


| Basic Information | |
|---|---|
| Family ID | F049074 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 147 |
| Average Sequence Length | 51 residues |
| Representative Sequence | MDELLKKIMEITGAGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFERDE |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 147 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 69.39 % |
| % of genes near scaffold ends (potentially truncated) | 29.93 % |
| % of genes from short scaffolds (< 2000 bps) | 71.43 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.476 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge (28.571 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.497 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (44.218 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 82.00% β-sheet: 0.00% Coil/Unstructured: 18.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 147 Family Scaffolds |
|---|---|---|
| PF00643 | zf-B_box | 11.56 |
| PF12706 | Lactamase_B_2 | 10.88 |
| PF11383 | DUF3187 | 10.88 |
| PF12836 | HHH_3 | 8.84 |
| PF02405 | MlaE | 4.76 |
| PF01230 | HIT | 2.72 |
| PF13186 | SPASM | 2.04 |
| PF04333 | MlaA | 2.04 |
| PF06808 | DctM | 1.36 |
| PF01613 | Flavin_Reduct | 1.36 |
| PF11304 | DUF3106 | 0.68 |
| PF01541 | GIY-YIG | 0.68 |
| PF01168 | Ala_racemase_N | 0.68 |
| PF14251 | DUF4346 | 0.68 |
| PF02547 | Queuosine_synth | 0.68 |
| PF12437 | GSIII_N | 0.68 |
| PF00990 | GGDEF | 0.68 |
| PF07690 | MFS_1 | 0.68 |
| PF13399 | LytR_C | 0.68 |
| PF05494 | MlaC | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 147 Family Scaffolds |
|---|---|---|---|
| COG0767 | Permease subunit MlaE of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 4.76 |
| COG2853 | Lipoprotein subunit MlaA of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 2.04 |
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 1.36 |
| COG0809 | S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine synthetase) | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| COG2854 | Periplasmic subunit MlaC of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.48 % |
| Unclassified | root | N/A | 9.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000032|Draft_c0001711 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7384 | Open in IMG/M |
| 3300000032|Draft_c0447342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095 | 1766 | Open in IMG/M |
| 3300000310|WSSedA1Ba2DRAFT_1015305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095 | 933 | Open in IMG/M |
| 3300000313|WSSedB1CaDRAFT_10058263 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300000506|Soeholt_1002654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 22374 | Open in IMG/M |
| 3300000558|Draft_10029568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2397 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_100732765 | Not Available | 581 | Open in IMG/M |
| 3300002219|SCADCLC_10115348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 529 | Open in IMG/M |
| 3300002961|JGI11641J44799_10000274 | All Organisms → cellular organisms → Bacteria | 14920 | Open in IMG/M |
| 3300003432|JGI20214J51088_10051639 | All Organisms → cellular organisms → Bacteria | 2861 | Open in IMG/M |
| 3300003432|JGI20214J51088_10103034 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2011 | Open in IMG/M |
| 3300003858|Ga0031656_10346004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 501 | Open in IMG/M |
| 3300003861|Ga0031654_10026821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1660 | Open in IMG/M |
| 3300004072|Ga0055512_10000288 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3839 | Open in IMG/M |
| 3300004781|Ga0062379_10046879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 863 | Open in IMG/M |
| 3300006224|Ga0079037_100824501 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 912 | Open in IMG/M |
| 3300006224|Ga0079037_102330254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Noviherbaspirillum → Noviherbaspirillum massiliense | 534 | Open in IMG/M |
| 3300006360|Ga0079079_1042593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae | 2627 | Open in IMG/M |
| 3300006592|Ga0079076_1272727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae | 2347 | Open in IMG/M |
| 3300006593|Ga0079081_1176876 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
| 3300006596|Ga0079074_1006686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella | 2969 | Open in IMG/M |
| 3300006930|Ga0079303_10139294 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 942 | Open in IMG/M |
| 3300009078|Ga0105106_10004650 | All Organisms → cellular organisms → Bacteria | 9802 | Open in IMG/M |
| 3300009078|Ga0105106_10264200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095 | 1249 | Open in IMG/M |
| 3300009081|Ga0105098_10314611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095 | 756 | Open in IMG/M |
| 3300009082|Ga0105099_10084224 | All Organisms → cellular organisms → Bacteria | 1724 | Open in IMG/M |
| 3300009082|Ga0105099_11027393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095 | 526 | Open in IMG/M |
| 3300009085|Ga0105103_10270997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095 | 920 | Open in IMG/M |
| 3300009087|Ga0105107_10008347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae | 7092 | Open in IMG/M |
| 3300009087|Ga0105107_10413988 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300009091|Ga0102851_11403471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095 | 776 | Open in IMG/M |
| 3300009091|Ga0102851_11943010 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300009111|Ga0115026_10440839 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300009166|Ga0105100_10005909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 7119 | Open in IMG/M |
| 3300009166|Ga0105100_10039473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2740 | Open in IMG/M |
| 3300009167|Ga0113563_10734061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095 | 1111 | Open in IMG/M |
| 3300009169|Ga0105097_10064191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae | 1987 | Open in IMG/M |
| 3300009171|Ga0105101_10015841 | All Organisms → cellular organisms → Bacteria | 3625 | Open in IMG/M |
| 3300009179|Ga0115028_10237438 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300009179|Ga0115028_10326009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095 | 1045 | Open in IMG/M |
| 3300009179|Ga0115028_11091237 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300009179|Ga0115028_11178545 | Not Available | 629 | Open in IMG/M |
| 3300009655|Ga0116190_1037365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2187 | Open in IMG/M |
| 3300009658|Ga0116188_1065983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1557 | Open in IMG/M |
| 3300009658|Ga0116188_1125977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095 | 983 | Open in IMG/M |
| 3300009669|Ga0116148_1000234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 72103 | Open in IMG/M |
| 3300009673|Ga0116185_1012770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae | 5578 | Open in IMG/M |
| 3300009673|Ga0116185_1191512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 935 | Open in IMG/M |
| 3300009675|Ga0116149_1375546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 596 | Open in IMG/M |
| 3300009676|Ga0116187_1023712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae | 3767 | Open in IMG/M |
| 3300009676|Ga0116187_1090883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1559 | Open in IMG/M |
| 3300009685|Ga0116142_10023343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4035 | Open in IMG/M |
| 3300009685|Ga0116142_10054652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2309 | Open in IMG/M |
| 3300009689|Ga0116186_1197639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095 | 900 | Open in IMG/M |
| 3300009689|Ga0116186_1389434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 581 | Open in IMG/M |
| 3300009704|Ga0116145_1057191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1792 | Open in IMG/M |
| 3300009704|Ga0116145_1180427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095 | 828 | Open in IMG/M |
| 3300009767|Ga0116161_1352271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 580 | Open in IMG/M |
| 3300009769|Ga0116184_10008065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae | 7610 | Open in IMG/M |
| 3300009769|Ga0116184_10330714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095 | 646 | Open in IMG/M |
| 3300009771|Ga0116155_10139431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095 | 1051 | Open in IMG/M |
| 3300009776|Ga0116154_10447207 | Not Available | 550 | Open in IMG/M |
| 3300009868|Ga0130016_10262056 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
| 3300009868|Ga0130016_10353721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 997 | Open in IMG/M |
| 3300010342|Ga0116252_10358031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 850 | Open in IMG/M |
| 3300010345|Ga0116253_10020809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. SCADC | 6190 | Open in IMG/M |
| 3300010347|Ga0116238_10343850 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300010353|Ga0116236_10016852 | All Organisms → cellular organisms → Bacteria | 9156 | Open in IMG/M |
| 3300010429|Ga0116241_10439909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1026 | Open in IMG/M |
| 3300010429|Ga0116241_10657055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 810 | Open in IMG/M |
| 3300011340|Ga0151652_11242861 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300011340|Ga0151652_13407092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 644 | Open in IMG/M |
| 3300014257|Ga0075319_1011973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095 | 1284 | Open in IMG/M |
| 3300014301|Ga0075323_1071870 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 707 | Open in IMG/M |
| 3300014309|Ga0075317_1008150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1738 | Open in IMG/M |
| 3300015250|Ga0180072_1104029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 506 | Open in IMG/M |
| 3300019236|Ga0179944_1086182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095 | 582 | Open in IMG/M |
| 3300020814|Ga0214088_1027127 | All Organisms → cellular organisms → Bacteria | 2871 | Open in IMG/M |
| 3300020814|Ga0214088_1626248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095 | 694 | Open in IMG/M |
| 3300021603|Ga0226659_10315969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 697 | Open in IMG/M |
| 3300023207|Ga0255811_10774154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095 | 501 | Open in IMG/M |
| 3300025629|Ga0208824_1056142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1387 | Open in IMG/M |
| 3300025638|Ga0208198_1076252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095 | 1069 | Open in IMG/M |
| 3300025638|Ga0208198_1118416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 753 | Open in IMG/M |
| 3300025706|Ga0209507_1168371 | Not Available | 585 | Open in IMG/M |
| 3300025708|Ga0209201_1000311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 72117 | Open in IMG/M |
| 3300025715|Ga0209310_1038195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1719 | Open in IMG/M |
| 3300025715|Ga0209310_1238082 | Not Available | 508 | Open in IMG/M |
| 3300025720|Ga0208197_1058029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1541 | Open in IMG/M |
| 3300025739|Ga0209745_1138085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales | 773 | Open in IMG/M |
| 3300025740|Ga0208940_1070481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1366 | Open in IMG/M |
| 3300025784|Ga0209200_1041850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2031 | Open in IMG/M |
| 3300025856|Ga0209604_1220048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095 | 744 | Open in IMG/M |
| 3300025963|Ga0210146_1001859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1994 | Open in IMG/M |
| 3300025980|Ga0210137_1011792 | Not Available | 1034 | Open in IMG/M |
| 3300027051|Ga0209269_1013282 | All Organisms → cellular organisms → Bacteria | 2112 | Open in IMG/M |
| 3300027715|Ga0208665_10099416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 893 | Open in IMG/M |
| 3300027715|Ga0208665_10287724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095 | 516 | Open in IMG/M |
| 3300027716|Ga0209682_10057125 | Not Available | 950 | Open in IMG/M |
| 3300027885|Ga0209450_10007804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5627 | Open in IMG/M |
| 3300027887|Ga0208980_10000709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 19286 | Open in IMG/M |
| 3300027890|Ga0209496_10012621 | All Organisms → cellular organisms → Bacteria | 2427 | Open in IMG/M |
| 3300027897|Ga0209254_10011246 | All Organisms → cellular organisms → Bacteria | 8234 | Open in IMG/M |
| 3300027897|Ga0209254_10363816 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300027899|Ga0209668_10663380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 699 | Open in IMG/M |
| 3300027900|Ga0209253_10106903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2289 | Open in IMG/M |
| 3300027900|Ga0209253_10455851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 962 | Open in IMG/M |
| 3300027902|Ga0209048_10064623 | All Organisms → cellular organisms → Bacteria | 2925 | Open in IMG/M |
| 3300029781|Ga0167330_1004420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus aciditrophicus | 3928 | Open in IMG/M |
| 3300031834|Ga0315290_10282838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1451 | Open in IMG/M |
| 3300031997|Ga0315278_10012732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae | 7797 | Open in IMG/M |
| 3300032143|Ga0315292_10624319 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300032397|Ga0315287_10638747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales | 1259 | Open in IMG/M |
| 3300032401|Ga0315275_10706504 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300032897|Ga0335071_11045156 | Not Available | 763 | Open in IMG/M |
| 3300033004|Ga0335084_10084170 | All Organisms → cellular organisms → Bacteria | 3299 | Open in IMG/M |
| 3300033406|Ga0316604_10118328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1401 | Open in IMG/M |
| 3300033406|Ga0316604_10167354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095 | 1179 | Open in IMG/M |
| 3300033406|Ga0316604_10355250 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300033406|Ga0316604_10554571 | Not Available | 632 | Open in IMG/M |
| 3300033408|Ga0316605_12077298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095 | 553 | Open in IMG/M |
| 3300033413|Ga0316603_10119293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2124 | Open in IMG/M |
| 3300033413|Ga0316603_12005702 | Not Available | 547 | Open in IMG/M |
| 3300033413|Ga0316603_12207749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 519 | Open in IMG/M |
| 3300033414|Ga0316619_10010216 | All Organisms → cellular organisms → Bacteria | 3839 | Open in IMG/M |
| 3300033414|Ga0316619_10843596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095 | 786 | Open in IMG/M |
| 3300033414|Ga0316619_11383857 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300033418|Ga0316625_101492047 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300033418|Ga0316625_101610227 | Not Available | 620 | Open in IMG/M |
| 3300033419|Ga0316601_102192433 | Not Available | 556 | Open in IMG/M |
| 3300033433|Ga0326726_10663878 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1005 | Open in IMG/M |
| 3300033433|Ga0326726_11273232 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300033433|Ga0326726_11587272 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300033480|Ga0316620_10686586 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 972 | Open in IMG/M |
| 3300033481|Ga0316600_11077933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 569 | Open in IMG/M |
| 3300033482|Ga0316627_101053808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095 | 793 | Open in IMG/M |
| 3300033483|Ga0316629_10984536 | Not Available | 661 | Open in IMG/M |
| 3300033486|Ga0316624_11417704 | Not Available | 637 | Open in IMG/M |
| 3300033487|Ga0316630_12128147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 517 | Open in IMG/M |
| 3300033488|Ga0316621_10778031 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300033521|Ga0316616_100244450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095 | 1841 | Open in IMG/M |
| 3300033521|Ga0316616_100510560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae | 1380 | Open in IMG/M |
| 3300033521|Ga0316616_101983367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin095 | 770 | Open in IMG/M |
| 3300033521|Ga0316616_102672221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 671 | Open in IMG/M |
| 3300034123|Ga0370479_0003273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3373 | Open in IMG/M |
| 3300034126|Ga0370486_007325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2400 | Open in IMG/M |
| 3300034128|Ga0370490_0008147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3664 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 28.57% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 18.37% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 8.16% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 6.12% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 4.76% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 4.08% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.40% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 3.40% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.04% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 2.04% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.04% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.04% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 2.04% |
| Granular Sludge | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Granular Sludge | 2.04% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.36% |
| Wetland | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland | 1.36% |
| Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 1.36% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 1.36% |
| Hydrocarbon Resource Environments | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Hydrocarbon Resource Environments | 1.36% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.68% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.68% |
| Biosolids | Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Biosolids | 0.68% |
| Anaerobic Digester | Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic) → Activated Sludge → Anaerobic Digester | 0.68% |
| Enrichment Culture | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture | 0.68% |
| Anaerobic Digester Digestate | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000032 | Oil sands microbial community from Northern Alberta which degrade Naphthaline | Engineered | Open in IMG/M |
| 3300000310 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300000313 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site B1 Cattail | Environmental | Open in IMG/M |
| 3300000506 | Anaerobic digester microbial communities from Northern Denmark, sample from Soeholt sludge | Engineered | Open in IMG/M |
| 3300000558 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300002219 | Tailings pond microbial communities from Northern Alberta -Short chain hydrocarbon degrading methanogenic enrichment culture SCADC: | Engineered | Open in IMG/M |
| 3300002961 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300003432 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300003858 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI | Environmental | Open in IMG/M |
| 3300003861 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR | Environmental | Open in IMG/M |
| 3300004072 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004781 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006360 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Val_03_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006592 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Leu_03_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006593 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Gly_02_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006596 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Leu_01_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009655 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR4_MetaG | Engineered | Open in IMG/M |
| 3300009658 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR2_MetaG | Engineered | Open in IMG/M |
| 3300009669 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG | Engineered | Open in IMG/M |
| 3300009673 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA7_MetaG | Engineered | Open in IMG/M |
| 3300009675 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC057_MetaG | Engineered | Open in IMG/M |
| 3300009676 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA6_MetaG | Engineered | Open in IMG/M |
| 3300009685 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG | Engineered | Open in IMG/M |
| 3300009689 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA4_MetaG | Engineered | Open in IMG/M |
| 3300009704 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG1_MetaG | Engineered | Open in IMG/M |
| 3300009767 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS3_MetaG | Engineered | Open in IMG/M |
| 3300009769 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA5_MetaG | Engineered | Open in IMG/M |
| 3300009771 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC032_MetaG | Engineered | Open in IMG/M |
| 3300009776 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC030_MetaG | Engineered | Open in IMG/M |
| 3300009868 | Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plant | Engineered | Open in IMG/M |
| 3300010342 | AD_JPNAca1 | Engineered | Open in IMG/M |
| 3300010345 | AD_JPNAca2 | Engineered | Open in IMG/M |
| 3300010347 | AD_JPHGca | Engineered | Open in IMG/M |
| 3300010353 | AD_USCAca | Engineered | Open in IMG/M |
| 3300010429 | AD_USRAca | Engineered | Open in IMG/M |
| 3300011340 | Combined Assembly of Wetland Metatranscriptomes | Environmental | Open in IMG/M |
| 3300014257 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014301 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014309 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleB_D1 | Environmental | Open in IMG/M |
| 3300015250 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293B_16_10D | Environmental | Open in IMG/M |
| 3300019236 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_STIC10_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300020814 | Granular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules megahit | Engineered | Open in IMG/M |
| 3300021603 | Granular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules spades | Engineered | Open in IMG/M |
| 3300023207 | Combined Assembly of Gp0238866, Gp0238878, Gp0238879 | Engineered | Open in IMG/M |
| 3300025629 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR3_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025638 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR2_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025706 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC028_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025708 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025715 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC030_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025720 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA4_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025739 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-312 (SPAdes) | Environmental | Open in IMG/M |
| 3300025740 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA6_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025784 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025856 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025963 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025980 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027051 | Enrichment culture microbial communities from Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKM (Arthur Kill Methanogenic) MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300027715 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes) | Environmental | Open in IMG/M |
| 3300027716 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
| 3300027887 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300029781 | Biosolids microbial communities from sewage treatment plant in Sweden - SWESTP11 - Uppsala-digested 112 | Engineered | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033406 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CT | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
| 3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300034123 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_15 | Environmental | Open in IMG/M |
| 3300034126 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_16 | Environmental | Open in IMG/M |
| 3300034128 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Draft_00017111 | 3300000032 | Hydrocarbon Resource Environments | MDELIKTIMEKAGITEEAARGIIDEVVAYTKSKVPGPFQHFVDQIFERDE* |
| Draft_04473422 | 3300000032 | Hydrocarbon Resource Environments | MEELLKKIMEITGAGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFERDE* |
| WSSedA1Ba2DRAFT_10153052 | 3300000310 | Wetland | LKKIMEITGTSDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFEREE* |
| WSSedB1CaDRAFT_100582632 | 3300000313 | Wetland | MDELIQRIIEKTGISHEAALQIIDEVVAFTKSKVPGPFQHFVDQIFEREE* |
| Soeholt_100265424 | 3300000506 | Anaerobic Digester | MDELLKKIKEITGAGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFERDE* |
| Draft_100295684 | 3300000558 | Hydrocarbon Resource Environments | ETNMDELIKTIMEKAGITEEAARGIIDEVVAYTKSKVPGPFQHFVDQIFERDE* |
| JGIcombinedJ13530_1007327652 | 3300001213 | Wetland | DELIRSIIEKTGISREAALQIIDEVVAFTKSKVPGPFQHFVDQIFEREE* |
| SCADCLC_101153482 | 3300002219 | Hydrocarbon Resource Environments | METNMDELIKTIMEKAGITEEAARGIIDEVVAYTKSKVPGPFQHFVDQIFERDE* |
| JGI11641J44799_100002745 | 3300002961 | Wetland | MDELLKKIMEITGTSDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFEREE* |
| JGI20214J51088_100516391 | 3300003432 | Wetland | MDELIQSIIEKTGISREAALQIXDEVVAFAKSKVPGPFQHFVDQIFEREE* |
| JGI20214J51088_101030343 | 3300003432 | Wetland | MDELIQRIIEKTGISREAALQIIDEVVAFTKSKVPGPFQHFVDQIFEREE* |
| Ga0031656_103460041 | 3300003858 | Freshwater Lake Sediment | METDMDELIKTIMEKAGITEEAARNIIDEVVAYTKSKVPGPFQHFVDQIFEREE* |
| Ga0031654_100268212 | 3300003861 | Freshwater Lake Sediment | MDELIKTIMEKAGITEEAARGIIDDVVAYTKSKVPGPFQHFVDQIFEREE* |
| Ga0055512_100002886 | 3300004072 | Natural And Restored Wetlands | MDELIQSIIEKTGISREAALQIIDEVVAFAKSKVPGPFQHFVDQIFEREE* |
| Ga0062379_100468792 | 3300004781 | Wetland Sediment | MDELIKTIMEKAGITEETARGIIDEVVAYTKSKVPGPFQHFVDQIFEREE* |
| Ga0079037_1008245012 | 3300006224 | Freshwater Wetlands | MDKEERMDELLKKIMEITGAGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFERDE* |
| Ga0079037_1023302541 | 3300006224 | Freshwater Wetlands | MDKEYRMDELLKKIMEITGAGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFERDSE* |
| Ga0079079_10425934 | 3300006360 | Anaerobic Digestor Sludge | MDELLKKIMEITGAGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFERDE* |
| Ga0079076_12727271 | 3300006592 | Anaerobic Digestor Sludge | DLTEESGMDELLKKIKEITGAGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFERDE* |
| Ga0079081_11768762 | 3300006593 | Anaerobic Digestor Sludge | ELLKKIKEITGAGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFERDE* |
| Ga0079074_10066865 | 3300006596 | Anaerobic Digestor Sludge | ESGMDELLKKIKEITGAGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFERDE* |
| Ga0079303_101392942 | 3300006930 | Deep Subsurface | MDKEYRMEELLKKIMEITGAGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFERDSE* |
| Ga0105106_100046505 | 3300009078 | Freshwater Sediment | MDKEERMDELLKKIMEITGAGDEAARKVVDEVVAFAREKVPGPFQHFVDQIFERDE* |
| Ga0105106_102642003 | 3300009078 | Freshwater Sediment | MDKEERMDELLKKIMEITGTSDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFEREE* |
| Ga0105098_103146112 | 3300009081 | Freshwater Sediment | MDKEERMDELLKKIMEITGTSDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFERDE* |
| Ga0105099_100842244 | 3300009082 | Freshwater Sediment | DKEERMDELLKKIMEITGAGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFERDE* |
| Ga0105099_110273931 | 3300009082 | Freshwater Sediment | IQIHIDKEHRMDELLKKIMEITGAGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFERDE |
| Ga0105103_102709973 | 3300009085 | Freshwater Sediment | MDELLKKIMEITGAGDEVARRVIDEVVAYTKSKVPGPFQHFVDQIFEREE* |
| Ga0105107_100083477 | 3300009087 | Freshwater Sediment | MDKEHRMDELLKKIMEITGAGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFERDE* |
| Ga0105107_104139882 | 3300009087 | Freshwater Sediment | METDMDELIKTIMEKAGITEEAARSIIDEVVAYTKSKVPGPFQHFVDQIFERD |
| Ga0102851_114034713 | 3300009091 | Freshwater Wetlands | DELLKKIMEITGAGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFERDSE* |
| Ga0102851_119430102 | 3300009091 | Freshwater Wetlands | MESNMDELIKTIMEKAGITEEAARGIIDEVVAYTKSKVPGPFQHFVDQIFERDE* |
| Ga0115026_104408392 | 3300009111 | Wetland | MDKEYRMDELLKKIMEITGAGDEAARKVVDEVVAFAKDKAPGPFQHVVDQIFERDSE* |
| Ga0105100_100059095 | 3300009166 | Freshwater Sediment | MDKEERMDELLKKIMEITGAGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFERDEY* |
| Ga0105100_100394733 | 3300009166 | Freshwater Sediment | MDKEHRMDALLKKIMEITGAGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFERDE* |
| Ga0113563_107340612 | 3300009167 | Freshwater Wetlands | MGKEYRMDELLKKIMEITGAGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFERDSE* |
| Ga0105097_100641914 | 3300009169 | Freshwater Sediment | DKEHRMDELLKKIMEITGAGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFERDE* |
| Ga0105101_100158415 | 3300009171 | Freshwater Sediment | MDKEESMDELLKKIMEITGAGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFERDE* |
| Ga0115028_102374381 | 3300009179 | Wetland | MDKEYRMDELLKKIMEITGAGDEAARKVVDEVVAFAKEKVPGPFQHF |
| Ga0115028_103260092 | 3300009179 | Wetland | MDELLKKIMEITGVGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFERDE* |
| Ga0115028_110912371 | 3300009179 | Wetland | MEPNMDELIKTIMEKAGITEDAARGIIDEVVAYTKSKVPGPFQHFVD |
| Ga0115028_111785452 | 3300009179 | Wetland | EPEMDELIKTIMEKAGITEEAARGIIDEVVAYTKSKVPGPFQHFVDQIFERDE* |
| Ga0116190_10373653 | 3300009655 | Anaerobic Digestor Sludge | MDELLRKIREITGAGDEAARKVVDEVVAFAKSKVPGPFQHFVDQIFERDE* |
| Ga0116188_10659832 | 3300009658 | Anaerobic Digestor Sludge | MDELLKKIMEITGAGDEAARKVVDEVVAFAKSKVPGPFQHFVDQIFERDE* |
| Ga0116188_11259772 | 3300009658 | Anaerobic Digestor Sludge | MDELLRKIMEITGAGDEAARKVVDEVVAYAKSKVPGPFQHFVDQIFEREE* |
| Ga0116148_100023460 | 3300009669 | Anaerobic Digestor Sludge | MDDLLRKIMEITGAGDEAARKVVDEVVAFAKSKVPGPFQHFVDQIFERDE* |
| Ga0116185_10127709 | 3300009673 | Anaerobic Digestor Sludge | MEELLKKIMEITGAGDEAARKVVDEVVAFAKSKVPGPFQHFVDQIFERDE* |
| Ga0116185_11915121 | 3300009673 | Anaerobic Digestor Sludge | MDELLRKIMEITGAGDEAARKVIDEVVAFAKSKVPGPFQHFVDQIFERDES* |
| Ga0116149_13755461 | 3300009675 | Anaerobic Digestor Sludge | MDELLKKIMEITGAGDDAARKVVDEVVAFAKEKVPGPFQHFVDQ |
| Ga0116187_10237126 | 3300009676 | Anaerobic Digestor Sludge | EITGAGDEAARKVVDEVVAFAKSKVPGPFQHFVDQIFERDES* |
| Ga0116187_10908833 | 3300009676 | Anaerobic Digestor Sludge | MEELLKKIMEITGAGDEAARKVVDEVVAFAKSKVPGPFQHFVDQIFERD |
| Ga0116142_100233433 | 3300009685 | Anaerobic Digestor Sludge | MDELLKKIMEITGTGDEAARKVIDEVVAFAKSKVPGPFQHFVDQIFERDES* |
| Ga0116142_100546521 | 3300009685 | Anaerobic Digestor Sludge | MEELLKKIMEITGAGDEAARKVIDEVVAFAKEKVPGPFQHFVDQIFEREE* |
| Ga0116186_11976392 | 3300009689 | Anaerobic Digestor Sludge | MDELLRKIMEITGAGDEAARKVIDEVVAFAKSKVPGPFQHFVDQIFERDE* |
| Ga0116186_13894342 | 3300009689 | Anaerobic Digestor Sludge | MDELLKKIMEITGAGDEAARKVVDEVVAFAKSKVPGPFQHFVDQIFERDES* |
| Ga0116145_10571914 | 3300009704 | Anaerobic Digestor Sludge | MDELLKKIMEITGAGDEAARKVVDEVVAFAKSKVPGPFQHFVDQIFERED* |
| Ga0116145_11804272 | 3300009704 | Anaerobic Digestor Sludge | MDELLRKIREITGAGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFERDE* |
| Ga0116161_13522712 | 3300009767 | Anaerobic Digestor Sludge | MDELLKKIMEITGAGDDAARKVVDEVVAFAKDKVPGPFQHFVDQIFERDE* |
| Ga0116184_1000806510 | 3300009769 | Anaerobic Digestor Sludge | MDELLRKIMEITGAGDEAARKVVDEVVAFAKSKVPGPFQHFVDQIFERDE* |
| Ga0116184_103307142 | 3300009769 | Anaerobic Digestor Sludge | DELLKKIKEITGAGDEAARKVVDEVVAYAKSKVPGPFQHFVDQIFEREE* |
| Ga0116155_101394312 | 3300009771 | Anaerobic Digestor Sludge | MDELLKKIMEITGAGDEAARKVIDEVVAFAKEKVPGPFQHFVDQIFERDE* |
| Ga0116154_104472071 | 3300009776 | Anaerobic Digestor Sludge | MDELLKKIMEITGAGDEAARKVIDEVVTFAKEKVPGPFQHFVDQIFERDE* |
| Ga0130016_102620561 | 3300009868 | Wastewater | MDELLKKIMEITGVGDEAARKVIDEVVAFAKEKVPGPFQHFVDQIFERDE* |
| Ga0130016_103537212 | 3300009868 | Wastewater | MDELLKKIMEITGVGDEAARKVIDEVVTFAKEKVPGPFQHFVDQIFERDE* |
| Ga0116252_103580312 | 3300010342 | Anaerobic Digestor Sludge | MDDLLRKIMEITGAGDEAARKVVDEVVAFAKSKVPGPFQHFVDQI |
| Ga0116253_100208091 | 3300010345 | Anaerobic Digestor Sludge | MEITGAGDEAARKVVDEVVAFAKSKVPGPFQHFVDQIFERDE* |
| Ga0116238_103438502 | 3300010347 | Anaerobic Digestor Sludge | MDELLRKIREITGAGDEAARKVVDEVVAFAKSKVPGPFQHFVDQIFERED* |
| Ga0116236_1001685213 | 3300010353 | Anaerobic Digestor Sludge | MDDLLRKIMEITGAGDEAARKVVDEVVAFAKSKVPGPFQHFVDQIFERD |
| Ga0116241_104399093 | 3300010429 | Anaerobic Digestor Sludge | ETGMDELLRKIREITGAGDEAARKVVDEVVAFAKSKVPGPFQHFVDQIFERDE* |
| Ga0116241_106570551 | 3300010429 | Anaerobic Digestor Sludge | DELLKKIMEITGAGDEAARKVIDEVVAFAKSKVPGPFQHFVDQIFERDES* |
| Ga0151652_112428612 | 3300011340 | Wetland | MREPSARRTFFTEPDMDELIKTIMEKAGITEETARGILDEVVAFTKSKVPGPFQHFVDQIFEREE* |
| Ga0151652_134070921 | 3300011340 | Wetland | MDELLKKIMEITGAGDEAARKVVDEVVAFAREKVPGPFQHFVDQ |
| Ga0075319_10119732 | 3300014257 | Natural And Restored Wetlands | MDKENRMDELLKKIMEITGTGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFERDE* |
| Ga0075323_10718701 | 3300014301 | Natural And Restored Wetlands | MDELIRTIMEKAGITEEAARGIIDEVVAYTKTKVPGPFQHFVDQIFEREE* |
| Ga0075317_10081504 | 3300014309 | Natural And Restored Wetlands | MDKEHRMDELLKKIMEITGTGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFER |
| Ga0180072_11040291 | 3300015250 | Soil | LIKTIMQKAGITEEAARGILDEVVAYTKSKVPGPFQHFVDQIFERDE* |
| Ga0179944_10861822 | 3300019236 | Anaerobic Digestor Sludge | MDELLKKIKEITGAGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFERDE |
| Ga0214088_10271273 | 3300020814 | Granular Sludge | MNELLKKIMEITGAGDEAARKVIDEVVAFAKEKVPGPFQHFVDQIFEREE |
| Ga0214088_16262481 | 3300020814 | Granular Sludge | MDELLKKIMEITGVGDEAARKVIDEVVTFAKEKVPGPFQHFVDQIFERDE |
| Ga0226659_103159692 | 3300021603 | Granular Sludge | MEELLKKIMEITGAGDEAARKVIDEVVAFAKEKVPGPFQHFVDQIFEREE |
| Ga0255811_107741542 | 3300023207 | Anaerobic Digester Digestate | AGKENGMNELLKKIMEITGVGDEAARKVIDEVVTFAKEKVPGPFQHFVDQIFERDE |
| Ga0208824_10561422 | 3300025629 | Anaerobic Digestor Sludge | MDELLRKIMEITGAGDEAARKVVDEVVAYAKSKVPGPFQHFVDQIFERDE |
| Ga0208198_10762523 | 3300025638 | Anaerobic Digestor Sludge | MDELLRKIMEITGAGDEAARKVVDEVVAYAKSKVPGPFQHFVDQIFEREE |
| Ga0208198_11184162 | 3300025638 | Anaerobic Digestor Sludge | MDELLKKIMEITGAGDEAARKVVDEVVAFAKSKVPGPFQHFVDQIFERDE |
| Ga0209507_11683712 | 3300025706 | Anaerobic Digestor Sludge | LKKIMEITGAGDEAARKVIDEVVAFAKEKVPGPFQHFVDQIFERDE |
| Ga0209201_100031116 | 3300025708 | Anaerobic Digestor Sludge | MDDLLRKIMEITGAGDEAARKVVDEVVAFAKSKVPGPFQHFVDQIFERDE |
| Ga0209310_10381951 | 3300025715 | Anaerobic Digestor Sludge | MDELLKKIMEITGAGDEAARKVIDEVVAFAKEKVPGPFQHFVDQIFERDE |
| Ga0209310_12380821 | 3300025715 | Anaerobic Digestor Sludge | MDELLKKIMEITGAGDEAARKVIDEVVTFAKEKVPGPFQHFVDQIFERDE |
| Ga0208197_10580292 | 3300025720 | Anaerobic Digestor Sludge | MDELLKKIMEITGAGDEAARKVVDEVVAFAKSKVPGPFQHFVDQIFERDES |
| Ga0209745_11380852 | 3300025739 | Arctic Peat Soil | MDELIKTIMEKAGITEEAARSIIDEVVAYTKSKVPDPFQHFVDQIFEREE |
| Ga0208940_10704813 | 3300025740 | Anaerobic Digestor Sludge | MEELLKKIMEITGAGDEAARKVVDEVVAFAKSKVPGPFQHFVDQIFERDE |
| Ga0209200_10418503 | 3300025784 | Anaerobic Digestor Sludge | MDDLLRKIMEITGAGDEAARKVVDEVVAFAKSKVPGPFQHFVDQIFE |
| Ga0209604_12200481 | 3300025856 | Anaerobic Digestor Sludge | LRKENGMDDLLRKIMEITGAGDEAARKVVDEVVAFAKSKVPGPFQHFVDQIFERDE |
| Ga0210146_10018593 | 3300025963 | Natural And Restored Wetlands | MDELIQSIIEKTGISREAALQIIDEVVAFAKSKVPGPFQHFVDQIFEREE |
| Ga0210137_10117921 | 3300025980 | Natural And Restored Wetlands | LIQSIIEKTGISREAALQIIDEVVAFAKSKVPGPFQHFVDQIFEREE |
| Ga0209269_10132823 | 3300027051 | Enrichment Culture | MDELLKKIMEITGAGDEAARKVVDEVVAYTKSKVPGPFQHFVDQIFERDE |
| Ga0208665_100994162 | 3300027715 | Deep Subsurface | MDELLKKIMEITGASDEEARKVVDEVVAFAKEKVPGPFQHFVDQIFERDSE |
| Ga0208665_102877241 | 3300027715 | Deep Subsurface | METDMDELIKTIMEKAGITEEAARGIIDEVVAYTKSKVPGPFQHFVDQIFERDE |
| Ga0209682_100571251 | 3300027716 | Wetland Sediment | MDELIRSIIEKTGISREAALQIIDEVVAFTKSKVPGPFQHF |
| Ga0209450_100078043 | 3300027885 | Freshwater Lake Sediment | MDKEERMDELLKKIMEITGAGDEAARKVVDEVVAFAREKVPGPFQHFVDQIFERDE |
| Ga0208980_100007095 | 3300027887 | Wetland | MDELLKKIMEITGTSDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFEREE |
| Ga0209496_100126213 | 3300027890 | Wetland | MDELLKKIMEITGAGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFERDSE |
| Ga0209254_100112463 | 3300027897 | Freshwater Lake Sediment | MDELIKTIMEKAGITEEAARNIIDEVVAYTKSKVPGPFQHFVDQIFEREE |
| Ga0209254_103638162 | 3300027897 | Freshwater Lake Sediment | MDELLKKIMEITGAGDEAARKVVDEVVAFAREKVPGPFQHFVDQIFEREESDG |
| Ga0209668_106633802 | 3300027899 | Freshwater Lake Sediment | LMKEDRMDELLKKIMEITGAGDEAARKVVDEVVAFAREKVPGPFQHFVDQIFERDE |
| Ga0209253_101069033 | 3300027900 | Freshwater Lake Sediment | MEKDKDMDELIKTIMEKAGITEEAARSIIDEVVAYTKSKVPGPFQHFVDQIFEREE |
| Ga0209253_104558512 | 3300027900 | Freshwater Lake Sediment | MDKEERMDELLKKIMEITGTSDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFEREE |
| Ga0209048_100646232 | 3300027902 | Freshwater Lake Sediment | MDELIKTIMEKAGITEEAARGIIDDVVAYTKSKVPGPFQHFVDQIFEREE |
| Ga0167330_10044205 | 3300029781 | Biosolids | MDELLKKIKEITGAGDEAARKVIDEVVAFAKEKVPGPFQHFVDQIFERDE |
| Ga0315290_102828383 | 3300031834 | Sediment | METDMDELIKTIMEKAGITEDAARSIIDEVVAYTKSKVPGPFQHFVDQIFEREE |
| Ga0315278_100127323 | 3300031997 | Sediment | MDELIKTIMEKAGITEDAARSIIDEVVAYTKSKVPGPFQHFVDQIFEREE |
| Ga0315292_106243192 | 3300032143 | Sediment | MDELIKTIMEKAGITEETARGIIDEVVAYTKSKVPGPFQHFVDQIFERDE |
| Ga0315287_106387472 | 3300032397 | Sediment | MDELIKTIMEKAGITEEAARGIIDEVVAYTKSKVPGPFQHFVDQIFERDE |
| Ga0315275_107065041 | 3300032401 | Sediment | MDELIKTIMEKAGITEDAARSIIDEVVAYTKSKVPGPFQHFVDQIFERDE |
| Ga0335071_110451562 | 3300032897 | Soil | MDELIRTIMEKAGISEEAARGIIDEVVAWTKTKVPGPFQHFVDQIFEREE |
| Ga0335084_100841704 | 3300033004 | Soil | MDELIRTIMEKAGITEEAARGIIDEVVAYTKTKVPGPFQHFVDQIFEREE |
| Ga0316604_101183283 | 3300033406 | Soil | MDELLKKIMEITGAGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFE |
| Ga0316604_101673541 | 3300033406 | Soil | MDKEYRMDELLKKIMEITGAGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFERDSE |
| Ga0316604_103552502 | 3300033406 | Soil | MDELLKKIMEITGASDEEARKVVDEVVAFAKEKVPGPFQHFVDQIFERDE |
| Ga0316604_105545711 | 3300033406 | Soil | MDKEERMDELLKKIMEITGAGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFERDE |
| Ga0316605_120772982 | 3300033408 | Soil | MMEENGMDELLKKIMEITGAGDEAARKVVDEVVAYTKSKVPGPFQHFVDQIFERDE |
| Ga0316603_101192931 | 3300033413 | Soil | SLARRDFIMETDMDELIKTIMEKAGITEEAARGIIDEVVAYTKSKVPGPFQHFVDQIFERDE |
| Ga0316603_120057021 | 3300033413 | Soil | MDELLKKIMEITGAGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFEREE |
| Ga0316603_122077491 | 3300033413 | Soil | MDELLKKIMEITGAGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIF |
| Ga0316619_100102165 | 3300033414 | Soil | MDELLKKIMEITGASDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFERDE |
| Ga0316619_108435961 | 3300033414 | Soil | RMDELLKKIMEITGAGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFERDSE |
| Ga0316619_113838572 | 3300033414 | Soil | MDELLKKIMEITGAGDEAARKVVDEVVAFAKEKVPGPFQHF |
| Ga0316625_1014920472 | 3300033418 | Soil | MDELIKTIMEKAGITEEAARGIIDEVVAYTKSKVPGPFQHFVDQIFERD |
| Ga0316625_1016102271 | 3300033418 | Soil | MDKEYRMEELLKKIMEITGAGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFERDSE |
| Ga0316601_1021924331 | 3300033419 | Soil | MEELLKKIMEITGAGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIF |
| Ga0326726_106638782 | 3300033433 | Peat Soil | MDELIQSIIEKTGISREAALQIIDDVVAFAKAKVPGPFQHFVDQIFEREE |
| Ga0326726_112732322 | 3300033433 | Peat Soil | VDELIQSIIEKTGISREAAVQIIDDVVAFAKSKVPGPFQHFVDQIFEREE |
| Ga0326726_115872721 | 3300033433 | Peat Soil | MDELIKTIMEKAGITEEAARGIIDEVVAFAKSKVPGPFQHFVDQIFEREE |
| Ga0316620_106865861 | 3300033480 | Soil | SLARRNFFMETNMDELIKTIMEKAGITEEAARGIIDEVVAYTKSKVPGPFQHFVDQIFERDE |
| Ga0316600_110779331 | 3300033481 | Soil | MDELLKKIMEITGASDEEARKVVDEVVAFAKEKVPGPFQHF |
| Ga0316627_1010538081 | 3300033482 | Soil | HHLTKEDGMDELLKKIMEITGVGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFERDE |
| Ga0316629_109845362 | 3300033483 | Soil | MDKEERMDELLKKIMEITGASDEEARKVVDEVVAFAKEKVPGPFQHFVDQIFERDE |
| Ga0316624_114177041 | 3300033486 | Soil | MDELIQSIIEKTGISREAALQIIDDVVAFAKSKVPGPFQHFVDQIFEREE |
| Ga0316630_121281472 | 3300033487 | Soil | MDELLKKIMEITGAGDEAARKVVDEVVAFAKEKVPGPFQHFVD |
| Ga0316621_107780312 | 3300033488 | Soil | MDKEYRMEELLKKIMEITGAGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFERDE |
| Ga0316616_1002444501 | 3300033521 | Soil | KEYRMEELLKKIMEITGAGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFERDSE |
| Ga0316616_1005105601 | 3300033521 | Soil | LLKKIMEITGAGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFERDE |
| Ga0316616_1019833673 | 3300033521 | Soil | MDELLKKIMEITGAGDEAARKVVDEVVAFAREKVPGPFQHFVDQIFERDE |
| Ga0316616_1026722212 | 3300033521 | Soil | MDEENRMDELLKKIMEITGAGDEAARKVVDEVVAFAKEKVPGPFQHFVDQIFERDE |
| Ga0370479_0003273_1727_1891 | 3300034123 | Untreated Peat Soil | METDMDELIKTIMEKAGITEEAARSIIDEVVAYTKSKVPGPFQHFVDQIFEREE |
| Ga0370486_007325_1961_2125 | 3300034126 | Untreated Peat Soil | MEQDMDELIKTIMEKAGITEEAARSIIDEVVAYTKSKVPGPFQHFVDQIFERDE |
| Ga0370490_0008147_1290_1478 | 3300034128 | Untreated Peat Soil | MEESRMDELLKKIMEITGAGDEVARQVIDEVVAYTKSKVPGPFQHFVDQIFERDEEKTVTSD |
| ⦗Top⦘ |