


| Basic Information | |
|---|---|
| Family ID | F048891 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 147 |
| Average Sequence Length | 45 residues |
| Representative Sequence | ARDHSHVVVELDLGLRRKTVFTLRHGETVPDSVVKHALLGSKQR |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 147 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.65 % |
| % of genes near scaffold ends (potentially truncated) | 76.87 % |
| % of genes from short scaffolds (< 2000 bps) | 68.71 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (78.912 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (34.014 % of family members) |
| Environment Ontology (ENVO) | Unclassified (54.422 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.544 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 31.94% Coil/Unstructured: 68.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 147 Family Scaffolds |
|---|---|---|
| PF16655 | PhoD_N | 5.44 |
| PF01713 | Smr | 3.40 |
| PF02518 | HATPase_c | 3.40 |
| PF00326 | Peptidase_S9 | 3.40 |
| PF13531 | SBP_bac_11 | 2.72 |
| PF09365 | DUF2461 | 2.04 |
| PF00753 | Lactamase_B | 2.04 |
| PF13442 | Cytochrome_CBB3 | 2.04 |
| PF12695 | Abhydrolase_5 | 1.36 |
| PF07681 | DoxX | 1.36 |
| PF02441 | Flavoprotein | 1.36 |
| PF01402 | RHH_1 | 1.36 |
| PF04986 | Y2_Tnp | 1.36 |
| PF00990 | GGDEF | 1.36 |
| PF01370 | Epimerase | 1.36 |
| PF04734 | Ceramidase_alk | 1.36 |
| PF15902 | Sortilin-Vps10 | 1.36 |
| PF03401 | TctC | 0.68 |
| PF00196 | GerE | 0.68 |
| PF06224 | HTH_42 | 0.68 |
| PF09694 | Gcw_chp | 0.68 |
| PF13432 | TPR_16 | 0.68 |
| PF00034 | Cytochrom_C | 0.68 |
| PF09423 | PhoD | 0.68 |
| PF01546 | Peptidase_M20 | 0.68 |
| PF13226 | DUF4034 | 0.68 |
| PF13545 | HTH_Crp_2 | 0.68 |
| PF04480 | DUF559 | 0.68 |
| PF14559 | TPR_19 | 0.68 |
| PF06537 | DHOR | 0.68 |
| PF01075 | Glyco_transf_9 | 0.68 |
| PF13229 | Beta_helix | 0.68 |
| PF07687 | M20_dimer | 0.68 |
| PF07676 | PD40 | 0.68 |
| PF01799 | Fer2_2 | 0.68 |
| PF00082 | Peptidase_S8 | 0.68 |
| PF13964 | Kelch_6 | 0.68 |
| PF07769 | PsiF_repeat | 0.68 |
| PF02012 | BNR | 0.68 |
| PF12697 | Abhydrolase_6 | 0.68 |
| PF01070 | FMN_dh | 0.68 |
| PF03699 | UPF0182 | 0.68 |
| PF07963 | N_methyl | 0.68 |
| PF12867 | DinB_2 | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 147 Family Scaffolds |
|---|---|---|---|
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 1.36 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 1.36 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.68 |
| COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.68 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.68 |
| COG1615 | Uncharacterized membrane protein, UPF0182 family | Function unknown [S] | 0.68 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.68 |
| COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 0.68 |
| COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.91 % |
| Unclassified | root | N/A | 21.09 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002557|JGI25381J37097_1073649 | Not Available | 556 | Open in IMG/M |
| 3300002558|JGI25385J37094_10008727 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3601 | Open in IMG/M |
| 3300002558|JGI25385J37094_10053160 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
| 3300002560|JGI25383J37093_10014406 | All Organisms → cellular organisms → Bacteria | 2619 | Open in IMG/M |
| 3300002561|JGI25384J37096_10103941 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 983 | Open in IMG/M |
| 3300002908|JGI25382J43887_10236307 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300002909|JGI25388J43891_1025415 | Not Available | 1002 | Open in IMG/M |
| 3300002912|JGI25386J43895_10030207 | All Organisms → cellular organisms → Bacteria | 1596 | Open in IMG/M |
| 3300004631|Ga0058899_11443567 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300005172|Ga0066683_10360746 | Not Available | 901 | Open in IMG/M |
| 3300005178|Ga0066688_10049684 | All Organisms → cellular organisms → Bacteria | 2419 | Open in IMG/M |
| 3300005180|Ga0066685_10991985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 555 | Open in IMG/M |
| 3300005450|Ga0066682_10405544 | Not Available | 873 | Open in IMG/M |
| 3300005556|Ga0066707_10765389 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300005556|Ga0066707_10881178 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300005557|Ga0066704_10332151 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1022 | Open in IMG/M |
| 3300005569|Ga0066705_10343659 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 942 | Open in IMG/M |
| 3300005586|Ga0066691_10320257 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 916 | Open in IMG/M |
| 3300005586|Ga0066691_10348758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 876 | Open in IMG/M |
| 3300005586|Ga0066691_10403577 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300005586|Ga0066691_10416724 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300006031|Ga0066651_10070057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1695 | Open in IMG/M |
| 3300006046|Ga0066652_100901628 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300006791|Ga0066653_10639500 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300006794|Ga0066658_10037181 | All Organisms → cellular organisms → Bacteria | 2019 | Open in IMG/M |
| 3300006794|Ga0066658_10476683 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 679 | Open in IMG/M |
| 3300006796|Ga0066665_10040290 | All Organisms → cellular organisms → Bacteria | 3147 | Open in IMG/M |
| 3300006796|Ga0066665_10162846 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1702 | Open in IMG/M |
| 3300006796|Ga0066665_10241777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1424 | Open in IMG/M |
| 3300006796|Ga0066665_10419486 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
| 3300006796|Ga0066665_10822101 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300006796|Ga0066665_11559067 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 518 | Open in IMG/M |
| 3300006797|Ga0066659_10447753 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300006804|Ga0079221_10519231 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300006804|Ga0079221_10804175 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 674 | Open in IMG/M |
| 3300006852|Ga0075433_10086135 | All Organisms → cellular organisms → Bacteria | 2774 | Open in IMG/M |
| 3300006954|Ga0079219_10132555 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
| 3300007255|Ga0099791_10438911 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 631 | Open in IMG/M |
| 3300007258|Ga0099793_10185349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 995 | Open in IMG/M |
| 3300007258|Ga0099793_10542890 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 580 | Open in IMG/M |
| 3300009012|Ga0066710_100428871 | All Organisms → cellular organisms → Bacteria | 1978 | Open in IMG/M |
| 3300009012|Ga0066710_100557135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Arenimonas → Arenimonas oryziterrae → Arenimonas oryziterrae DSM 21050 = YC6267 | 1735 | Open in IMG/M |
| 3300009012|Ga0066710_101860521 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 904 | Open in IMG/M |
| 3300009012|Ga0066710_103073455 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300009012|Ga0066710_103874745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300009038|Ga0099829_11029146 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300009089|Ga0099828_10939519 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 772 | Open in IMG/M |
| 3300009090|Ga0099827_10936418 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 751 | Open in IMG/M |
| 3300009137|Ga0066709_102370515 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 723 | Open in IMG/M |
| 3300009137|Ga0066709_104051934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 533 | Open in IMG/M |
| 3300009813|Ga0105057_1050392 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300010320|Ga0134109_10224259 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300010323|Ga0134086_10258976 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 664 | Open in IMG/M |
| 3300010337|Ga0134062_10003551 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5486 | Open in IMG/M |
| 3300010397|Ga0134124_11607065 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 680 | Open in IMG/M |
| 3300010401|Ga0134121_12189374 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300011270|Ga0137391_10474393 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300012198|Ga0137364_10023700 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3820 | Open in IMG/M |
| 3300012198|Ga0137364_11474808 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 501 | Open in IMG/M |
| 3300012203|Ga0137399_10242993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Arenimonas → Arenimonas oryziterrae → Arenimonas oryziterrae DSM 21050 = YC6267 | 1474 | Open in IMG/M |
| 3300012206|Ga0137380_10015335 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6995 | Open in IMG/M |
| 3300012349|Ga0137387_11154364 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 549 | Open in IMG/M |
| 3300012351|Ga0137386_10297535 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300012351|Ga0137386_10400950 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300012359|Ga0137385_10184215 | All Organisms → cellular organisms → Bacteria | 1828 | Open in IMG/M |
| 3300012360|Ga0137375_11472541 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 502 | Open in IMG/M |
| 3300012361|Ga0137360_11613276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300012362|Ga0137361_11890341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300012401|Ga0134055_1087261 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 527 | Open in IMG/M |
| 3300012683|Ga0137398_11035015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium | 568 | Open in IMG/M |
| 3300012685|Ga0137397_10708058 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300012685|Ga0137397_11196447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 548 | Open in IMG/M |
| 3300012918|Ga0137396_10996954 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300012922|Ga0137394_10127755 | All Organisms → cellular organisms → Bacteria | 2155 | Open in IMG/M |
| 3300012922|Ga0137394_10489389 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1045 | Open in IMG/M |
| 3300012922|Ga0137394_11428209 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300012925|Ga0137419_10876696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 738 | Open in IMG/M |
| 3300012925|Ga0137419_10979071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 700 | Open in IMG/M |
| 3300012930|Ga0137407_10673977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. | 973 | Open in IMG/M |
| 3300012944|Ga0137410_11170323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 661 | Open in IMG/M |
| 3300012972|Ga0134077_10068425 | Not Available | 1336 | Open in IMG/M |
| 3300012972|Ga0134077_10329938 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 646 | Open in IMG/M |
| 3300014154|Ga0134075_10225322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 808 | Open in IMG/M |
| 3300014154|Ga0134075_10301468 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 698 | Open in IMG/M |
| 3300014166|Ga0134079_10155520 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 926 | Open in IMG/M |
| 3300014166|Ga0134079_10264095 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300015054|Ga0137420_1085940 | All Organisms → cellular organisms → Bacteria | 3809 | Open in IMG/M |
| 3300015054|Ga0137420_1379522 | All Organisms → cellular organisms → Bacteria | 3068 | Open in IMG/M |
| 3300015054|Ga0137420_1449192 | All Organisms → cellular organisms → Bacteria | 4311 | Open in IMG/M |
| 3300015245|Ga0137409_11041174 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300015264|Ga0137403_10011123 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9937 | Open in IMG/M |
| 3300015264|Ga0137403_10084369 | All Organisms → cellular organisms → Bacteria | 3206 | Open in IMG/M |
| 3300015264|Ga0137403_10143326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2360 | Open in IMG/M |
| 3300015358|Ga0134089_10305161 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300015358|Ga0134089_10475743 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300018071|Ga0184618_10147157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 960 | Open in IMG/M |
| 3300018482|Ga0066669_10114457 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1906 | Open in IMG/M |
| 3300021080|Ga0210382_10259542 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 761 | Open in IMG/M |
| 3300021088|Ga0210404_10176243 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300024317|Ga0247660_1056159 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300026277|Ga0209350_1113790 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 622 | Open in IMG/M |
| 3300026313|Ga0209761_1190806 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 915 | Open in IMG/M |
| 3300026323|Ga0209472_1285480 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 527 | Open in IMG/M |
| 3300026329|Ga0209375_1037951 | All Organisms → cellular organisms → Bacteria | 2525 | Open in IMG/M |
| 3300026329|Ga0209375_1265255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 568 | Open in IMG/M |
| 3300026343|Ga0209159_1166022 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300026528|Ga0209378_1018982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 3877 | Open in IMG/M |
| 3300026530|Ga0209807_1072672 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1538 | Open in IMG/M |
| 3300026532|Ga0209160_1141029 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1133 | Open in IMG/M |
| 3300026537|Ga0209157_1018971 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 4296 | Open in IMG/M |
| 3300026538|Ga0209056_10096762 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2424 | Open in IMG/M |
| 3300026538|Ga0209056_10563204 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300026548|Ga0209161_10208024 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300026557|Ga0179587_10701395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 667 | Open in IMG/M |
| 3300027655|Ga0209388_1106715 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 802 | Open in IMG/M |
| 3300027671|Ga0209588_1109195 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300027875|Ga0209283_10362075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 950 | Open in IMG/M |
| 3300027882|Ga0209590_11061645 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300031820|Ga0307473_10191752 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1205 | Open in IMG/M |
| 3300031962|Ga0307479_12141827 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300032180|Ga0307471_104181310 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 510 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 34.01% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 29.25% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 14.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 10.20% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.04% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.04% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.36% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.36% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.36% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.68% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.68% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009813 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012401 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300024317 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK01 | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25381J37097_10736492 | 3300002557 | Grasslands Soil | ARDHSHVVVELDLGLGRKTVFTLRHGQTVPDSVVKRTLLGSKQR* |
| JGI25385J37094_100087276 | 3300002558 | Grasslands Soil | SHLVVEVDLGLRRKAVFTVRHGDTVPDSVVKHSLLGSKRRK* |
| JGI25385J37094_100531601 | 3300002558 | Grasslands Soil | LVVELDLGLRRKAVFTMRHGDSEPDSIVKHSLLGSKRGK* |
| JGI25383J37093_100144063 | 3300002560 | Grasslands Soil | SHLVVELDLGLRRKAVFTMRHGDSEPDSIVKHSLLGSKRGK* |
| JGI25384J37096_101039412 | 3300002561 | Grasslands Soil | HSHVVVELDLGLRRKTVFTLRHGETVPDSVVKHALLGSKQR* |
| JGI25382J43887_102363071 | 3300002908 | Grasslands Soil | HLVVEVDLGLKRKAVFTLRHGTTAAESVVRHSLLGSKRRQ* |
| JGI25388J43891_10254151 | 3300002909 | Grasslands Soil | RPWRMARDHSHVVVELDLGLGRKTVFTLRHGQTVPDSVVKRTLLGSKQR* |
| JGI25386J43895_100302072 | 3300002912 | Grasslands Soil | SHLVVELDLGLRRKAVFTMRHGDSEPDSIVKHSLLGSKRRK* |
| Ga0058899_114435671 | 3300004631 | Forest Soil | VVEMGLGLTRKVVFTVRHGESVPDTTVKRSLLGPERRNPTRHSR* |
| Ga0066683_103607462 | 3300005172 | Soil | HSHVVVELDLGLRRKTVFTLRHGETVPDSVVKHTLLGSKRR* |
| Ga0066683_104638771 | 3300005172 | Soil | PKASRAWRMARDRSHLVVEVDLGLKRKAVFTLRHGTTAPESVVKHSLLGSKRRT* |
| Ga0066688_100496843 | 3300005178 | Soil | MARDHSHVVVELDLGLRRKTVFTLRHGETVPDSVVKHALLGSKQRQ* |
| Ga0066685_109919852 | 3300005180 | Soil | MARDHSHVVVELDLGLRRKTVFTLRHGETVPDSVVKHALLGSKQR* |
| Ga0066682_103988431 | 3300005450 | Soil | SRAWRMARDRRHIVVEIDLGLSRKAVFTLRPGTTAPEGVVQHSLLGSKRRQ* |
| Ga0066682_104055441 | 3300005450 | Soil | ARDRSHLVVELDLGLTRKTVFTVRHGDTVPDSVLKHSLLGSKRRK* |
| Ga0066695_106054781 | 3300005553 | Soil | GGPKSSRAWRMARDRSHLVVEVDLGLRRKAVFTVRHGDTVPDSVVKHSLLGSKRRK* |
| Ga0066707_107653892 | 3300005556 | Soil | AWRMARDRSHLVVEVDLGLRRKAVFTVRHGDTVPDSVVKHSLLGSKRRK* |
| Ga0066707_108811783 | 3300005556 | Soil | VEVDLGLKRKAVFTLRHGTTAPESVVKHSLLGSKRRT* |
| Ga0066704_103321512 | 3300005557 | Soil | RDHSHVVVELDLGLRGKTVFTLRHGETVPDSVVKHALLGSKQR* |
| Ga0066705_103436592 | 3300005569 | Soil | RIARDRSHFVVELDLGLTRKTVFTLRHGDTVPDRIVRHSVLGSKRRR* |
| Ga0066694_103341082 | 3300005574 | Soil | PKSSRPWRMARDHSHVVVELDLGLGRKTVFTLRHGQTVPDSVVKHTLLGSKQR* |
| Ga0066694_104367442 | 3300005574 | Soil | KASRAWRMARDRSHLVVEVDLGLKRKAVFTLRHGTTAPESVVRHSLLGSKRRK* |
| Ga0066691_103202571 | 3300005586 | Soil | ARDHSHVVVELDLGLRGKTVFTLRHGETVPDSVVKHALLGSKQR* |
| Ga0066691_103487582 | 3300005586 | Soil | PWRMARDHSHVVVELDLELRGKTVFTLRHGETVPDSVVKHALLGSKQR* |
| Ga0066691_104035772 | 3300005586 | Soil | SHVVVELDLELRGKTVFTLRHGETVPDSVVKHALPGSEQR* |
| Ga0066691_104167241 | 3300005586 | Soil | PWRMARDHSHVVVELDLGLRGKTVFTLRHGETVPDSVVKHTLPGSEQR* |
| Ga0066651_100700573 | 3300006031 | Soil | HSHVVVELDLGLRRKTVFTLRHGETVPDSVVKHTLLGSKQR* |
| Ga0066656_101765342 | 3300006034 | Soil | ASRAWRMARDRSHLVVEVDLGLKRKAVFTLRPGTTAPESVVRHSLLGSKRRQ* |
| Ga0066652_1009016283 | 3300006046 | Soil | AWRIARDKSHLVVELDLGFRRKAVFTVRHGDQVPDSVVRHSLLGSKRRK* |
| Ga0066653_106395001 | 3300006791 | Soil | KSHLVVELDLGFRRKAVFTVRHGDQVPDSVVRHSLLGSKRRK* |
| Ga0066658_100371811 | 3300006794 | Soil | HSHVVVELDLGLRRKTVFTLRHGETVPDSVVKHALLGSKQRQ* |
| Ga0066658_104766832 | 3300006794 | Soil | WRMARDHSHVVVELDLGLKTVFTLRHGETVPDSVVKHALPGSKQR* |
| Ga0066665_100402906 | 3300006796 | Soil | ARDRSHLVVEVDLGLRRKAVFTVRHGETVPDSVVKHSLLGSKRRK* |
| Ga0066665_101628461 | 3300006796 | Soil | RAWRIARDRSHFVVELDLGLTRKTVFTLRHGDTVPDRIVRHSVLGSKRRR* |
| Ga0066665_102417772 | 3300006796 | Soil | ARDHSHVVVELDLGLRRKTVFTLRHGETVPDSVVKHTLLGSEQR* |
| Ga0066665_104194861 | 3300006796 | Soil | LVVEVDLGLKRKAVFTLRHGTTAPESVVKHSLLGSKRRT* |
| Ga0066665_108221012 | 3300006796 | Soil | RSHIVVEIDLGFSRRAVFTLRPGTTAPESVVKHSLLGSKRRQ* |
| Ga0066665_115590671 | 3300006796 | Soil | MARDHSHVVVELDLGLRGKTVFTLRHGETVPDSVVKHTLLGSEQRQ* |
| Ga0066659_102840222 | 3300006797 | Soil | SRAWRMARDRSHLVVELDLGLTRKTVFTVRHGDTVPDSVLKHSLLGSKRRK* |
| Ga0066659_104477531 | 3300006797 | Soil | SHVVVELDLGLSRKTVFTLRHGETVPFSVVKHTLLGSKQRQ* |
| Ga0079221_105192311 | 3300006804 | Agricultural Soil | SHSIVELDLGLSRKTVVVLRHAGGDLVAESVVRHSLLGSKRRS* |
| Ga0079221_108041752 | 3300006804 | Agricultural Soil | VEVDLGFRRKAVVTMRPGGDAPESVVKHSLLGSKRRK* |
| Ga0075433_100861355 | 3300006852 | Populus Rhizosphere | ARDKSHLVVELDLGFRRKAVFTVRHGDTVPDSVVRHSLLGSKRRQ* |
| Ga0079219_101325553 | 3300006954 | Agricultural Soil | RIARDHSHSVVELDLGLSRKTVVVLRHEDLVAEGVVRHSLLGSKRRS* |
| Ga0099791_104389111 | 3300007255 | Vadose Zone Soil | SHLVVELDLGLRRKAVFTLRHGESVPDSVVRHSLLGSKQRK* |
| Ga0099793_101853491 | 3300007258 | Vadose Zone Soil | RDHSHVVVELDLELKGKTVFTLRHGETVPDSVVKHALLGSKQR* |
| Ga0099793_104059182 | 3300007258 | Vadose Zone Soil | VPKASRAWRMARDRSHLVVELDLGLRRKAVFTLRHGDSAPDSVVNHSLLGSKRRK* |
| Ga0099793_105428901 | 3300007258 | Vadose Zone Soil | SHLVVELDLGLRRKAVFTLRHGDSVPDSVVKHSLLGSKRRR* |
| Ga0066710_1004288712 | 3300009012 | Grasslands Soil | AWRVARDRSHLVVELDLGLRRKAVFTMRHGDSEPDSIVKHSLLGSKRGK |
| Ga0066710_1005255871 | 3300009012 | Grasslands Soil | RAWRLARDRSHLVVELDLGLTRKAVFTLRHGDSAPDGVVKHSLLGSKRRK |
| Ga0066710_1005571351 | 3300009012 | Grasslands Soil | ARDHSHVVVELDLELRGKTVFTLRHGETVPDSVVKHALPGSEQR |
| Ga0066710_1017971881 | 3300009012 | Grasslands Soil | GPKASRAWRMARDRSHLVVEVDLGLRRKAVFTMRHGDTVPDSVVKHSLLGSKRRK |
| Ga0066710_1018605213 | 3300009012 | Grasslands Soil | VVEVDLGLRRKTVFTLRHGEHVPDSVVKHSLLGSKRRR |
| Ga0066710_1030734552 | 3300009012 | Grasslands Soil | ARDHSHVVVELDLGLRGKTVFTLRHGETVPDSVVKHALLGSEQRQ |
| Ga0066710_1038747452 | 3300009012 | Grasslands Soil | RMARDHSHVVVELDLGLRRKTVFTLRHGETVPDSVVKHTLLGSKQR |
| Ga0099829_110291461 | 3300009038 | Vadose Zone Soil | MARDRSHLVVELDLGLTRKTVFTLRHGDSAPDSVVRHSLLGSKRRK* |
| Ga0099830_105042543 | 3300009088 | Vadose Zone Soil | GGAPRASRAWRIARDKSHLVVELDLGFRRKAVFTLRHGDKVPDSVVRHSLLGSKRRK* |
| Ga0099828_109395192 | 3300009089 | Vadose Zone Soil | MARDRSHLVVEIDLGLRRKAVFTVRHGDTVPDSVVKHSLLGSKRRK* |
| Ga0099828_109674591 | 3300009089 | Vadose Zone Soil | KSSRAWRMARDRSHLVVELDLGLTRKTVFTLRHGDSAPDSVVRHSLLGSKRRK* |
| Ga0099827_105496522 | 3300009090 | Vadose Zone Soil | SWRMARDQTHLIVELDLGLTRKTVFAVRHGDTVPDSIVRHSLLGSKRRQ* |
| Ga0099827_109364181 | 3300009090 | Vadose Zone Soil | SSGPWRMARDHSHVVVELDLGLRRKTVFTLRHGKTVPDSVVKHTQR* |
| Ga0066709_1000670926 | 3300009137 | Grasslands Soil | RAWRMARDRSHLVVEVDLGLKRKAVFTLRHGTTAPESVVKHSLLGSKRRT* |
| Ga0066709_1004066311 | 3300009137 | Grasslands Soil | APRASRAWRIARDKSHLVVELDLGFRRKAVFTVRHGDQVPDSVVRHSLLGSKRRK* |
| Ga0066709_1023705152 | 3300009137 | Grasslands Soil | VELDLGWKQKAVFTVRHGENVPDTVVNHSLLGSKRRK* |
| Ga0066709_1040519342 | 3300009137 | Grasslands Soil | ARDHSHVVVELDLGLRRKTVFTLRHGETVPDSVVKHALLGSKQR* |
| Ga0099792_101027254 | 3300009143 | Vadose Zone Soil | ARAPKVSRAWRIARDKSHLVVELDLGFRRKAVFTLRHGDKVPDSVVRHSLLGSKRRK* |
| Ga0105057_10503923 | 3300009813 | Groundwater Sand | VVELDLGLRRKAVFTVRHGDSVPDSVVKHSLLGSKRRR* |
| Ga0134109_102242591 | 3300010320 | Grasslands Soil | LVVELDLGFRRKAVFTVRHGDQVPDSVVRHSLLGSKRRK* |
| Ga0134086_102589761 | 3300010323 | Grasslands Soil | SHVVVELDLGLRRKTVFTLRHGETVPDSVVKHALLGSEQRQ* |
| Ga0134062_100035517 | 3300010337 | Grasslands Soil | DHSHVVVELDLGLRRKTVFTLRHGETVPDSVVKHALLGSKQRR* |
| Ga0134124_116070651 | 3300010397 | Terrestrial Soil | SRAWRMARDRSHLVVELDLGLRRKAVFTLRHGASVPYSVVRHSLLGSKQRK* |
| Ga0134121_121893742 | 3300010401 | Terrestrial Soil | VELDLGLSRKTVVALRHGDLVAESVVRHSLLGSKRRS* |
| Ga0137391_104743932 | 3300011270 | Vadose Zone Soil | VELDLGLRRKAVFTLRHGDSVPDSVVKHSLLGSKRRR* |
| Ga0137389_103128381 | 3300012096 | Vadose Zone Soil | RAWRVARDRSHLVVELDLGLRRKAVFTLRHGDSVPDSVVNHSLLGSRRRK* |
| Ga0137364_100237005 | 3300012198 | Vadose Zone Soil | VELDLGFRRKAVFTVRHGDQVPDSVVRHSLLGSKRRK* |
| Ga0137364_100497454 | 3300012198 | Vadose Zone Soil | PKSSRLWRMARDHSHVVVELDLGLRRKTVFTLRHGQTVPDSFVKHTLLGSKQR* |
| Ga0137364_114748081 | 3300012198 | Vadose Zone Soil | HYVVELDLGLTRKTVFTLRHGDTVPDRIVRHSVLGSKRRR* |
| Ga0137399_102429931 | 3300012203 | Vadose Zone Soil | RDHSHVVVELDLELRGKTVFTLRHGETVPDSVVKHALPGSEQR* |
| Ga0137380_100153351 | 3300012206 | Vadose Zone Soil | DHSHVVVELDLGLRRKTVFTLRHGETVPDSVVKHTLLGSKQR* |
| Ga0137387_111543641 | 3300012349 | Vadose Zone Soil | ELDLGFRRKAVFTVRHGDQVPDSVVRHSLLGSKRRK* |
| Ga0137386_102975353 | 3300012351 | Vadose Zone Soil | WRIARDHTHFVVEVDLGLTRKMVVTLRHGGTAPERVMRHSLLGSKPRKVR* |
| Ga0137386_104009501 | 3300012351 | Vadose Zone Soil | HVVVELDLGLRRKTVFTLRHGETVPDSVVKHTLLGSKQR* |
| Ga0137371_105216683 | 3300012356 | Vadose Zone Soil | GAPRASRAWRIARDKSHLVVELDLGFRRKAVFTVRHGDQVPDSVVRHSLLGSKRRK* |
| Ga0137385_101842151 | 3300012359 | Vadose Zone Soil | LDLGLSRKTVVAVRHEGLVPESVVNHSLLGSKRRG* |
| Ga0137375_114725412 | 3300012360 | Vadose Zone Soil | LDLGLRRKAVFTVRHGDTVPDSVVKHSLLGSKRRK* |
| Ga0137360_116132762 | 3300012361 | Vadose Zone Soil | SSSPWRMARDHSHVVVEIDLGLRRKTVFTLRHGKTVPDSVVKHTLPGSEQR* |
| Ga0137361_118903412 | 3300012362 | Vadose Zone Soil | VVVELDLALRGKTVFTLRHGETVPDSVVKHTLPGSEQR* |
| Ga0134055_10872612 | 3300012401 | Grasslands Soil | VVEVDLGLTRKTVFTLRHGDTVPDRIVKHSVLGSKRRR* |
| Ga0137398_110350152 | 3300012683 | Vadose Zone Soil | MARDHSHVVVELDLGLRRKTVFTLRHGKTVPDSVVKHTLLGSKQR* |
| Ga0137397_107080583 | 3300012685 | Vadose Zone Soil | VVEVDLGLTRKTVFTLRHGDTVPDRIVRHSVLGS* |
| Ga0137397_111964471 | 3300012685 | Vadose Zone Soil | SHVVVELDLGLRRKTVFTLRHGETVPDSVVRHTLMGSKQR* |
| Ga0137396_109969541 | 3300012918 | Vadose Zone Soil | PKSSRPWRMARDHSHMVVELDLGLKTVFTLRHGETVPDSVVKHALPGSKQR* |
| Ga0137394_101277551 | 3300012922 | Vadose Zone Soil | PWRMARDHSHVVVELDLELRGKTVFTLRHGETVPDSVVKHALPGSEQR* |
| Ga0137394_104893891 | 3300012922 | Vadose Zone Soil | PWRMARDHSHVVVELDLELRGKTVFTLRHGETVPDSVVKHASAS* |
| Ga0137394_114282091 | 3300012922 | Vadose Zone Soil | TFRAWRIARDHTHYVVEVDLGLTRKTVFTLRHGDTVPDRIVRHSVLGSKQRR* |
| Ga0137419_108766961 | 3300012925 | Vadose Zone Soil | KSSGPWRMARDHSHVVVELDLELRGKTVFTLRHGETVPDSVVKHTLPGSEHR* |
| Ga0137419_109790712 | 3300012925 | Vadose Zone Soil | RIARDHTHYVVEVDLGLTRKTVFTLRHGDTVPDRIVRHSVLGSKQRR* |
| Ga0137419_118720712 | 3300012925 | Vadose Zone Soil | VPKASRAWRMARDRSHLVVELDLGLRRKAVFTLRHGDSVPDSVVNHSLLGSKRRK* |
| Ga0137407_106739773 | 3300012930 | Vadose Zone Soil | HVVVELDRGLRRKTVFTLRHGETVPDSVVKHTLLGSKQR* |
| Ga0137410_111703231 | 3300012944 | Vadose Zone Soil | RDHSHVVVELDLGLRRKTVFTLRHGETVPDSVVRHTLLGSKQRQ* |
| Ga0134077_100684252 | 3300012972 | Grasslands Soil | ARDRSHLVVELDLGLTRKAVFTLRHGESAPDSVVKHSLLGSKRRK* |
| Ga0134077_103299382 | 3300012972 | Grasslands Soil | HVVVELDLGLRRKTVFTLRHGETVPDSVVKHALLGSKQR* |
| Ga0134087_101830882 | 3300012977 | Grasslands Soil | WRMARDRSHLVVEVDLGLKRKAVFTLRPVTTAPESVVRHSLLGSKRRQ* |
| Ga0134075_102253222 | 3300014154 | Grasslands Soil | VELDLGLRRETVFTLRHGETVPDSVVKHTLLGSKQR* |
| Ga0134075_103014682 | 3300014154 | Grasslands Soil | MARDRSHLVVELDLGLTRKAVFTLRHGESAPDSVVKHSLLGSKRRK* |
| Ga0134079_101555202 | 3300014166 | Grasslands Soil | DLGFRRKAVFTLRHGETVPDGVVKHSLLGSKRRK* |
| Ga0134079_102640953 | 3300014166 | Grasslands Soil | RIARDHTHFVAEVDLGMTRKVVFTLRHGETAPERVTRHSLLGTKPKVR* |
| Ga0137420_10859401 | 3300015054 | Vadose Zone Soil | LVVELDLGVVELDLGLRRKAVFTLRHGESVPDSVVNHSLLGSKRQK* |
| Ga0137420_13795224 | 3300015054 | Vadose Zone Soil | MARDHSHVVVELDLELRGKTVFTLRHGETVPDSVVKHASAS* |
| Ga0137420_14491923 | 3300015054 | Vadose Zone Soil | MARDRSHLVVELDLGLRRKAVFTLRHGDSVPDSVVNHSLLGSKRRK* |
| Ga0137409_110411741 | 3300015245 | Vadose Zone Soil | VEVDLGLTRKTVFTLRHGETAPERVMRHSLLGSKPKVR* |
| Ga0137403_100111231 | 3300015264 | Vadose Zone Soil | RDHSHVVVELDLGLRRKTVFTLRHGKTVPDSVVKHGLLGSKQR* |
| Ga0137403_100843695 | 3300015264 | Vadose Zone Soil | RDHSHVVVELDLGLRRKTVFTLRHGETVPDGVLKHTLLGSKQRK* |
| Ga0137403_101433263 | 3300015264 | Vadose Zone Soil | VVVELDLGLRRKTVFTLRHGETVPDSVVKHTLLGSKQR* |
| Ga0134089_103051612 | 3300015358 | Grasslands Soil | RLARDRSHLVVELDLGLTRKAVFTLRHGDSAPDSVVKHSLLGSKRRK* |
| Ga0134089_104757431 | 3300015358 | Grasslands Soil | DRSHVVVEVDLGLKRKAVFTLRHGTTAPESVVRHSLLGSKRRK* |
| Ga0134085_101560281 | 3300015359 | Grasslands Soil | PKSSRAWRMARDRTHLVVELDLGSNGRTVFTLRPGETVPESVVTHSPQSKRRS* |
| Ga0134083_102624322 | 3300017659 | Grasslands Soil | APKSSRAWRVARDRSHLVVELDLGLRRKTVFTMRHGDSEPDSIVKHSLLGSKRGK |
| Ga0184618_101471573 | 3300018071 | Groundwater Sediment | DHSHVVVELDLGLRRKTVFTLRHGETVPDSVVKHTLLGSKQR |
| Ga0066669_101144574 | 3300018482 | Grasslands Soil | TWRMARDRSHLVVEVDLGLRRKAVFTVRHGDTVPDSVVNHSLLGSKRRK |
| Ga0184643_11238863 | 3300019255 | Groundwater Sediment | ESKASRTWRMARDRSHLVVELDLGLTRKTVFTLRHGDTVPDSIVKHSVLGSKRRQ |
| Ga0210382_102595421 | 3300021080 | Groundwater Sediment | VVVELDLGLTRKTVFTLRHGDTVPDRIVRHSVLGSKSSPR |
| Ga0210404_101762433 | 3300021088 | Soil | SRAWRMARDRSHLVVELDLGLRRKAVFTVRHGNNVPDSVVRHSLLGSKRRK |
| Ga0247660_10561591 | 3300024317 | Soil | SHSVVELDLGLSRKTVVVLRHEDLVAESVLRHSLLGSKRRS |
| Ga0209350_11137902 | 3300026277 | Grasslands Soil | EVDLGLRRKAVFTLRHGETVPDGVVKHSLLGSKRRK |
| Ga0209761_11908061 | 3300026313 | Grasslands Soil | VVELDLGLRRKTVFTLRHGQTVPDSVVKHALLGSKQR |
| Ga0209472_12854801 | 3300026323 | Soil | RSHLVVEVDLGLRRKAVFTLRHGETVPDGVVKHSLLGSKRRK |
| Ga0209375_10379511 | 3300026329 | Soil | HSHVVVELDLGLRRKTVFTLRHGETVPDSVVKHALLGSKQRR |
| Ga0209375_12652552 | 3300026329 | Soil | MARDHSHVVVELDLELRGKTVFTLRHGETVPDSVVKHALPGSEQR |
| Ga0209377_10027791 | 3300026334 | Soil | GRAPKSSRAWRVARDRSHLVVELDLGLRRKAVFTMRHGDSEPDSIVKHSLLGSKQRK |
| Ga0209159_11660222 | 3300026343 | Soil | RPWRMARDHSHVVVELDLELRGKTVFTLRHGETVPDSVVKHALPGSEQR |
| Ga0209378_10189826 | 3300026528 | Soil | ELDLGLRGKTVFTLRHGETVPDSVVKHALLGSKQR |
| Ga0209807_10726721 | 3300026530 | Soil | ARDRSHFVVELDLGLTRKTVFTLRHGDTVPDRIVRHSVLGSKRRR |
| Ga0209160_11410291 | 3300026532 | Soil | VVVELDLGLRRKTVFTLRHGETVPDSVVKHTLLGSKQR |
| Ga0209157_10189714 | 3300026537 | Soil | MARDRSHLVVELDLGLTRKAVFTLRHGESAPDSVVKHSLLGSKRRK |
| Ga0209056_100967624 | 3300026538 | Soil | WRMARDHSHVVVELDLELRGKTVFTLRHGETVPDSVVKHALPGSKQR |
| Ga0209056_105632041 | 3300026538 | Soil | SHVVVELDLGLRRKTVFTLRHGETVPDSVVKHALLGSKQRR |
| Ga0209161_102080242 | 3300026548 | Soil | DHSHVVVELDLGLRRKTVFTLRHGETVPDSVVKHALLGSKQRR |
| Ga0179587_107013952 | 3300026557 | Vadose Zone Soil | ARDHSHVVVELDLGLRRKTVFTLRHGETVPDSVLKHTLLGSKQR |
| Ga0209388_11067151 | 3300027655 | Vadose Zone Soil | LDLGLRRKAVFTLRHGESVPDSVVKHSLLGSKRRR |
| Ga0208981_11999482 | 3300027669 | Forest Soil | GPKPTRAWRVARDRRHIVVEIDLGFSRKAVFTLRHGTTVPESVVKHSLLGSKRRQ |
| Ga0209588_11091952 | 3300027671 | Vadose Zone Soil | SHLVVELDLGLRRKAVFTLRHGDSVPDSVVKHSLLGSKRRR |
| Ga0209283_103620752 | 3300027875 | Vadose Zone Soil | PWRMARDHSHVVVELDLGLRRKTVFTLRHGETVPDSVVKHTQR |
| Ga0209590_110616452 | 3300027882 | Vadose Zone Soil | HVVVELDLGLRRKTVFTLRHGETVPDSVVKHTLPGSEQR |
| Ga0307473_101917521 | 3300031820 | Hardwood Forest Soil | WRVARDHSHVVVELDLGLRRKAVFTLRHGDSVPDSVVNHSLLGSKRRK |
| Ga0307479_121418271 | 3300031962 | Hardwood Forest Soil | MARDRSHVVVEVDLGLRRKAVFTVPHGDTAPSTVVKHSLLGSKRRR |
| Ga0307471_1041813102 | 3300032180 | Hardwood Forest Soil | SHSVVELDLGFSRKTVVAVRHGDLVADSVVKHSLLGSKRRTNP |
| ⦗Top⦘ |