


| Basic Information | |
|---|---|
| Family ID | F048660 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 148 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MKRASIGLGILVTFFLLAMFLMADAEVTPVDDPALISASAPAR |
| Number of Associated Samples | 130 |
| Number of Associated Scaffolds | 148 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 85.14 % |
| % of genes near scaffold ends (potentially truncated) | 23.65 % |
| % of genes from short scaffolds (< 2000 bps) | 77.70 % |
| Associated GOLD sequencing projects | 125 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.297 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (11.486 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.432 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (34.459 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 30.99% β-sheet: 0.00% Coil/Unstructured: 69.01% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 148 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 50.00 |
| PF09130 | DUF1932 | 6.08 |
| PF02310 | B12-binding | 4.05 |
| PF04055 | Radical_SAM | 2.70 |
| PF03446 | NAD_binding_2 | 2.70 |
| PF02705 | K_trans | 1.35 |
| PF00982 | Glyco_transf_20 | 1.35 |
| PF04392 | ABC_sub_bind | 0.68 |
| PF06508 | QueC | 0.68 |
| PF02775 | TPP_enzyme_C | 0.68 |
| PF00440 | TetR_N | 0.68 |
| PF13525 | YfiO | 0.68 |
| PF02771 | Acyl-CoA_dh_N | 0.68 |
| PF02954 | HTH_8 | 0.68 |
| PF00012 | HSP70 | 0.68 |
| PF11839 | Alanine_zipper | 0.68 |
| PF00005 | ABC_tran | 0.68 |
| PF00528 | BPD_transp_1 | 0.68 |
| PF12860 | PAS_7 | 0.68 |
| PF00691 | OmpA | 0.68 |
| PF03807 | F420_oxidored | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 148 Family Scaffolds |
|---|---|---|---|
| COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 6.08 |
| COG0380 | Trehalose-6-phosphate synthase, GT20 family | Carbohydrate transport and metabolism [G] | 1.35 |
| COG3158 | K+ uptake protein Kup | Inorganic ion transport and metabolism [P] | 1.35 |
| COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| COG0137 | Argininosuccinate synthase | Amino acid transport and metabolism [E] | 0.68 |
| COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 0.68 |
| COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 0.68 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 0.68 |
| COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| COG0780 | NADPH-dependent 7-cyano-7-deazaguanine reductase QueF, C-terminal domain, T-fold superfamily | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 0.68 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.68 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.97 % |
| Unclassified | root | N/A | 27.03 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000443|F12B_10792803 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 597 | Open in IMG/M |
| 3300000574|JGI1357J11328_10212422 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 518 | Open in IMG/M |
| 3300000596|KanNP_Total_noBrdU_T14TCDRAFT_1023096 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300000956|JGI10216J12902_106506970 | Not Available | 894 | Open in IMG/M |
| 3300001431|F14TB_100104231 | All Organisms → cellular organisms → Bacteria | 3013 | Open in IMG/M |
| 3300002886|JGI25612J43240_1020738 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 970 | Open in IMG/M |
| 3300002914|JGI25617J43924_10361881 | Not Available | 504 | Open in IMG/M |
| 3300003324|soilH2_10019831 | All Organisms → cellular organisms → Bacteria | 23071 | Open in IMG/M |
| 3300003349|JGI26129J50193_1008153 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300003502|JGI26143J51219_1008428 | Not Available | 551 | Open in IMG/M |
| 3300003911|JGI25405J52794_10136215 | Not Available | 557 | Open in IMG/M |
| 3300003994|Ga0055435_10010198 | All Organisms → cellular organisms → Bacteria | 1768 | Open in IMG/M |
| 3300004058|Ga0055498_10030161 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 864 | Open in IMG/M |
| 3300004062|Ga0055500_10011607 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1454 | Open in IMG/M |
| 3300004463|Ga0063356_100044451 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4421 | Open in IMG/M |
| 3300004463|Ga0063356_100080772 | All Organisms → cellular organisms → Bacteria | 3434 | Open in IMG/M |
| 3300004479|Ga0062595_101601854 | Not Available | 607 | Open in IMG/M |
| 3300005289|Ga0065704_10485398 | Not Available | 678 | Open in IMG/M |
| 3300005330|Ga0070690_100034170 | All Organisms → cellular organisms → Bacteria | 3186 | Open in IMG/M |
| 3300005332|Ga0066388_100322526 | All Organisms → cellular organisms → Bacteria | 2191 | Open in IMG/M |
| 3300005338|Ga0068868_100096410 | All Organisms → cellular organisms → Bacteria | 2389 | Open in IMG/M |
| 3300005341|Ga0070691_10010740 | All Organisms → cellular organisms → Bacteria | 4180 | Open in IMG/M |
| 3300005341|Ga0070691_10014391 | All Organisms → cellular organisms → Bacteria | 3629 | Open in IMG/M |
| 3300005406|Ga0070703_10218277 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 758 | Open in IMG/M |
| 3300005436|Ga0070713_100514022 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 1131 | Open in IMG/M |
| 3300005439|Ga0070711_100414844 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300005445|Ga0070708_100058861 | All Organisms → cellular organisms → Bacteria | 3424 | Open in IMG/M |
| 3300005468|Ga0070707_101676120 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 603 | Open in IMG/M |
| 3300005529|Ga0070741_10002028 | All Organisms → cellular organisms → Bacteria | 56707 | Open in IMG/M |
| 3300005546|Ga0070696_100310448 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
| 3300005610|Ga0070763_10875966 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 533 | Open in IMG/M |
| 3300005713|Ga0066905_100012825 | All Organisms → cellular organisms → Bacteria | 4103 | Open in IMG/M |
| 3300005875|Ga0075293_1001963 | All Organisms → cellular organisms → Bacteria | 1763 | Open in IMG/M |
| 3300005937|Ga0081455_10000506 | All Organisms → cellular organisms → Bacteria | 50493 | Open in IMG/M |
| 3300005937|Ga0081455_10761738 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 611 | Open in IMG/M |
| 3300005985|Ga0081539_10408674 | Not Available | 564 | Open in IMG/M |
| 3300006574|Ga0074056_10838961 | Not Available | 525 | Open in IMG/M |
| 3300006845|Ga0075421_100344105 | All Organisms → cellular organisms → Bacteria | 1803 | Open in IMG/M |
| 3300009087|Ga0105107_10639708 | Not Available | 740 | Open in IMG/M |
| 3300009088|Ga0099830_10121186 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 1979 | Open in IMG/M |
| 3300009089|Ga0099828_11192631 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 675 | Open in IMG/M |
| 3300009090|Ga0099827_11270615 | Not Available | 640 | Open in IMG/M |
| 3300009795|Ga0105059_1041310 | Not Available | 586 | Open in IMG/M |
| 3300010047|Ga0126382_10439269 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1031 | Open in IMG/M |
| 3300010362|Ga0126377_13509646 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300010398|Ga0126383_12220243 | Not Available | 635 | Open in IMG/M |
| 3300010401|Ga0134121_10898925 | Not Available | 860 | Open in IMG/M |
| 3300011414|Ga0137442_1051821 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 829 | Open in IMG/M |
| 3300011423|Ga0137436_1213602 | Not Available | 506 | Open in IMG/M |
| 3300012034|Ga0137453_1035261 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 862 | Open in IMG/M |
| 3300012200|Ga0137382_11102372 | Not Available | 567 | Open in IMG/M |
| 3300012202|Ga0137363_10726925 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 841 | Open in IMG/M |
| 3300012362|Ga0137361_11705333 | Not Available | 549 | Open in IMG/M |
| 3300012912|Ga0157306_10218021 | Not Available | 653 | Open in IMG/M |
| 3300012918|Ga0137396_10928693 | Not Available | 636 | Open in IMG/M |
| 3300012922|Ga0137394_10133073 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 2111 | Open in IMG/M |
| 3300012929|Ga0137404_10241834 | All Organisms → cellular organisms → Bacteria | 1546 | Open in IMG/M |
| 3300012929|Ga0137404_10353374 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
| 3300012931|Ga0153915_10286846 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1834 | Open in IMG/M |
| 3300012961|Ga0164302_11162975 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300014321|Ga0075353_1105379 | Not Available | 665 | Open in IMG/M |
| 3300014884|Ga0180104_1002915 | All Organisms → cellular organisms → Bacteria | 3592 | Open in IMG/M |
| 3300015371|Ga0132258_10569992 | All Organisms → cellular organisms → Bacteria | 2839 | Open in IMG/M |
| 3300015372|Ga0132256_102496313 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 618 | Open in IMG/M |
| 3300017927|Ga0187824_10073386 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
| 3300017930|Ga0187825_10209905 | Not Available | 703 | Open in IMG/M |
| 3300017939|Ga0187775_10263454 | Not Available | 666 | Open in IMG/M |
| 3300017959|Ga0187779_11016300 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 576 | Open in IMG/M |
| 3300017973|Ga0187780_10084914 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2177 | Open in IMG/M |
| 3300017997|Ga0184610_1005155 | All Organisms → cellular organisms → Bacteria | 3085 | Open in IMG/M |
| 3300018000|Ga0184604_10048617 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1163 | Open in IMG/M |
| 3300018028|Ga0184608_10325973 | Not Available | 675 | Open in IMG/M |
| 3300018063|Ga0184637_10302182 | Not Available | 969 | Open in IMG/M |
| 3300018076|Ga0184609_10283138 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 776 | Open in IMG/M |
| 3300018084|Ga0184629_10055757 | All Organisms → cellular organisms → Bacteria | 1820 | Open in IMG/M |
| 3300018084|Ga0184629_10108031 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
| 3300018422|Ga0190265_10032211 | All Organisms → cellular organisms → Bacteria | 4372 | Open in IMG/M |
| 3300018422|Ga0190265_10038087 | All Organisms → cellular organisms → Bacteria | 4071 | Open in IMG/M |
| 3300018422|Ga0190265_13336384 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 536 | Open in IMG/M |
| 3300018429|Ga0190272_11142255 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 759 | Open in IMG/M |
| 3300018429|Ga0190272_11754559 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 645 | Open in IMG/M |
| 3300018429|Ga0190272_13259294 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 506 | Open in IMG/M |
| 3300019458|Ga0187892_10008145 | All Organisms → cellular organisms → Bacteria | 14505 | Open in IMG/M |
| 3300019458|Ga0187892_10064245 | All Organisms → cellular organisms → Bacteria | 2395 | Open in IMG/M |
| 3300019487|Ga0187893_10665738 | Not Available | 649 | Open in IMG/M |
| 3300019487|Ga0187893_10972046 | Not Available | 501 | Open in IMG/M |
| 3300019865|Ga0193748_1009230 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 878 | Open in IMG/M |
| 3300019879|Ga0193723_1012235 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2719 | Open in IMG/M |
| 3300020060|Ga0193717_1096507 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 941 | Open in IMG/M |
| 3300020580|Ga0210403_10769207 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 767 | Open in IMG/M |
| 3300020581|Ga0210399_10025161 | All Organisms → cellular organisms → Bacteria | 4731 | Open in IMG/M |
| 3300021073|Ga0210378_10222710 | Not Available | 717 | Open in IMG/M |
| 3300021080|Ga0210382_10059764 | Not Available | 1520 | Open in IMG/M |
| 3300021081|Ga0210379_10385250 | Not Available | 618 | Open in IMG/M |
| 3300021086|Ga0179596_10363099 | Not Available | 728 | Open in IMG/M |
| 3300021170|Ga0210400_11489954 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 537 | Open in IMG/M |
| 3300021445|Ga0182009_10016489 | All Organisms → cellular organisms → Bacteria | 2707 | Open in IMG/M |
| 3300021560|Ga0126371_11559501 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 787 | Open in IMG/M |
| 3300022533|Ga0242662_10264067 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 563 | Open in IMG/M |
| 3300023057|Ga0247797_1066328 | Not Available | 535 | Open in IMG/M |
| 3300023072|Ga0247799_1001625 | All Organisms → cellular organisms → Bacteria | 3139 | Open in IMG/M |
| 3300025160|Ga0209109_10135693 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300025165|Ga0209108_10088741 | All Organisms → cellular organisms → Bacteria | 1676 | Open in IMG/M |
| 3300025165|Ga0209108_10359003 | Not Available | 721 | Open in IMG/M |
| 3300025324|Ga0209640_10462488 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 1039 | Open in IMG/M |
| 3300025535|Ga0207423_1032218 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 894 | Open in IMG/M |
| 3300025899|Ga0207642_10377419 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 843 | Open in IMG/M |
| 3300025910|Ga0207684_10000867 | All Organisms → cellular organisms → Bacteria | 34569 | Open in IMG/M |
| 3300025910|Ga0207684_10104044 | All Organisms → cellular organisms → Bacteria | 2427 | Open in IMG/M |
| 3300025912|Ga0207707_10237611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1585 | Open in IMG/M |
| 3300025912|Ga0207707_10891578 | Not Available | 736 | Open in IMG/M |
| 3300025921|Ga0207652_11126713 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 685 | Open in IMG/M |
| 3300025934|Ga0207686_11236413 | Not Available | 612 | Open in IMG/M |
| 3300025957|Ga0210089_1051377 | Not Available | 531 | Open in IMG/M |
| 3300025962|Ga0210070_1026219 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 687 | Open in IMG/M |
| 3300026005|Ga0208285_1008575 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300026075|Ga0207708_11094058 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 695 | Open in IMG/M |
| 3300026102|Ga0208914_1044891 | Not Available | 543 | Open in IMG/M |
| 3300026121|Ga0207683_11896404 | Not Available | 545 | Open in IMG/M |
| 3300026351|Ga0257170_1022089 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300026508|Ga0257161_1072848 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300026514|Ga0257168_1001359 | All Organisms → cellular organisms → Bacteria | 3204 | Open in IMG/M |
| 3300026535|Ga0256867_10183895 | Not Available | 771 | Open in IMG/M |
| 3300027651|Ga0209217_1214762 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 513 | Open in IMG/M |
| 3300027682|Ga0209971_1081011 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina → Rhabditomorpha → Rhabditoidea → Rhabditidae → Rhabditidae incertae sedis → Diploscapter → Diploscapter pachys | 790 | Open in IMG/M |
| 3300027775|Ga0209177_10149795 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 790 | Open in IMG/M |
| 3300027882|Ga0209590_10710698 | Not Available | 642 | Open in IMG/M |
| 3300028792|Ga0307504_10163084 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 765 | Open in IMG/M |
| 3300028811|Ga0307292_10141355 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 968 | Open in IMG/M |
| 3300030006|Ga0299907_10146682 | All Organisms → cellular organisms → Bacteria | 1950 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1049936 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 882 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1078142 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 707 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1086416 | Not Available | 673 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10067452 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 943 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10074298 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 899 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10075006 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300031229|Ga0299913_10236756 | All Organisms → cellular organisms → Bacteria | 1808 | Open in IMG/M |
| 3300031455|Ga0307505_10281162 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 778 | Open in IMG/M |
| 3300031962|Ga0307479_10104123 | All Organisms → cellular organisms → Bacteria | 2760 | Open in IMG/M |
| 3300032174|Ga0307470_10014602 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3368 | Open in IMG/M |
| 3300032180|Ga0307471_100686054 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
| 3300032421|Ga0310812_10050673 | All Organisms → cellular organisms → Bacteria | 1597 | Open in IMG/M |
| 3300032770|Ga0335085_10000311 | All Organisms → cellular organisms → Bacteria | 145244 | Open in IMG/M |
| 3300033433|Ga0326726_10023284 | All Organisms → cellular organisms → Bacteria | 5384 | Open in IMG/M |
| 3300033480|Ga0316620_10831843 | Not Available | 888 | Open in IMG/M |
| 3300033486|Ga0316624_10318879 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
| 3300033513|Ga0316628_100801112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1242 | Open in IMG/M |
| 3300034817|Ga0373948_0098501 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 686 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.49% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.11% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.43% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.73% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 4.05% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 4.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.38% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 3.38% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.70% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.70% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.70% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 2.70% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.03% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.03% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.03% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.03% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.03% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.35% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.35% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.35% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.35% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.35% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 1.35% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 1.35% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.35% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.68% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.68% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.68% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.68% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.68% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.68% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.68% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.68% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.68% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.68% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.68% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.68% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.68% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
| 3300000574 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m | Environmental | Open in IMG/M |
| 3300000596 | Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA no BrdU F1.4TC | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Host-Associated | Open in IMG/M |
| 3300003502 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM | Host-Associated | Open in IMG/M |
| 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004058 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004062 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005875 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009795 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011414 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2 | Environmental | Open in IMG/M |
| 3300011423 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2 | Environmental | Open in IMG/M |
| 3300012034 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300014321 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014884 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300019865 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s1 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023057 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6 | Environmental | Open in IMG/M |
| 3300023072 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6 | Environmental | Open in IMG/M |
| 3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
| 3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025535 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025957 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025962 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026005 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026102 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F12B_107928032 | 3300000443 | Soil | MKRASIGLGILVTFFLLAMFLMADAEVQPLDDTPVLTSASSAR* |
| JGI1357J11328_102124222 | 3300000574 | Groundwater | MKRASIGLGILVTFFILAMFLMADAEVTPVDDPALISASAPAR* |
| KanNP_Total_noBrdU_T14TCDRAFT_10230963 | 3300000596 | Soil | GLGILVTFFLLAMFLMADAEVQPLDDTPVLTSASSAR* |
| JGI10216J12902_1065069702 | 3300000956 | Soil | MKRASIGLGILVTFFLLAMFLMADAEVQPVDDTPVLTSTSSGR* |
| F14TB_1001042313 | 3300001431 | Soil | MKRASIGLGILVTFFLLAMFLMADAEVQPQDDTPVLTSASSAR* |
| JGI25612J43240_10207382 | 3300002886 | Grasslands Soil | MKRATIGFGVLVTFFLLAMFLMADAEVPTVDDTAVVTSTSAR* |
| JGI25617J43924_103618811 | 3300002914 | Grasslands Soil | MKRATIGFGVLVTFFLLAMFLMADAEVPPVDDTAVVTSTAAR* |
| soilH2_100198318 | 3300003324 | Sugarcane Root And Bulk Soil | MKRATIGLGILVTFFLLAMFLMADAEVPAVNDAAVVNTSTAR* |
| JGI26129J50193_10081533 | 3300003349 | Arabidopsis Thaliana Rhizosphere | RMKRASIGLGILVTFFLLAMFLMADAEVQPLDDSPVLTSSPSAR* |
| JGI26143J51219_10084282 | 3300003502 | Arabidopsis Thaliana Rhizosphere | MKRASIGLGILVTFFLLAMFLMADAEVQPLDDSPVLTSSPSAR* |
| JGI25405J52794_101362152 | 3300003911 | Tabebuia Heterophylla Rhizosphere | RMKRASIGLGILVTFFLLAMFLMADAEVQPLDDPSVLTTSPSGH* |
| Ga0055435_100101983 | 3300003994 | Natural And Restored Wetlands | MKRASIGLGILITFFLLAIFLMADAEVTPVDDPAMVSTSAPAR* |
| Ga0055498_100301611 | 3300004058 | Natural And Restored Wetlands | MKRASIGLGILITFFLLAIFLMADAEVTPVDAPAMISTSAPAR* |
| Ga0055500_100116071 | 3300004062 | Natural And Restored Wetlands | MKRASIGLGILITFFLLAIFLMADAEVTPVDDPAMISTSAPAR* |
| Ga0063356_1000444514 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKRASIGLGILVTFFILAMFLMADAEVAPVDDPALISASAPAR* |
| Ga0063356_1000807725 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKRASIGLGILVTFFLLAMFLMADAEVPAVDDAAVVSTSAAR* |
| Ga0062595_1016018542 | 3300004479 | Soil | MKRASIGFGIIVTFFLLAMFLMADAEVTPVDDPALVSASAPAR* |
| Ga0065704_104853982 | 3300005289 | Switchgrass Rhizosphere | MKRVSIGFGIIITFFILAMFLMADAEVTPVDDPALMSTSAPAR* |
| Ga0070690_1000341704 | 3300005330 | Switchgrass Rhizosphere | MKRASIGLGILVTFFLLAMFLMADAEVPAVDDTAVVTSTSAR* |
| Ga0066388_1003225263 | 3300005332 | Tropical Forest Soil | MKRASIGLGIFMIFFLLAMFLMADAEVAPVDDPAVVSTSASAR* |
| Ga0068868_1000964102 | 3300005338 | Miscanthus Rhizosphere | MKRASIGFGIIVTFFLLAMFLMADAEVPAVDDAAVVSTSAAR* |
| Ga0070691_100107403 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRATIGLGVLVTFFLLAMFLMADAEVPPVDDAAVVTSTAAR* |
| Ga0070691_100143911 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | SIGLGILVTFFLLAMFLMADAEVQPLDDSPVLTSSPSAR* |
| Ga0070703_102182772 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRATIGFGVLVTFFLLAMFLMADAEVPTVDDTAVVTSTAAR* |
| Ga0070713_1005140222 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRATIGFGVLVTFFLLAMFLMADAEVPAVDDTAVVTSTSAR* |
| Ga0070711_1004148443 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRATIGFGVLVTFFLLAMFLMADAEVPAVDDTAVVTSTAAR* |
| Ga0070708_1000588612 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRVSIGLGILVTFFLLAMLLMVDAEVPPVNEPAVTTDAAAR* |
| Ga0070707_1016761202 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRASIGLGILVTFFLLAMFLMADAEVTPVDDPALISASAPAR* |
| Ga0070741_100020282 | 3300005529 | Surface Soil | MKRLSIGLGILVMFFVVAMFLMADAEVPSAEDAAVISTSAPAR* |
| Ga0070696_1003104483 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRATIGFGVLVTFFLLAMFLMADAEVSTVDDTAVVTSTSAR* |
| Ga0070763_108759661 | 3300005610 | Soil | MKRASIGLGILVIFFLLAMFLMADAEVQPVEDTPVVTTSAPAR* |
| Ga0066905_1000128253 | 3300005713 | Tropical Forest Soil | MKRASIGLGILVTFFLLAMFLMADAEIQPLDDTPVLTSTPSAR* |
| Ga0075293_10019633 | 3300005875 | Rice Paddy Soil | MKRASIGLGVLVTFFLLAMFLMADAEVAPPDSPTVTTSAAAR* |
| Ga0081455_100005063 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MKRASIGLGILVTFFLLAMFLMADAEVQPLDDPSVLTTSPSGH* |
| Ga0081455_107617381 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MKRVSIGLGILMTFFFLAMFLMADAEIPAASDPVAAADATAR* |
| Ga0081539_104086742 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MKRASIGLGILVTFFLLAMFLMADAEVPAVDDAAVISTSTAR* |
| Ga0074056_108389612 | 3300006574 | Soil | MKRATIGFGVLVTFFLLAMFLMADAEVPAVDDTVVVTSTAAR* |
| Ga0075421_1003441053 | 3300006845 | Populus Rhizosphere | MKRASIGLGILVTFFLLAMFLMADAEVTPVDDPALISASTPAR* |
| Ga0105107_106397082 | 3300009087 | Freshwater Sediment | MKRASIGFGILVTFFILAMFLMADAEVTPVDDPALISASSPAR* |
| Ga0099830_101211862 | 3300009088 | Vadose Zone Soil | MKRVSIGLGILVTFFLLAMLLMVDAEVPPVNEPVVTTGAAAR* |
| Ga0099828_111926312 | 3300009089 | Vadose Zone Soil | MKRATIGFGVLVTFFLLAMFLMADAEVPPVDDTAVVT |
| Ga0099827_112706152 | 3300009090 | Vadose Zone Soil | MKRVSIGLGILVTFFLLAMFLMVDAEVPPVNEPAVTTGAAAR* |
| Ga0105059_10413102 | 3300009795 | Groundwater Sand | MKRVSIGLGILVTFFLLAMLLMVDAEVSPVSDPMVTTGAAAR* |
| Ga0126382_104392693 | 3300010047 | Tropical Forest Soil | MKRASIGLGILVTFFLLAMFLMADAEIQPLDNTPVLTSTPSAR* |
| Ga0126377_135096462 | 3300010362 | Tropical Forest Soil | MKRASIGLGIFMIFFLLAMFLMADAEVAPVDDPTIVSTSAPAR* |
| Ga0126383_122202432 | 3300010398 | Tropical Forest Soil | MKRASIGLGIFMIFFLLAMFLMADAEVAPVDDPAVVSTSVSAR* |
| Ga0134121_108989252 | 3300010401 | Terrestrial Soil | MKRATIGFGVLVTFFLLAMFLMAAAEVSTVDDTAVVTSTSAR* |
| Ga0137442_10518212 | 3300011414 | Soil | MKRASIGFGILVTFFILAMFLMADAEVTPVDDPALISTSAPAR* |
| Ga0137436_12136022 | 3300011423 | Soil | MKRASIGFGILVTFFILAMFLMADAEVTPVDDPALISASAPAR* |
| Ga0137453_10352612 | 3300012034 | Soil | MKRASIGLGILVTFFILAMFLMADAEVTPVDDPALISTSAPAR* |
| Ga0137382_111023721 | 3300012200 | Vadose Zone Soil | MKRATIGFGVLVTFFLLAMFLMADAEVPTVDDAAVVTSTSAR* |
| Ga0137363_107269251 | 3300012202 | Vadose Zone Soil | MKRATIGFGVLVTFFLLAMFLMADAEVPTVDDTAV |
| Ga0137361_117053332 | 3300012362 | Vadose Zone Soil | FGVLVTFFLLAMFLMADAEVPTVDDTAVVTSTSAR* |
| Ga0157306_102180211 | 3300012912 | Soil | ASIGLGILVTFFLLAMFLMADAEVQPLDDSPVLTSSPSAR* |
| Ga0137396_109286932 | 3300012918 | Vadose Zone Soil | MKRATIGFGVLVTFFLLAMFLMADAEVPPVDDTAVVTSTSAR* |
| Ga0137394_101330733 | 3300012922 | Vadose Zone Soil | MKRASIGLGILVTFFLLAMFLMADAEVTPVDDPALISASAPTR* |
| Ga0137404_102418342 | 3300012929 | Vadose Zone Soil | MKRASIGLGILVTFFLLAMFLMADAEVTPVDDPALI* |
| Ga0137404_103533741 | 3300012929 | Vadose Zone Soil | HPRMKRASIGLGILVTFFLLAMFLMADAEVTPVDDPALVSASAPAR* |
| Ga0153915_102868463 | 3300012931 | Freshwater Wetlands | MKRATIGLGVLVIFFLLAMFLMADAEVPPVDDTAVVASTAAR* |
| Ga0164302_111629752 | 3300012961 | Soil | MKRASIGLGILVTSFLLAMFLMADAEVPAVDDAAVVSTSAAR* |
| Ga0075353_11053793 | 3300014321 | Natural And Restored Wetlands | ASIGLGILITFFLLAIFLMADAEVTPVDDPAMISTSAPAR* |
| Ga0180104_10029154 | 3300014884 | Soil | MKRASIGLGILVTFFILAMCLMADAEVTPVDDPALISASAPAR* |
| Ga0132258_105699923 | 3300015371 | Arabidopsis Rhizosphere | MKRATIGFGVLVTFFLLAMFLMADAEVPPVDDTAVVINTAAR* |
| Ga0132256_1024963131 | 3300015372 | Arabidopsis Rhizosphere | MKRATIGFGILVTFFLLAMFLMADAEVPPVDDTAVV |
| Ga0187824_100733863 | 3300017927 | Freshwater Sediment | MKRATIGFGILVTFFLLAMFLMADAEVPAVDDTAVVTSTAAR |
| Ga0187825_102099052 | 3300017930 | Freshwater Sediment | MKRATIGFGILVTFFLLAMFLMADAEVPPVDDTAVVTSTAAR |
| Ga0187775_102634542 | 3300017939 | Tropical Peatland | MKRASIGLGILVTFFLLAMFLMADAEVQPADDSPVLTSTSAAR |
| Ga0187779_110163001 | 3300017959 | Tropical Peatland | MKRAWIGLGILITFFILAMFLMADADVQPAEDSPVVSSAPAR |
| Ga0187780_100849143 | 3300017973 | Tropical Peatland | MKRAWIGFGILITFFILAMFLMADAEVQPVDDTPVVSSAPAR |
| Ga0184610_10051555 | 3300017997 | Groundwater Sediment | MKRASIGLGILVTFFILAMFLMADAEVTPVDDPALISASAPAR |
| Ga0184604_100486173 | 3300018000 | Groundwater Sediment | MKRASIGLGILVTFFLLAMFLMADAEVSPVDDPALISASAPAR |
| Ga0184608_103259732 | 3300018028 | Groundwater Sediment | HPRMKRASIGLGILVTFFILAMFLMADAEVTPVDDPALISASAPAR |
| Ga0184637_103021822 | 3300018063 | Groundwater Sediment | MKRVSIGLGILVTFFLLAMFLMVDAEVPAVSDPVVTTGSVAR |
| Ga0184609_102831383 | 3300018076 | Groundwater Sediment | DHPRMKRASIGLGILVTFFILAMFLMADAEVTPVDDPALISASAPAR |
| Ga0184629_100557574 | 3300018084 | Groundwater Sediment | SIGLGILVTFFIRAMFLMADAEVTPVDDPALISASAPAR |
| Ga0184629_101080313 | 3300018084 | Groundwater Sediment | MKRASIGFSILVTFFILAMFLMADAEVTPVDDPALISTSAPAR |
| Ga0190265_100322113 | 3300018422 | Soil | MKRASIGLGILVTFFILAMFLMADAEVTPVDDPALISASSPAR |
| Ga0190265_100380874 | 3300018422 | Soil | MKRASIGLGILVTFFLLAMFLMADAEVVPLDDPAVHSTSAPAR |
| Ga0190265_133363842 | 3300018422 | Soil | MKRASIGFGILVTFFILAMFLMADAEVTPVDDPALVSTSAPAR |
| Ga0190272_111422552 | 3300018429 | Soil | MKRASIGLGILVTFFILAMFLMADAEVTPVDDPALISASAP |
| Ga0190272_117545592 | 3300018429 | Soil | MKRASIGLGILVTFFILAMFLMADAEVTPVDDPALVSTSAPAR |
| Ga0190272_132592942 | 3300018429 | Soil | MKRASIGLGILVTFFLLAMFLMADAEVTPVDDPALISASAPAR |
| Ga0187892_1000814512 | 3300019458 | Bio-Ooze | MKRASIGLGILVTFFLLAMFLMADAEVTPVDDPALISASTPAR |
| Ga0187892_100642452 | 3300019458 | Bio-Ooze | MKRVSIGLGILVTFFLLAMFLMVDAEVPPVSDPVVTTGAAAR |
| Ga0187893_106657381 | 3300019487 | Microbial Mat On Rocks | PRMKRASIGLGILVTFFLLAMFLMADAEVTPVDDPALISASTPAR |
| Ga0187893_109720462 | 3300019487 | Microbial Mat On Rocks | MKRAWIGLGILVTFFVLAMFLMADAEVTPLDDPALISPSSLPR |
| Ga0193748_10092302 | 3300019865 | Soil | MKRATIGFGVLVTFFLLAMFLMADAEVPTVDDTAVVTSTSAR |
| Ga0193723_10122354 | 3300019879 | Soil | MKRASIGFGIIVTFFLLAMFLMADAEVPPVDDPALVSASAPAR |
| Ga0193717_10965072 | 3300020060 | Soil | MKRASIGFGILVTFFILAMFLMADAEVTPVDDPALISASAPAR |
| Ga0210403_107692072 | 3300020580 | Soil | MKRASIGLGILVIFFLLAMFLMADAEVQPVEDTPVVTTSAPAR |
| Ga0210399_100251616 | 3300020581 | Soil | MKRASIGLGILVIFFLLAMLLMADAEVQPVEDTPVVTTSAPAR |
| Ga0210378_102227103 | 3300021073 | Groundwater Sediment | GDHPRMKRASIGLGILVTFFILAMFLMADAEVTPVDDPALISASAPAR |
| Ga0210382_100597644 | 3300021080 | Groundwater Sediment | IGLGILVTFFLLAMFLMADAEVSPVDDPALISASAPAR |
| Ga0210379_103852502 | 3300021081 | Groundwater Sediment | RASIGLGILVTFFILAMFLMADAEVTPVDDPALISASAPAR |
| Ga0179596_103630992 | 3300021086 | Vadose Zone Soil | MKRATIGFGVLVTFFLLAMFLMADAEVPPVDDTAVVTSTAAR |
| Ga0210400_114899542 | 3300021170 | Soil | MKRASIGLGILVIFFLLAMLLMADAEVQPVEDTPVVT |
| Ga0182009_100164892 | 3300021445 | Soil | MKRASIGLGILVTFFLLAMFLMADAEVPAVDDAAVVSTSAAR |
| Ga0126371_115595012 | 3300021560 | Tropical Forest Soil | MKRASIGLGIFMIFFLLAMFLMADAEVAPVDDPAVVSTSASAR |
| Ga0242662_102640671 | 3300022533 | Soil | MKRATIGFGVLVTFFLLAMFLMADAEVPAVDDTAVVTGTAAR |
| Ga0247797_10663282 | 3300023057 | Soil | MKRASIGLGILVTFFLLAMFLMADAEVQPLDDSPVLTSSPSAR |
| Ga0247799_10016251 | 3300023072 | Soil | RPRMKRASIGLGILVTFFLLAMFLMADAEVQPLDDSPVLTSSPSAR |
| Ga0209109_101356932 | 3300025160 | Soil | MKRASIGLGILVTFFILAMFLMADAEVTPVDDPALFSASAPAR |
| Ga0209108_100887413 | 3300025165 | Soil | MKRASIGLGILVTFFILAMFLMADAEVTPLDDSAVVSTSAPAR |
| Ga0209108_103590032 | 3300025165 | Soil | MKRVSIGLGILVTFFLLAMFLMVDAEVPSVNDPVVTTGAAAR |
| Ga0209640_104624882 | 3300025324 | Soil | MKRVSIGLGILVTFFLLAMFLMVDAEVPPVNDSVVTTGAAAR |
| Ga0207423_10322182 | 3300025535 | Natural And Restored Wetlands | MKRASIGLGILITFFLLAIFLMADAEVTPVDDPAMVSTSAPAR |
| Ga0207642_103774191 | 3300025899 | Miscanthus Rhizosphere | RMKRASIGFGIIVTFFLLAMFLMADAEVTPVDDPALVSASAPAR |
| Ga0207684_1000086712 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRVSIGLGILVTFFLLAMLLMVDAEVPPVNEPAVTTDAAAR |
| Ga0207684_101040443 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRATIGFGVLVTFFLLAMFLMADAEVPTVDDTAVVTSTAAR |
| Ga0207707_102376112 | 3300025912 | Corn Rhizosphere | MKRASIGLGILVTFFILAMFLMADAEVAPVDDPALISASAPAR |
| Ga0207707_108915782 | 3300025912 | Corn Rhizosphere | MKRASIGFGIIVTFFLLAMFLMADAEVTPVDDPALVSASAPAR |
| Ga0207652_111267131 | 3300025921 | Corn Rhizosphere | MKRASIGLGILVTFFILAMFLMADAEVAPVDDPALISASAPA |
| Ga0207686_112364132 | 3300025934 | Miscanthus Rhizosphere | MKRATIGFGVLVTFFLLAMFLMADAEVSTVDDTAVVTSTSAR |
| Ga0210089_10513772 | 3300025957 | Natural And Restored Wetlands | MKRASIGFAILITFFILAMFLMADAEVTPVDDPALTSTSAPAR |
| Ga0210070_10262192 | 3300025962 | Natural And Restored Wetlands | MKRASIGLGILITFFLLAIFLMADAEVTPVDDPAMISTSAPAR |
| Ga0208285_10085752 | 3300026005 | Rice Paddy Soil | MKRATIGLGVLVTFFLLAMFLMADAEVPPVDDAAVVTSTAAR |
| Ga0207708_110940581 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRASIGFGIIVTFFLLAMFLMADAEVTPVDDPAL |
| Ga0208914_10448911 | 3300026102 | Natural And Restored Wetlands | KRASIGLGILITFFLLAIFLMADAEVTPVDDPAMISTSAPAR |
| Ga0207683_118964041 | 3300026121 | Miscanthus Rhizosphere | MKRASIGLGILVTFFLLAMFLMADAEVPAVDDAAVVSTSAA |
| Ga0257170_10220891 | 3300026351 | Soil | PRMKRASIGLGILVTFFILAMFLMADAEVTPVDDPALISASAPAR |
| Ga0257161_10728481 | 3300026508 | Soil | IGFGVLVTFFLLAMFLMADAEVPTVDDTAVVTSTSAR |
| Ga0257168_10013594 | 3300026514 | Soil | MKRATIGFGVLVTFFLLAMFLMADAEVPTVDDTAVVTGTAAR |
| Ga0256867_101838952 | 3300026535 | Soil | MKRASIGLGILVTFFILAMFLMADAEVAPVDEPALSSAGAPTR |
| Ga0209217_12147621 | 3300027651 | Forest Soil | MKRATIGFGVLVTFFLLAMFLMADAEVPTVDDTAVVTSTSA |
| Ga0209971_10810111 | 3300027682 | Arabidopsis Thaliana Rhizosphere | MKRASIGLGILVTFFLLAMFLMADAEVPAVDDAAVVSTS |
| Ga0209177_101497951 | 3300027775 | Agricultural Soil | MKRATIGLGILVTFFLLAMFLMADAEVPAVNDAAVVNTSTAR |
| Ga0209590_107106982 | 3300027882 | Vadose Zone Soil | MKRVSIGLGILVTFFLLAMFLMVDAEVPPVNEPAVTTGAAAR |
| Ga0307504_101630842 | 3300028792 | Soil | MKRVSIGLGILVTFFLLAMLLMVDAEVPPVNDPVVTTGAAAR |
| Ga0307292_101413553 | 3300028811 | Soil | MKRASIGLGILVTFFLLAMFLMADAEVSPVDDPALISASAP |
| Ga0299907_101466824 | 3300030006 | Soil | MKRASIGLGILVTFFILAMFLMADAEVAPVDEPALSSASAPAR |
| (restricted) Ga0255311_10499362 | 3300031150 | Sandy Soil | MKRLSIGLGILVTFFLLAMLLMADAEVPSVSDSAVVTTSTPAR |
| (restricted) Ga0255311_10781422 | 3300031150 | Sandy Soil | MKRASIGFGIIITFFILAMFLMADAEVTPVDDPALMSTSAPAR |
| (restricted) Ga0255311_10864161 | 3300031150 | Sandy Soil | PGDHSRMKRASIGFGILVTFFILAMFLMADAEVTPVDDPALISASAPAR |
| (restricted) Ga0255310_100674522 | 3300031197 | Sandy Soil | MKRATIGFGILVTFFLLAMFLMADAEVPVVDDTAVVTSTAAR |
| (restricted) Ga0255310_100742982 | 3300031197 | Sandy Soil | MKRLSIGLGILVTFFLLAILLMADAEVPSVGDSAVVTTSAPAR |
| (restricted) Ga0255310_100750061 | 3300031197 | Sandy Soil | GLGILVTFFILAMFLMADAEVTPLDDAAVVSTSAPAR |
| Ga0299913_102367563 | 3300031229 | Soil | MKRASIGLGILVTFFILAMFLMADAEVAPVDEPALSSASAPTR |
| Ga0307505_102811622 | 3300031455 | Soil | MKRASIAFGILVTFFILAMFLMADAEVSPVDDPALISASSPAR |
| Ga0307479_101041236 | 3300031962 | Hardwood Forest Soil | MKRASIGLGILVIFFLLAMFLMADADVQPVEDTPVVTTSAPAR |
| Ga0307470_100146023 | 3300032174 | Hardwood Forest Soil | MKRASIGFGILVTFFILAMFLMADAEVTPVDDPALISTSAPAR |
| Ga0307471_1006860542 | 3300032180 | Hardwood Forest Soil | MKRASIGLGILVTFFLLAMFLMADAEVQPLDDTPVLTSSPSAR |
| Ga0310812_100506732 | 3300032421 | Soil | MKRATIGFGVLVTFFLLAMFLMADAEVPPVDDTAVVTNTSAR |
| Ga0335085_1000031126 | 3300032770 | Soil | MKRASIGLGVLVTFFLLAMFLMADAEVQPVEDTPVLTSSSPAR |
| Ga0326726_100232845 | 3300033433 | Peat Soil | MKRATIGLGVLVTFFLLAMFLMADAEVPPVDDTAVVTSTAAR |
| Ga0316620_108318432 | 3300033480 | Soil | MKRATIGLGVLVIFFLLAMFLMADAEVPPVDDTAVVASTAAR |
| Ga0316624_103188792 | 3300033486 | Soil | MKRATIGLGVLVTFFLLAMFLMADAEVPPVDDAAVVTSTAAAR |
| Ga0316628_1008011121 | 3300033513 | Soil | MKRATIGLGVLVIFFLLAMFLMADAEVPPVDDTAVVAS |
| Ga0373948_0098501_76_204 | 3300034817 | Rhizosphere Soil | MKRATIGFGVLVTFFLLAMFLMADAEVPPVDDTAVVTSTSAR |
| ⦗Top⦘ |