


| Basic Information | |
|---|---|
| Family ID | F049015 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 147 |
| Average Sequence Length | 40 residues |
| Representative Sequence | WIIRRTIIMKLKEHIPHFVKEHKKAIAVAVVILIIAIII |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 147 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.68 % |
| % of genes near scaffold ends (potentially truncated) | 97.96 % |
| % of genes from short scaffolds (< 2000 bps) | 92.52 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.340 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater (35.374 % of family members) |
| Environment Ontology (ENVO) | Unclassified (91.156 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (92.517 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.73% β-sheet: 0.00% Coil/Unstructured: 46.27% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 147 Family Scaffolds |
|---|---|---|
| PF07847 | PCO_ADO | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 50.34 % |
| All Organisms | root | All Organisms | 48.98 % |
| unclassified Hyphomonas | no rank | unclassified Hyphomonas | 0.68 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10155873 | Not Available | 830 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10044660 | All Organisms → Viruses → Predicted Viral | 1819 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10063383 | Not Available | 1376 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10183868 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10147682 | Not Available | 809 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10188500 | Not Available | 670 | Open in IMG/M |
| 3300001450|JGI24006J15134_10050018 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1714 | Open in IMG/M |
| 3300001450|JGI24006J15134_10084098 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1182 | Open in IMG/M |
| 3300001460|JGI24003J15210_10180775 | All Organisms → Viruses → environmental samples → uncultured marine virus | 511 | Open in IMG/M |
| 3300001472|JGI24004J15324_10120399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 644 | Open in IMG/M |
| 3300002242|KVWGV2_10044341 | All Organisms → Viruses → environmental samples → uncultured marine virus | 670 | Open in IMG/M |
| 3300004460|Ga0066222_1026895 | Not Available | 871 | Open in IMG/M |
| 3300005239|Ga0073579_1490764 | Not Available | 1030 | Open in IMG/M |
| 3300005837|Ga0078893_10131707 | Not Available | 8578 | Open in IMG/M |
| 3300006029|Ga0075466_1080007 | All Organisms → Viruses → environmental samples → uncultured marine virus | 913 | Open in IMG/M |
| 3300006382|Ga0075494_1421122 | Not Available | 615 | Open in IMG/M |
| 3300006737|Ga0098037_1175276 | unclassified Hyphomonas → Hyphomonas sp. | 711 | Open in IMG/M |
| 3300006737|Ga0098037_1213752 | Not Available | 627 | Open in IMG/M |
| 3300006749|Ga0098042_1096788 | All Organisms → Viruses → environmental samples → uncultured marine virus | 751 | Open in IMG/M |
| 3300006752|Ga0098048_1061372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1168 | Open in IMG/M |
| 3300006752|Ga0098048_1204840 | All Organisms → Viruses → environmental samples → uncultured marine virus | 582 | Open in IMG/M |
| 3300006793|Ga0098055_1247289 | Not Available | 671 | Open in IMG/M |
| 3300006810|Ga0070754_10534555 | Not Available | 502 | Open in IMG/M |
| 3300006916|Ga0070750_10008521 | Not Available | 5470 | Open in IMG/M |
| 3300006916|Ga0070750_10101671 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1332 | Open in IMG/M |
| 3300006919|Ga0070746_10037654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 2571 | Open in IMG/M |
| 3300006919|Ga0070746_10223321 | All Organisms → Viruses → environmental samples → uncultured marine virus | 889 | Open in IMG/M |
| 3300006920|Ga0070748_1293996 | Not Available | 578 | Open in IMG/M |
| 3300006921|Ga0098060_1045597 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1305 | Open in IMG/M |
| 3300006922|Ga0098045_1032162 | Not Available | 1347 | Open in IMG/M |
| 3300006922|Ga0098045_1039189 | All Organisms → Viruses → Predicted Viral | 1199 | Open in IMG/M |
| 3300006929|Ga0098036_1131104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 767 | Open in IMG/M |
| 3300006929|Ga0098036_1188494 | Not Available | 627 | Open in IMG/M |
| 3300007229|Ga0075468_10183373 | Not Available | 618 | Open in IMG/M |
| 3300007276|Ga0070747_1112749 | All Organisms → Viruses → environmental samples → uncultured marine virus | 996 | Open in IMG/M |
| 3300008012|Ga0075480_10144559 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1296 | Open in IMG/M |
| 3300009193|Ga0115551_1198225 | Not Available | 903 | Open in IMG/M |
| 3300009435|Ga0115546_1037360 | All Organisms → Viruses → Predicted Viral | 1933 | Open in IMG/M |
| 3300009443|Ga0115557_1052557 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1830 | Open in IMG/M |
| 3300009472|Ga0115554_1329644 | Not Available | 601 | Open in IMG/M |
| 3300009495|Ga0115571_1163632 | All Organisms → Viruses → environmental samples → uncultured marine virus | 926 | Open in IMG/M |
| 3300009543|Ga0115099_11043890 | Not Available | 755 | Open in IMG/M |
| 3300009703|Ga0114933_10661811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 671 | Open in IMG/M |
| 3300009790|Ga0115012_11016042 | Not Available | 686 | Open in IMG/M |
| 3300010149|Ga0098049_1253815 | All Organisms → Viruses → environmental samples → uncultured marine virus | 534 | Open in IMG/M |
| 3300011013|Ga0114934_10533887 | Not Available | 518 | Open in IMG/M |
| 3300011118|Ga0114922_10610301 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300011258|Ga0151677_1107846 | Not Available | 856 | Open in IMG/M |
| 3300013195|Ga0116815_1061854 | Not Available | 540 | Open in IMG/M |
| 3300017697|Ga0180120_10171150 | All Organisms → Viruses → environmental samples → uncultured marine virus | 912 | Open in IMG/M |
| 3300017708|Ga0181369_1107146 | All Organisms → Viruses → environmental samples → uncultured marine virus | 577 | Open in IMG/M |
| 3300017709|Ga0181387_1009348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1905 | Open in IMG/M |
| 3300017710|Ga0181403_1106777 | All Organisms → Viruses → environmental samples → uncultured marine virus | 585 | Open in IMG/M |
| 3300017713|Ga0181391_1021983 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1583 | Open in IMG/M |
| 3300017713|Ga0181391_1040662 | Not Available | 1114 | Open in IMG/M |
| 3300017713|Ga0181391_1049854 | Not Available | 990 | Open in IMG/M |
| 3300017713|Ga0181391_1122830 | All Organisms → Viruses → environmental samples → uncultured marine virus | 581 | Open in IMG/M |
| 3300017714|Ga0181412_1057171 | All Organisms → Viruses → environmental samples → uncultured marine virus | 977 | Open in IMG/M |
| 3300017717|Ga0181404_1101239 | Not Available | 706 | Open in IMG/M |
| 3300017717|Ga0181404_1125319 | Not Available | 626 | Open in IMG/M |
| 3300017719|Ga0181390_1075390 | Not Available | 941 | Open in IMG/M |
| 3300017727|Ga0181401_1110571 | Not Available | 692 | Open in IMG/M |
| 3300017729|Ga0181396_1047883 | Not Available | 851 | Open in IMG/M |
| 3300017732|Ga0181415_1060561 | Not Available | 858 | Open in IMG/M |
| 3300017733|Ga0181426_1023832 | Not Available | 1201 | Open in IMG/M |
| 3300017734|Ga0187222_1016785 | Not Available | 1788 | Open in IMG/M |
| 3300017734|Ga0187222_1059437 | Not Available | 884 | Open in IMG/M |
| 3300017737|Ga0187218_1035642 | Not Available | 1265 | Open in IMG/M |
| 3300017737|Ga0187218_1065974 | Not Available | 888 | Open in IMG/M |
| 3300017737|Ga0187218_1066919 | Not Available | 881 | Open in IMG/M |
| 3300017738|Ga0181428_1170891 | Not Available | 508 | Open in IMG/M |
| 3300017743|Ga0181402_1117141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 683 | Open in IMG/M |
| 3300017744|Ga0181397_1040470 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1312 | Open in IMG/M |
| 3300017745|Ga0181427_1001106 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6760 | Open in IMG/M |
| 3300017748|Ga0181393_1003974 | Not Available | 4889 | Open in IMG/M |
| 3300017749|Ga0181392_1112375 | Not Available | 809 | Open in IMG/M |
| 3300017752|Ga0181400_1044350 | All Organisms → Viruses → Predicted Viral | 1393 | Open in IMG/M |
| 3300017755|Ga0181411_1032866 | Not Available | 1646 | Open in IMG/M |
| 3300017755|Ga0181411_1042607 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1414 | Open in IMG/M |
| 3300017755|Ga0181411_1074016 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1027 | Open in IMG/M |
| 3300017755|Ga0181411_1089149 | All Organisms → Viruses → environmental samples → uncultured marine virus | 919 | Open in IMG/M |
| 3300017755|Ga0181411_1120991 | All Organisms → Viruses → environmental samples → uncultured marine virus | 765 | Open in IMG/M |
| 3300017756|Ga0181382_1092642 | Not Available | 825 | Open in IMG/M |
| 3300017756|Ga0181382_1129638 | Not Available | 668 | Open in IMG/M |
| 3300017757|Ga0181420_1139536 | Not Available | 728 | Open in IMG/M |
| 3300017759|Ga0181414_1058498 | All Organisms → Viruses → Predicted Viral | 1029 | Open in IMG/M |
| 3300017760|Ga0181408_1015863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2101 | Open in IMG/M |
| 3300017763|Ga0181410_1071893 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1031 | Open in IMG/M |
| 3300017765|Ga0181413_1017447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 2248 | Open in IMG/M |
| 3300017767|Ga0181406_1061619 | Not Available | 1153 | Open in IMG/M |
| 3300017767|Ga0181406_1125405 | Not Available | 774 | Open in IMG/M |
| 3300017768|Ga0187220_1241837 | All Organisms → Viruses → environmental samples → uncultured marine virus | 540 | Open in IMG/M |
| 3300017769|Ga0187221_1058884 | Not Available | 1221 | Open in IMG/M |
| 3300017770|Ga0187217_1039199 | Not Available | 1667 | Open in IMG/M |
| 3300017770|Ga0187217_1116492 | Not Available | 904 | Open in IMG/M |
| 3300017771|Ga0181425_1057483 | Not Available | 1262 | Open in IMG/M |
| 3300017772|Ga0181430_1037541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1532 | Open in IMG/M |
| 3300017772|Ga0181430_1146719 | Not Available | 686 | Open in IMG/M |
| 3300017773|Ga0181386_1130964 | Not Available | 773 | Open in IMG/M |
| 3300017781|Ga0181423_1087595 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1225 | Open in IMG/M |
| 3300017786|Ga0181424_10115230 | Not Available | 1159 | Open in IMG/M |
| 3300017786|Ga0181424_10188528 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 876 | Open in IMG/M |
| 3300020325|Ga0211507_1004721 | All Organisms → Viruses → environmental samples → uncultured marine virus | 2890 | Open in IMG/M |
| 3300020335|Ga0211690_1123993 | Not Available | 546 | Open in IMG/M |
| 3300020378|Ga0211527_10151937 | Not Available | 659 | Open in IMG/M |
| 3300020385|Ga0211677_10311049 | Not Available | 628 | Open in IMG/M |
| 3300020395|Ga0211705_10003326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 6593 | Open in IMG/M |
| 3300020395|Ga0211705_10040830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1678 | Open in IMG/M |
| 3300020410|Ga0211699_10051086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1537 | Open in IMG/M |
| 3300020413|Ga0211516_10299879 | All Organisms → Viruses → environmental samples → uncultured marine virus | 722 | Open in IMG/M |
| 3300021960|Ga0222715_10537060 | Not Available | 614 | Open in IMG/M |
| 3300022067|Ga0196895_1031735 | Not Available | 603 | Open in IMG/M |
| 3300022068|Ga0212021_1076676 | Not Available | 685 | Open in IMG/M |
| 3300022074|Ga0224906_1059559 | Not Available | 1200 | Open in IMG/M |
| 3300024344|Ga0209992_10309934 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 642 | Open in IMG/M |
| 3300025048|Ga0207905_1021932 | Not Available | 1060 | Open in IMG/M |
| 3300025070|Ga0208667_1055838 | Not Available | 628 | Open in IMG/M |
| 3300025083|Ga0208791_1023236 | Not Available | 1235 | Open in IMG/M |
| 3300025086|Ga0208157_1039519 | Not Available | 1316 | Open in IMG/M |
| 3300025099|Ga0208669_1102083 | Not Available | 597 | Open in IMG/M |
| 3300025102|Ga0208666_1011983 | All Organisms → Viruses → Predicted Viral | 2950 | Open in IMG/M |
| 3300025120|Ga0209535_1084811 | All Organisms → Viruses → Predicted Viral | 1186 | Open in IMG/M |
| 3300025128|Ga0208919_1069259 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1175 | Open in IMG/M |
| 3300025137|Ga0209336_10052789 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1255 | Open in IMG/M |
| 3300025137|Ga0209336_10058194 | All Organisms → Viruses → Predicted Viral | 1178 | Open in IMG/M |
| 3300025137|Ga0209336_10059183 | All Organisms → Viruses | 1164 | Open in IMG/M |
| 3300025137|Ga0209336_10178520 | All Organisms → Viruses → environmental samples → uncultured marine virus | 539 | Open in IMG/M |
| 3300025138|Ga0209634_1062688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1781 | Open in IMG/M |
| 3300025138|Ga0209634_1137025 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1020 | Open in IMG/M |
| 3300025138|Ga0209634_1138121 | Not Available | 1014 | Open in IMG/M |
| 3300025138|Ga0209634_1148307 | Not Available | 961 | Open in IMG/M |
| 3300025168|Ga0209337_1106297 | Not Available | 1296 | Open in IMG/M |
| 3300025626|Ga0209716_1171393 | Not Available | 544 | Open in IMG/M |
| 3300025641|Ga0209833_1170429 | Not Available | 554 | Open in IMG/M |
| 3300025769|Ga0208767_1142959 | Not Available | 883 | Open in IMG/M |
| 3300025849|Ga0209603_1061500 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1887 | Open in IMG/M |
| 3300025849|Ga0209603_1099258 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1305 | Open in IMG/M |
| 3300025853|Ga0208645_1152607 | All Organisms → Viruses → environmental samples → uncultured marine virus | 876 | Open in IMG/M |
| 3300026292|Ga0208277_1066164 | All Organisms → Viruses → Predicted Viral | 1425 | Open in IMG/M |
| 3300026292|Ga0208277_1067688 | All Organisms → Viruses → Predicted Viral | 1401 | Open in IMG/M |
| 3300027779|Ga0209709_10205881 | Not Available | 910 | Open in IMG/M |
| 3300031569|Ga0307489_11115486 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300031659|Ga0307986_10096270 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1445 | Open in IMG/M |
| 3300032073|Ga0315315_11355164 | All Organisms → Viruses → environmental samples → uncultured marine virus | 623 | Open in IMG/M |
| 3300032088|Ga0315321_10672689 | Not Available | 604 | Open in IMG/M |
| 3300033742|Ga0314858_031000 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1234 | Open in IMG/M |
| 3300034374|Ga0348335_029720 | Not Available | 2429 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 35.37% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 26.53% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 10.88% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 6.12% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 6.12% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 4.08% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 2.04% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.36% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.68% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.68% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.68% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.68% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.68% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.68% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.68% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.68% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.68% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.68% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300002242 | Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006382 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009443 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009543 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300011258 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeate | Environmental | Open in IMG/M |
| 3300013195 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 10m_Station7_GOM_Metagenome | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017729 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017734 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2) | Environmental | Open in IMG/M |
| 3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300020325 | Marine microbial communities from Tara Oceans - TARA_B100000034 (ERX556073-ERR598966) | Environmental | Open in IMG/M |
| 3300020335 | Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX556030-ERR599035) | Environmental | Open in IMG/M |
| 3300020378 | Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556006-ERR599102) | Environmental | Open in IMG/M |
| 3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
| 3300020395 | Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX555987-ERR599133) | Environmental | Open in IMG/M |
| 3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
| 3300020413 | Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX555962-ERR599092) | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300022067 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025048 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025641 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300026292 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205 (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
| 3300031659 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_101558732 | 3300000101 | Marine | YDGCSSRWTGWIIRRTIIMKIKEHIPHFVKEHKKAVAIAVVILIIAIII* |
| DelMOSum2011_100446603 | 3300000115 | Marine | SWWIIRRTIIMNIKEHIPHFVKEHKKAIAVAVVILVIAIII* |
| DelMOSum2011_100633833 | 3300000115 | Marine | IIRRTIIMKLKEHIPHFVKEHKKAIGIAIIVFIIAIII* |
| DelMOSum2011_101838683 | 3300000115 | Marine | KRIRRNIIMKIQEHVTHFVKEHKKAIAIAVVILIIAIII* |
| DelMOSpr2010_101476822 | 3300000116 | Marine | RTIIMNIKEHIPHFVKEHKKAIAVAVVILVIAIII* |
| DelMOSpr2010_101885002 | 3300000116 | Marine | CNGWSYRWTWWIIRRTIIMDLKQHIPHFVKEHKKAVAIAVVILIIAIII* |
| JGI24006J15134_100500181 | 3300001450 | Marine | RWTWWIIRRTIIMKIQEHIPHFVKEHKKAIAIAIVILIIAIII* |
| JGI24006J15134_100840981 | 3300001450 | Marine | WTWWIIRRTIIMKIQEHIPHFVKEHKKAVAIAVVILIIAIII* |
| JGI24003J15210_101807751 | 3300001460 | Marine | RKEMNLKDHIPHFVEEHKKAIAVVVVILIIAIIL* |
| JGI24004J15324_101203992 | 3300001472 | Marine | RRKISRSILMNLKEHIPHFVAEHKKAIAVAVVVLIIAIII* |
| KVWGV2_100443411 | 3300002242 | Marine Sediment | ARHGSCNRWWFWIIRRVIIMNLKDHIPHFVEEHKKAIAVAIVILVIAIII* |
| Ga0066222_10268951 | 3300004460 | Marine | SSRWTGWIIRRTIIMKLKEHIPHFVKEHKKAIAIAVVILIIAIII* |
| Ga0073579_14907641 | 3300005239 | Marine | VDIRRTIIMKLKEHIPHFVKEHKKAIAVAVVILVIAIII* |
| Ga0078893_1013170714 | 3300005837 | Marine Surface Water | IIRRTIIMNLKEHIPHFVAEHKKAIAVAVVILVIAIII* |
| Ga0075466_10800072 | 3300006029 | Aqueous | IIRRTIIMNLKEHIPHFVAEHKKAIAVAIVILVIAIII* |
| Ga0075494_14211222 | 3300006382 | Aqueous | TIIMKIKEHIPHFVKEHKKALAIAVVILIIAIII* |
| Ga0098037_11752761 | 3300006737 | Marine | RTIIMNLKEHIPHFVAEHKKAIAVAVVILVIAIII* |
| Ga0098037_12137522 | 3300006737 | Marine | IRRTIIMNLKEHIPHFVKEHKKAIAVAVVILVIAIII* |
| Ga0098042_10967882 | 3300006749 | Marine | WIIRRTIIMNLKEHIPHFVAEHKKAIAVAVVILVIAIII* |
| Ga0098048_10613721 | 3300006752 | Marine | RRTIIMNLKEHIPHFVAEHKKAIAVAVVILVIAIII* |
| Ga0098048_12048402 | 3300006752 | Marine | IRRTIIMNLKEHIPHFVAEHKKAIAVAVVILVIAIII* |
| Ga0098055_12472892 | 3300006793 | Marine | WWIIRRTIIMNLKQHIPHFVKEHKKAIAVAVVILVIAIII* |
| Ga0070754_105345552 | 3300006810 | Aqueous | WTGWIIRRTIIMKIKEHIPHFVKEHKKAIAVAVVILIIAIII* |
| Ga0070750_100085211 | 3300006916 | Aqueous | IFRGVIIMKLKEHIPHFVEEHKKAIAVAVVILIIAIIL* |
| Ga0070750_101016713 | 3300006916 | Aqueous | IRRTIIMNLKEHIPHFVKEHKKAIAVAVVILIVAIII* |
| Ga0070746_100376543 | 3300006919 | Aqueous | YDRSSNWWFRWIIRRTIIMNLKEHIPHFVAEHKKAIAVAVVILVIAIII* |
| Ga0070746_102233212 | 3300006919 | Aqueous | TIIMNLKEHIPHFVAEHKKAIAVAVVILVIAIII* |
| Ga0070748_12939962 | 3300006920 | Aqueous | WIIRRTIIMKIQEHIPHFVKEHKKAIAIAVVILITAIII* |
| Ga0098060_10455973 | 3300006921 | Marine | IRRTIIMNLKQHIPHFVKEHKKAIAVAVVILVIAIII* |
| Ga0098045_10321623 | 3300006922 | Marine | WIIRRTIIMNLKEHIPHFVKEHKKAIAVAVVILVIAIII* |
| Ga0098045_10391893 | 3300006922 | Marine | TIIMNLKEHIPHFIKEHKKAIAVAVVILVIAIII* |
| Ga0098036_11311041 | 3300006929 | Marine | WIIRRVIIMNLKDHIPHFVEEHKKAIAIAIVILVIAIII* |
| Ga0098036_11884943 | 3300006929 | Marine | IIRRTIIMKIQEHIPHFVKEHKKAIAVAVVILIIAIIL* |
| Ga0075468_101833732 | 3300007229 | Aqueous | IIRRTIIMKIQEHIPHFVKEHKKAIAIAVVILIIAIII* |
| Ga0070747_11127493 | 3300007276 | Aqueous | SSRWTGWIIRRTIIMNLKEHIPHFVAEHKKAIAVAVVILVIAIII* |
| Ga0075480_101445591 | 3300008012 | Aqueous | RTIIMNLKEHIPHFVKEHKKAIAVAVVILIVAIII* |
| Ga0115551_11982251 | 3300009193 | Pelagic Marine | WSWWIIRRTIIMNLKEHIPHFVAEHKKAIAVAVVILVIAIII* |
| Ga0115546_10373601 | 3300009435 | Pelagic Marine | WIIRRTIIMKLKEHIPHFVKEHKKAIAVAVVILIIAIII* |
| Ga0115557_10525571 | 3300009443 | Pelagic Marine | SSNRWTWWIIRRTIIMKLKEHIPHFVKEHKKALAIAVVILIIAIII* |
| Ga0115554_13296442 | 3300009472 | Pelagic Marine | IWSYDGCSSRWIGWIIRMTIIMNIQEHIPHFVKEHKKAIAVAVVILIIAIII* |
| Ga0115571_11636321 | 3300009495 | Pelagic Marine | IRRTIIMNLKEHIPHFVKEHKKAIAVAVVILIIAIII* |
| Ga0115099_110438901 | 3300009543 | Marine | YWCINRWWSRILRGIIIMKIQEHIPHFIKEHKKAIAVAVVILIVAIIL* |
| Ga0114933_106618112 | 3300009703 | Deep Subsurface | GIIRRIIIMNLKDHIPHFVEEHKKAIAIAVVILVIAIII* |
| Ga0115012_110160422 | 3300009790 | Marine | MGSSYRWWYGIIRRIIIMNLKDHIPHFVEEHKKAIAIAVVILVIAIII* |
| Ga0098049_12538151 | 3300010149 | Marine | IIRRVIIMNLKDHIPHFVEEHKKAIAIAVVILVIAIII* |
| Ga0114934_105338872 | 3300011013 | Deep Subsurface | SWWIIRRTIIMNLKEHIPHFVKEHKKAIAVAVVILIIAIII* |
| Ga0114922_106103012 | 3300011118 | Deep Subsurface | MKLKEHIPHFVKEHKKAIGIAIIVFIIAIIILCNML* |
| Ga0151677_11078463 | 3300011258 | Marine | WIIRRTIIMKIQEHIPHFVKEHKKAIAVAVVILVIAIIL* |
| Ga0116815_10618541 | 3300013195 | Marine | SWIWIIRRTIIMKLKEHIPHIIKEHKKEAIAIIAIIVILAIL* |
| Ga0180120_101711501 | 3300017697 | Freshwater To Marine Saline Gradient | WYWWIIRRTIIMNLKEHIPHFVAEHKKAIAVAVVILVIAIII |
| Ga0181369_11071461 | 3300017708 | Marine | IIRRTIIMNLKEHIPHFVAEHKKAIAVAVVILVIAIII |
| Ga0181387_10093483 | 3300017709 | Seawater | IRRTIIMNLKEHIPHFVAEHKKAIAVAVVILVIAIII |
| Ga0181403_11067772 | 3300017710 | Seawater | SWWIIRRTIIMNLKEHIPHFVKEHKKAIAVAVVILIVAIII |
| Ga0181391_10219833 | 3300017713 | Seawater | IRRIIIMNLKQHLPHFVAEHKKAIAVAVVILIIAIII |
| Ga0181391_10406622 | 3300017713 | Seawater | WIIRRTIIMNLKEHIPHFVAEHKKAIAVAVVILVIAIII |
| Ga0181391_10498541 | 3300017713 | Seawater | CCSRWIIRRTIIMNLKDHIPHFVEEHKKAIAIAVVILIIAIIL |
| Ga0181391_11228301 | 3300017713 | Seawater | SNRWSWWIIRRTIIMNLKEHIPHFVAEHKKAIAIAVVILVIAIII |
| Ga0181412_10571712 | 3300017714 | Seawater | IRRTIIMNLKEHIPHFVKEHKKAIAVAVVILVIAIII |
| Ga0181404_11012393 | 3300017717 | Seawater | RWIIRRTIIMKIQEHIPHFVKEHKKAIAVAVVILIIAIIL |
| Ga0181404_11253192 | 3300017717 | Seawater | HGSTYWWWNGIIRRTIIMNLKQHIPHFVKEHKKAIAVAVVILVIAIII |
| Ga0181390_10753901 | 3300017719 | Seawater | NRHRHGSTYWWWHGIIRRTIIMNLKEHIPHFLKEHKKAIAVAVVILIIAIII |
| Ga0181401_11105711 | 3300017727 | Seawater | RTIIMNLKEHIPHFVKEHKKAIAVAVVILVIAIII |
| Ga0181396_10478833 | 3300017729 | Seawater | WFRIFRGVIIMKLKEHIPHFVEEHKKAIAVAVVILIIAIII |
| Ga0181415_10605611 | 3300017732 | Seawater | HGIIRRTIIMNLKEHIPHFVKEHKKAIAVAVVILVIAIII |
| Ga0181426_10238323 | 3300017733 | Seawater | XYTLRGKIKMNLKEHIPHFVAEHKKAIAVAVVILVIAIIL |
| Ga0187222_10167851 | 3300017734 | Seawater | LRGKIKMNLKEHIPHFVAEHKKAIAVAVVILIIAIVI |
| Ga0187222_10594371 | 3300017734 | Seawater | KYAFSRNRWSNWWSIIRRTIIMKIQQHIPHFVKEHKKAIAIAVVILIIAIIL |
| Ga0187218_10356421 | 3300017737 | Seawater | IRRTIIMKIQEHIPHFIKEHKKAIAVAVVILIVAIIL |
| Ga0187218_10659742 | 3300017737 | Seawater | GIIRRTIIMNLKEHIPHFLKEHKKAIAVAVVILIIAIII |
| Ga0187218_10669191 | 3300017737 | Seawater | RRTIIMNLKEHIPHFVAEHKKAIAVAVVILVIAIII |
| Ga0181428_11708912 | 3300017738 | Seawater | RTIIIKIQEHIPPFIKEHKKAIVVAVVILVIAIII |
| Ga0181402_11171411 | 3300017743 | Seawater | INRWWSRILRGIIIMKIQEHIPHFVKEHKKAIAVAVVILIIAIIL |
| Ga0181397_10404703 | 3300017744 | Seawater | GIIRRTIIMNLKEHIPHFVKEHKKAIAVAVVILIVAIII |
| Ga0181427_10011066 | 3300017745 | Seawater | RTIIMKIQQHILHFVKEHKKAIAVAVVILIIAIIL |
| Ga0181393_10039741 | 3300017748 | Seawater | YWCINRWWSRILRGIIIMKIQEHIPHFVKEHKKAIAVAVVILIIAIIL |
| Ga0181392_11123751 | 3300017749 | Seawater | RRTIIMNLKEHIPHFVKEHKKAIAVAVVILITAIIL |
| Ga0181400_10443501 | 3300017752 | Seawater | RGCYWWSIIRRIIIMKIQQHIPHFVKEHKKAIAVAVVVLIIAIIL |
| Ga0181411_10328661 | 3300017755 | Seawater | CINRWWSRILRGIIIMKIQEHIPHFVKEHKKAIAVAVVILIIAIIL |
| Ga0181411_10426071 | 3300017755 | Seawater | RHGSTYWWWNGIIRRTIIMNLKEHIPHFVKEHKKAIAVAVVILIVAIII |
| Ga0181411_10740161 | 3300017755 | Seawater | RTIIMNLKEHIPHFVAEHKKAIAVAVVILVIAIII |
| Ga0181411_10891491 | 3300017755 | Seawater | STYWWWNGIIRRTIIMNLKEHIPHFVKEHKKAIAVAVVILIIAIII |
| Ga0181411_11209911 | 3300017755 | Seawater | STYWWWNGIIRRTIIMNLKEHIPHFVKEHKKAIAVAVVILIVAIII |
| Ga0181382_10926421 | 3300017756 | Seawater | WSIIRRIIIMKIQQHIPHFVKEHKKAIAVAVVILVIAIII |
| Ga0181382_11296381 | 3300017756 | Seawater | RWCCCRWTIRRTIIMKIQEHIPHFVKEHKKAIAVAVVILIIAIIL |
| Ga0181420_11395362 | 3300017757 | Seawater | GIIRRTIIMDLKQHIPHFVKEHKKAIAVAVVILVIAIII |
| Ga0181414_10584982 | 3300017759 | Seawater | CSRWIIRRTIIMNLKDHIPHFIEEHKKAIAVAVVILIIAIIL |
| Ga0181408_10158633 | 3300017760 | Seawater | WIIRRTIIMNLKDHIPHIVEEHKKAIAVAVVILIIAIII |
| Ga0181410_10718931 | 3300017763 | Seawater | SLSTIIIMKIKEHIPHFVKEHKIAIAVAVVILIVAIII |
| Ga0181413_10174473 | 3300017765 | Seawater | WWIIRRTIIMNLKEHIPHFLKEHKKAIAVAVVILVIAIII |
| Ga0181406_10616192 | 3300017767 | Seawater | GRWIIRRTIIMNLKEHIPHFVEEHKKAIAVAVVILIIAIII |
| Ga0181406_11254052 | 3300017767 | Seawater | IRRTIIMNLKEHIPHFVKEHKKAIAVAVVILIVAIII |
| Ga0187220_12418372 | 3300017768 | Seawater | RWIIRRTIIMNLKEHIPHFVAEHKKAIAVAVVILIIAIII |
| Ga0187221_10588842 | 3300017769 | Seawater | MCKIKMNLKEHIPHFVAEHKKAIAVAVVILVIAIII |
| Ga0187217_10391995 | 3300017770 | Seawater | IRRTIIMNLKEHIPHFVKEHKKAIAVAVVILIIAIVI |
| Ga0187217_11164921 | 3300017770 | Seawater | GIIRRTIIMNLKEHIPHFVKEHKKAIAVAVVILIIAIII |
| Ga0181425_10574832 | 3300017771 | Seawater | RWWFRIFRGVIIMKLKEHIPHFVEEHKKAIAVAVVILIIAIIL |
| Ga0181430_10375411 | 3300017772 | Seawater | WIIRRTIIMNLKEHIPHFVKEHKKAIAVAVVILIVAIII |
| Ga0181430_11467191 | 3300017772 | Seawater | RWIIRRTIIMKIQEHIPHFVKEHKKAIAVNVVILIIAIIL |
| Ga0181386_11309642 | 3300017773 | Seawater | IFRGVIIMKLKEHIPHFVEEHKKAIAVAVVILIIAIIL |
| Ga0181423_10875951 | 3300017781 | Seawater | RHGSTYWWWNGIIRRTIIMNLKEHIPHFVKEHKKAIAVAVVILVIAIII |
| Ga0181424_101152302 | 3300017786 | Seawater | WSRILRRIIIMKIQEHITHFVKEHKKAIAVAVVILIIAIIL |
| Ga0181424_101885284 | 3300017786 | Seawater | RRKEMNLKDHIPHFVEEHKKAIAVVVVILIVAIII |
| Ga0211507_10047211 | 3300020325 | Marine | WWIWIIRRTIIMKLKEHIPHFIEEHKKAIAVAVVILVIAIII |
| Ga0211690_11239932 | 3300020335 | Marine | IWYYWCIDRWWSRILRGIIIMKIQEHIPHFVKEHKKAIAVAVVILVIAIIL |
| Ga0211527_101519371 | 3300020378 | Marine | IWIIRRTIIMKLKEHIPHFIEEHKKAIAVAVVILVIAIII |
| Ga0211677_103110491 | 3300020385 | Marine | RIIIMKIQEHIPHFIKEHKKAIAVAVVILIIAIIL |
| Ga0211705_100033261 | 3300020395 | Marine | WWYGIIRRIIIMNLKDHIPHFVEEHKKAIAIAVIILVIAIII |
| Ga0211705_100408303 | 3300020395 | Marine | WWYGIIRRIIIMNLKDHIPHFVEEHKKAIAIAIVILVIAIII |
| Ga0211699_100510861 | 3300020410 | Marine | NWSNGSTYWWRLWIIRRIIIMKLKEHIPHFVEEHKKAIAVAVVILVIAIII |
| Ga0211516_102998791 | 3300020413 | Marine | FRWIIRRTIIMNLKEHIPHFVAEHKKAIAVAVVILVIAIII |
| Ga0222715_105370601 | 3300021960 | Estuarine Water | WWIIRRTIIMNLKEHIPHFVKEHKKAIAVAVVILVIAIII |
| Ga0196895_10317352 | 3300022067 | Aqueous | CCSWRSWWIIRRTIIMDLKQHIPHFVKEHKKAIAVAVVILIVAIII |
| Ga0212021_10766762 | 3300022068 | Aqueous | FRRTIIMNLKEHIPHFVKEHKKAIAVAVVILVIAIII |
| Ga0224906_10595592 | 3300022074 | Seawater | FGWIIRRTIIMNLKEHIPHFVAEHKKAIAVAVVILVIAIII |
| Ga0209992_103099342 | 3300024344 | Deep Subsurface | RRIIIMNLKDHIPHFVEEHKKAIAVAIVILVIAIII |
| Ga0207905_10219322 | 3300025048 | Marine | YWCIDRWWSRILRGIIIMKIQEHIPHFVKEHKKAIAVAVVILIIAIIL |
| Ga0208667_10558381 | 3300025070 | Marine | IRRTIIMNLKQHIPHFVKEHKKAIAVAVVILVIAIII |
| Ga0208791_10232362 | 3300025083 | Marine | WIIRRTIIMNLKEHIPHFVKEHKKAIAVAVVILVIAIII |
| Ga0208157_10395192 | 3300025086 | Marine | IIRRTIIMNLKEHIPHFVKEHKKAIAVAVVILVIAIII |
| Ga0208669_11020832 | 3300025099 | Marine | IIRRIIIMNLKQHIPHFVAEHKKAIAVAVVILVIAIII |
| Ga0208666_10119835 | 3300025102 | Marine | IIRRTIIMNLKEHIPHFIKEHKKAIAVAVVILVIAIII |
| Ga0209535_10848111 | 3300025120 | Marine | WWIIRRTIIMNLKEHIPHFVAEHKKAIAVAVVILIIAIII |
| Ga0208919_10692591 | 3300025128 | Marine | IIRRTIIMNLKEHIPHFVKEHKKAIAVAVVILIVAIII |
| Ga0209336_100527891 | 3300025137 | Marine | WSWWIIRRTIIMNIKEHIPHFVKEHKKAIAVAIVILVIAIII |
| Ga0209336_100581941 | 3300025137 | Marine | WIIRRTIIMNLKEHIPHFVAEHKKAIAVAVVILIIAIII |
| Ga0209336_100591831 | 3300025137 | Marine | KKIRRIIIMKIQEHVTHFVKEHKKAIAIAVVILIIAIII |
| Ga0209336_101785203 | 3300025137 | Marine | RRKEMNLKDHIPHFVEEHKKAIAVVVVILIIAIIL |
| Ga0209634_10626881 | 3300025138 | Marine | TWWIIRRTIIMKLKEHIPHFVKEHKKAIGIIIIIFIIAIII |
| Ga0209634_11370252 | 3300025138 | Marine | IIRRTIIMKIQEHIPHFVKEHKKAVAIAVVILIIAIII |
| Ga0209634_11381213 | 3300025138 | Marine | SRILRGIIIMKIQEHIPHFVKEHKKAIAVAVVILVIAIIL |
| Ga0209634_11483073 | 3300025138 | Marine | YWCIDRWWSRILRGIIIMKIQEHIPHFVKEHKKAIAVAVVILVIAIIL |
| Ga0209337_11062972 | 3300025168 | Marine | ISRSILMNLKEHIPHFVAEHKKAIAVAVVILIIAIII |
| Ga0209716_11713932 | 3300025626 | Pelagic Marine | WIIRRTIIMKLKEHIPHFVKEHKKAIAVAVVILIIAIII |
| Ga0209833_11704291 | 3300025641 | Pelagic Marine | DGCSSRWIRWIIRRTIIMKLKEHIPHFVKEHKKAIAVAVVILIIAIII |
| Ga0208767_11429591 | 3300025769 | Aqueous | TWWIIRRTIIMKIKEHIPHFVKEHKKALAIAVVILIIAIII |
| Ga0209603_10615001 | 3300025849 | Pelagic Marine | IRRTIIMKIKEHIPHFVKEHKKAIAIAVVILIIAIII |
| Ga0209603_10992583 | 3300025849 | Pelagic Marine | GWIIRRTIIMKLKEHIPHFVKEHKKAIAVAVVILIIAIII |
| Ga0208645_11526072 | 3300025853 | Aqueous | IIRRTIIMKIQEHIPHFVKEHKKAIAIAVVILIIAIII |
| Ga0208277_10661641 | 3300026292 | Marine | WFRIIRRIIIMKLKEHIPHFVAEHKKAIAIAVVILIVAIII |
| Ga0208277_10676881 | 3300026292 | Marine | WFRIIRRIIIMKLKEHIPHFVAEHKKAIAIAVVVLIVAIII |
| Ga0209709_102058812 | 3300027779 | Marine | NRWTWWIIRRTIIMKIQEHIPHFVKEHKKAVAIAVVILIIAIII |
| Ga0307489_111154863 | 3300031569 | Sackhole Brine | IKKIRRIIIMKIQEHVTHFVKEHKKAIAIAVVILIIAIII |
| Ga0307986_100962701 | 3300031659 | Marine | TWWIIRRTIIMNLKEHIPHFVEEHKKAIAIAVVILIIAIII |
| Ga0315315_113551641 | 3300032073 | Seawater | RRIIIMNLKQHLPHFVAEHKKAIAVAVVILIIAIII |
| Ga0315321_106726891 | 3300032088 | Seawater | RNIKMKLKEHIPHIIAEHKKAIAVAVVILIVAIII |
| Ga0314858_031000_1079_1225 | 3300033742 | Sea-Ice Brine | MRGKRRWTWWIIRRTIIMKIQEHIPHFVKEHKKAIAIAVVILIIAIII |
| Ga0348335_029720_3_116 | 3300034374 | Aqueous | AWRTIIKKLKEHIPHFVKEHKKAIAVAVVILITAIIL |
| ⦗Top⦘ |