VPGTDDPSTPVSSTSSAVDEDCLPRSHRCQSQRLDGFYDREPAARCA |
| Ga0206349_10774491 | 3300020075 | Corn, Switchgrass And Miscanthus Rhizosphere | VPGTDDPSTPVSSTSSAVDEDCLPRSHRCQSQRLDGFYDREPAARC |
| Ga0206355_11609571 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | VPGTDDPSTPVSSTSSAVDEDCLPRSHRCRSQRLDGFYDREPAAR |
| Ga0206351_100804231 | 3300020077 | Corn, Switchgrass And Miscanthus Rhizosphere | VPGTDDPSTPVSSTSSAVDEDCLPRSHRCQSQRLDGFYDREPAAR |
| Ga0206352_100360931 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | VPGTNDPSTPVSSTSSAVDEDYLPRSHRCQSQRLDGFYDREPAARCA |
| Ga0206350_106758521 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | VPGTDDPSTPVSSTSSAVDEDCLPRSHRCQSQRLDGFYDREPA |
| Ga0210329_1429723 | 3300021257 | Estuarine | MPPSSTSSTVDEDRLPRSHRCRLQRLNGFYDRESVAR |
| Ga0210345_1310421 | 3300021258 | Estuarine | MPPSSTSSTVDEDRLPRSHRCRLQRLNGFYDRESVARCA |
| Ga0179585_10270691 | 3300021307 | Vadose Zone Soil | VPGTDDPSTPASSTGSAVDEDRLPRSHRCRTQRLNGFYDREPA |
| Ga0179585_10358331 | 3300021307 | Vadose Zone Soil | VPGTDDPSTPASSTDSAVDEDRLPRSHRCRSQRLDGFYDREPAA |
| Ga0179585_10761542 | 3300021307 | Vadose Zone Soil | VPGTDDPSTPPSSTDPAVDEDRLPRSHRCRSQRLDGFYDR |
| Ga0179958_10952341 | 3300021315 | Vadose Zone Soil | VPGTDDPSTPASSTGSAVDEDRLPRSHRCRTQRLNGFYD |
| Ga0179958_11713481 | 3300021315 | Vadose Zone Soil | MPPSSTDSAVDEDGLPRSHRCRTQRLDGFYDREFVARCA |
| Ga0210323_10794101 | 3300021853 | Estuarine | MPTSSTDSTVDENRLSRSHRCQSQRLNGFYDRESVARCA |
| Ga0213850_10287752 | 3300021856 | Watersheds | VPRTDDPSTPPSSTSPAVDEDRLPRSHRCRSQRLDGFYDRELAARCA |
| Ga0213852_14593821 | 3300021858 | Watersheds | VPGTDDPSTPPSSTSPAVDEDRLPRSHRCRSQRLDGFYDRELAAR |
| Ga0210334_102694541 | 3300021859 | Estuarine | MPPSSTNSTVDEDRLPRSHRCQLQRLNGFYDRESVARCA |
| Ga0213847_10659231 | 3300021938 | Watersheds | VPGTDDPSTPPSSTDSAVDEDRLPRSHRCRTQRLDGFYDREPA |
| Ga0213856_10243461 | 3300021947 | Watersheds | VPGTDDPSTPPSSTDSTVDEDRLPRSHRCRTQRLDGFYDRESVAR |
| Ga0213856_10446741 | 3300021947 | Watersheds | MPGTDDPSTPPSSTDSTVDEDRLPRSHRCQSQRLDGFYDREPAAR |
| Ga0213856_11243102 | 3300021947 | Watersheds | VPGTDDPSTPPSSTDPAVDEDRLPRSHRCQSQRLDGFYDREPAARC |
| Ga0213856_11275681 | 3300021947 | Watersheds | VPGTDDPSTPTSSTSSAVDEDSLPRSHRCRSQCLDGFYDREPAAR |
| Ga0222625_11992741 | 3300022195 | Groundwater Sediment | VPGTDDPSTPLSSTDSTVDEDRLPRSHRCRSQRLDGFYDREPAA |
| Ga0222625_12559611 | 3300022195 | Groundwater Sediment | VPGADDPSTPPSSIGSTVDEDRLPRSHRCRSQRLNGFYDREFVARCA |
| Ga0247646_10046401 | 3300030546 | Soil | VPGTDDPSTPPSSTDLAVGEDRLPRSHQCQSQRLDGFYDR |
| Ga0247654_11068562 | 3300030552 | Soil | VPGTDDPSTPPSSTDLAVGEDRLPRSHQCRSQRLDGFYDREPAARCEVR |
| Ga0308200_10304951 | 3300030905 | Soil | VPGTDDPSTPLSSTDSTVDEDRLPRSHRCRSQRLDGFYDREPA |
| Ga0308155_10381391 | 3300030987 | Soil | VPGTDDPSTPPSSTDPTVDEDRVPRSHRCQSQRLDGLYDREPAARCA |
| Ga0308178_10221511 | 3300030990 | Soil | VPGTDDPSTPPSSTDSAVGEDRLPRSHRCRTQRLDGFYDRESV |
| Ga0308178_11274861 | 3300030990 | Soil | VPGTDDPSTPPSSTDPAVDEDRLPRSHRCQSQRLDGFYDREPAAR |
| Ga0308190_10154451 | 3300030993 | Soil | MPPSSTDSAVDENRLSRSHRCQSQRLNGFYDRESVA |
| Ga0308190_10167411 | 3300030993 | Soil | MPPSSTDSTVDENRLSRSHRCQSQRLNGFYDRESVA |
| Ga0073997_121556051 | 3300030997 | Soil | VPGTDDPSTPVGSTGPTVDEDCLPRSHRYRSQRLDGFYDR |
| Ga0073997_121672591 | 3300030997 | Soil | VPGTDDPSTPPSSTDSTVDGNRLSRSHRCRTQRLDGFYDREPAA |
| Ga0073997_122325051 | 3300030997 | Soil | VPGTDDPSTPPSSTDPAVDEDRLPRSHRCRTQRLDGFYDREP |
| Ga0073997_122606431 | 3300030997 | Soil | VPGTDDPSTPPSSSDSAVDEDRLPRSHRCRTQRLDGFYDRE |
| Ga0308189_101550641 | 3300031058 | Soil | VPGTDDPSTPTSSTDPTVDEDRLPRSHRCRSQRLDGFYDREPA |
| Ga0308192_10152222 | 3300031082 | Soil | MPTSSTDSAVDEDGLPRSHRCRTQRLDGFYDREFVARCA |
| Ga0308192_10180282 | 3300031082 | Soil | VPGTDDPSTPLSSTDSTVDEDRLPRSHRCRSQRLDGFYDREPAARCA |
| Ga0308181_11034711 | 3300031099 | Soil | VPGTDDPSTPVGSTGPTVDEDCLPRSHRYRSQRLDGFYDREPAARC |
| Ga0308180_10079481 | 3300031100 | Soil | VPGTDDPSTPLSSTDSTVDEDRLPRSHRCQSQRLDGFYDREPAAR |
| Ga0308187_101252751 | 3300031114 | Soil | MPGTDDPSTPPSSTDSTVDEDRLPRSHRCRSQRLDGFYDR |
| Ga0308187_102160261 | 3300031114 | Soil | MEFVPGTDDPSTPSSSTGSAVDEDRLPRSHRYRSQRPYGFYDRELAARCA |
| Ga0308187_102481401 | 3300031114 | Soil | VPGTDDPSTPPSSTDSTVDEDRLPRSHRCRTQRLDGFYDREPAARCA |
| Ga0308187_104065821 | 3300031114 | Soil | VPGTDDPSTPTSSIGSAVDEDRLPRSHRCQSQRLNGFYDQESAARCA |
| Ga0308195_10025861 | 3300031123 | Soil | MPPSSTDSTVDENRLSRSHRCQSQRLNGFYDRESVARCA |
| Ga0308195_10110062 | 3300031123 | Soil | VPGTDDPSTPLSSTDSTVDEDRLPRSHRCQSQRLDGFYDREPAARC |
| Ga0170824_1147519782 | 3300031231 | Forest Soil | VPGTDDPSTPTSSTDSTVDGNRLSRSHRCRTQRLDGFYDREPA |
| Ga0170824_1280450431 | 3300031231 | Forest Soil | MPGTDDPSTPTSSTDPAVDEDRLPRSHRCRTQRLDGFYDREP |
| Ga0308194_100142162 | 3300031421 | Soil | VPGTDDPSTPPSSTDSAVDEDRLPRSYRCRSQRLDGFYDREPA |
| Ga0308179_10032572 | 3300031424 | Soil | VPGTDDPSTPPSSTDSTVDEDRLPRSHRCRSQRLDGFYDREPAARCA |
| Ga0170819_107594961 | 3300031469 | Forest Soil | VPGADDPSTPPSSTDSAVDEDRLPRSHRCRTQRLDGFYDR |
| Ga0307480_10016232 | 3300031677 | Hardwood Forest Soil | MPGTDDPSNPTSPTGEAVDGDCLLRSYHHQSQRPYGFYDRESAARCA |
| Ga0370544_01769_3_113 | 3300034447 | Soil | MPPSSTDSAVDEDGLPRSHRCRTQRLDGFYDREFVAR |
| Ga0370540_09335_2_142 | 3300034448 | Soil | MPGTDDPSTPPSSTDSTVDEDRLPRSHRCRTQRLDGFYDRESVARCA |
| Ga0370545_002009_2_142 | 3300034643 | Soil | MPGTDDPSTPPSSTDTAVDEDRLPRSHRCRSQRLDGFYDRESAARCA |
| Ga0314782_046926_715_846 | 3300034661 | Soil | MPGTDDPSTPPSSTDSTVDEDKLPRSHRCRTQRLDGFYDRESVA |
| Ga0314783_019734_944_1078 | 3300034662 | Soil | MPGTDDPSTPPSSTDTAVDGDRLPRSHPCQSQRLDGFYDRESAAR |
| Ga0314783_025341_2_142 | 3300034662 | Soil | MPGTDDPSTPVGSTGPTVDEDCLPRSHRYRSQRLDGFYDREPAARCA |
| Ga0314783_031205_2_142 | 3300034662 | Soil | MPGTDDPSTPPSSTGLTVDEDRLPRSHQCQSQRLDGFYDREPAARCA |
| Ga0314783_110279_2_115 | 3300034662 | Soil | MPGTDDRSTPSSSSDPTVEEDRLPRSHRFRSQRLDGFY |
| Ga0314786_005184_2_142 | 3300034664 | Soil | MPGADDPSTPPSSTDLAVDEDRLPRSHQCQSQRLDGFYDREPAARCA |
| Ga0314786_019106_944_1078 | 3300034664 | Soil | MPGTDDPSTPPSSTDPTVDGDRLPRSHRCRSLRLDGFSDREPAAR |
| Ga0314787_033119_3_137 | 3300034665 | Soil | MPGTDDPSTPPSSTSSTVDEDRLPRSHRCRTQRLDGFYDRESVAR |
| Ga0314788_028502_2_136 | 3300034666 | Soil | MPGTDDPSTPVGSTGPTVDEDCLPRSHRYRSQRLDGFYDREPAAR |
| Ga0314788_037876_1_123 | 3300034666 | Soil | MPGADVPSTPSSSTNSAVDEIRLSRSHRCQSQRLDGFYNRE |
| Ga0314788_198046_1_141 | 3300034666 | Soil | MPGIDEPSTPPRSSDSAVDEGSLPRSHRYRTQRLNGFYDREFVARCA |
| Ga0314792_045205_2_142 | 3300034667 | Soil | MPGTEDPSTPPSSTDSAVDEDRLPRSHRCRTQRLDGFYDREFVARCA |
| Ga0314793_082708_503_643 | 3300034668 | Soil | MPRTDDLSTPSSSTDSTVDEDRLPRSHRCRTQRLDGFYDREPAARCA |
| Ga0314796_005708_2_142 | 3300034671 | Soil | MPGADVPSTPSSSTNSAVDEIRLSRSHRCQSQRLDGFYNREPAARCA |
| Ga0314799_008432_3_137 | 3300034674 | Soil | MPGTDDPSTPPSSTSSTVDEDRLPRSDRCQSQRLVGFYDREPAAR |
| Ga0370541_057899_403_519 | 3300034680 | Soil | MPPSSTDSAVDEDGLPRSHRCRTQRLDGFYDRELVARCA |
| ⦗Top⦘ |