


| Basic Information | |
|---|---|
| Family ID | F048420 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 148 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MKNIGRLGTTVLGIYLIAVGVVPYLPPMGISMLVSVLAIVAGVLILLGR |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 148 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 83.11 % |
| % of genes near scaffold ends (potentially truncated) | 22.97 % |
| % of genes from short scaffolds (< 2000 bps) | 85.14 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.622 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (15.540 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.027 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (38.514 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.14% β-sheet: 0.00% Coil/Unstructured: 42.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 148 Family Scaffolds |
|---|---|---|
| PF03965 | Penicillinase_R | 14.19 |
| PF00583 | Acetyltransf_1 | 6.76 |
| PF13618 | Gluconate_2-dh3 | 6.76 |
| PF01364 | Peptidase_C25 | 4.05 |
| PF00270 | DEAD | 2.70 |
| PF00106 | adh_short | 2.03 |
| PF02610 | Arabinose_Isome | 2.03 |
| PF00793 | DAHP_synth_1 | 1.35 |
| PF07681 | DoxX | 1.35 |
| PF04972 | BON | 1.35 |
| PF02574 | S-methyl_trans | 1.35 |
| PF08447 | PAS_3 | 1.35 |
| PF13924 | Lipocalin_5 | 1.35 |
| PF13590 | DUF4136 | 1.35 |
| PF12228 | DUF3604 | 0.68 |
| PF00497 | SBP_bac_3 | 0.68 |
| PF13561 | adh_short_C2 | 0.68 |
| PF00149 | Metallophos | 0.68 |
| PF07755 | DUF1611 | 0.68 |
| PF13432 | TPR_16 | 0.68 |
| PF13635 | DUF4143 | 0.68 |
| PF13345 | Obsolete Pfam Family | 0.68 |
| PF00034 | Cytochrom_C | 0.68 |
| PF00440 | TetR_N | 0.68 |
| PF02378 | PTS_EIIC | 0.68 |
| PF06267 | DUF1028 | 0.68 |
| PF01451 | LMWPc | 0.68 |
| PF00596 | Aldolase_II | 0.68 |
| PF01435 | Peptidase_M48 | 0.68 |
| PF14559 | TPR_19 | 0.68 |
| PF08327 | AHSA1 | 0.68 |
| PF00890 | FAD_binding_2 | 0.68 |
| PF03486 | HI0933_like | 0.68 |
| PF01408 | GFO_IDH_MocA | 0.68 |
| PF13289 | SIR2_2 | 0.68 |
| PF03160 | Calx-beta | 0.68 |
| PF04945 | YHS | 0.68 |
| PF06580 | His_kinase | 0.68 |
| PF03575 | Peptidase_S51 | 0.68 |
| PF01965 | DJ-1_PfpI | 0.68 |
| PF03929 | PepSY_TM | 0.68 |
| PF08241 | Methyltransf_11 | 0.68 |
| PF00487 | FA_desaturase | 0.68 |
| PF01699 | Na_Ca_ex | 0.68 |
| PF08240 | ADH_N | 0.68 |
| PF01988 | VIT1 | 0.68 |
| PF13188 | PAS_8 | 0.68 |
| PF05685 | Uma2 | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 148 Family Scaffolds |
|---|---|---|---|
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 14.19 |
| COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 14.19 |
| COG2160 | L-arabinose isomerase | Carbohydrate transport and metabolism [G] | 2.03 |
| COG0493 | NADPH-dependent glutamate synthase beta chain or related oxidoreductase | Amino acid transport and metabolism [E] | 1.35 |
| COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 1.35 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.35 |
| COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 1.35 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 1.35 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 1.35 |
| COG0387 | Cation (Ca2+/Na+/K+)/H+ antiporter ChaA | Inorganic ion transport and metabolism [P] | 0.68 |
| COG0446 | NADPH-dependent 2,4-dienoyl-CoA reductase, sulfur reductase, or a related oxidoreductase | Lipid transport and metabolism [I] | 0.68 |
| COG0492 | Thioredoxin reductase | Posttranslational modification, protein turnover, chaperones [O] | 0.68 |
| COG0530 | Ca2+/Na+ antiporter | Inorganic ion transport and metabolism [P] | 0.68 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.68 |
| COG1053 | Succinate dehydrogenase/fumarate reductase, flavoprotein subunit | Energy production and conversion [C] | 0.68 |
| COG1249 | Dihydrolipoamide dehydrogenase (E3) component of pyruvate/2-oxoglutarate dehydrogenase complex or glutathione oxidoreductase | Energy production and conversion [C] | 0.68 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.68 |
| COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 0.68 |
| COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 0.68 |
| COG2072 | Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD | Inorganic ion transport and metabolism [P] | 0.68 |
| COG2081 | Predicted flavoprotein YhiN | General function prediction only [R] | 0.68 |
| COG2509 | FAD-dependent dehydrogenase | General function prediction only [R] | 0.68 |
| COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 0.68 |
| COG3182 | PepSY-associated TM region | Function unknown [S] | 0.68 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.68 |
| COG3275 | Sensor histidine kinase, LytS/YehU family | Signal transduction mechanisms [T] | 0.68 |
| COG3295 | Uncharacterized conserved protein | Function unknown [S] | 0.68 |
| COG3342 | Uncharacterized conserved protein, Ntn-hydrolase superfamily | General function prediction only [R] | 0.68 |
| COG3367 | Uncharacterized conserved protein, NAD-dependent epimerase/dehydratase family | General function prediction only [R] | 0.68 |
| COG3634 | Alkyl hydroperoxide reductase subunit AhpF | Defense mechanisms [V] | 0.68 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.68 |
| COG0029 | Aspartate oxidase | Coenzyme transport and metabolism [H] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.62 % |
| Unclassified | root | N/A | 28.38 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2067725004|GPKC_F5V46DG02D8IL9 | Not Available | 505 | Open in IMG/M |
| 2228664022|INPgaii200_c0837364 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100754492 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100755349 | Not Available | 560 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101303891 | Not Available | 1036 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_104707346 | Not Available | 518 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_103702141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1012 | Open in IMG/M |
| 3300002121|C687J26615_10024033 | Not Available | 1500 | Open in IMG/M |
| 3300003990|Ga0055455_10124595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 774 | Open in IMG/M |
| 3300004025|Ga0055433_10201862 | Not Available | 501 | Open in IMG/M |
| 3300004114|Ga0062593_100591763 | Not Available | 1055 | Open in IMG/M |
| 3300004114|Ga0062593_100726040 | Not Available | 974 | Open in IMG/M |
| 3300004479|Ga0062595_100101339 | All Organisms → cellular organisms → Bacteria | 1532 | Open in IMG/M |
| 3300004643|Ga0062591_100452510 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
| 3300005171|Ga0066677_10066608 | All Organisms → cellular organisms → Bacteria | 1840 | Open in IMG/M |
| 3300005332|Ga0066388_102105748 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300005332|Ga0066388_103057387 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 855 | Open in IMG/M |
| 3300005332|Ga0066388_106116098 | Not Available | 608 | Open in IMG/M |
| 3300005338|Ga0068868_101218638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
| 3300005440|Ga0070705_100927859 | Not Available | 702 | Open in IMG/M |
| 3300005440|Ga0070705_101404178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300005471|Ga0070698_101060746 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300005561|Ga0066699_10508340 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300005719|Ga0068861_102079154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300005764|Ga0066903_102887515 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300005764|Ga0066903_104104667 | Not Available | 780 | Open in IMG/M |
| 3300005764|Ga0066903_104291318 | Not Available | 762 | Open in IMG/M |
| 3300005764|Ga0066903_107340867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300005836|Ga0074470_11096232 | All Organisms → cellular organisms → Bacteria | 11538 | Open in IMG/M |
| 3300006042|Ga0075368_10033001 | All Organisms → cellular organisms → Bacteria | 2013 | Open in IMG/M |
| 3300006049|Ga0075417_10075554 | Not Available | 1497 | Open in IMG/M |
| 3300006051|Ga0075364_10368977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 979 | Open in IMG/M |
| 3300006177|Ga0075362_10764073 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300006196|Ga0075422_10320986 | Not Available | 668 | Open in IMG/M |
| 3300006573|Ga0074055_10581438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 871 | Open in IMG/M |
| 3300006605|Ga0074057_11359613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300006844|Ga0075428_100040391 | All Organisms → cellular organisms → Bacteria | 5133 | Open in IMG/M |
| 3300006844|Ga0075428_100466100 | Not Available | 1353 | Open in IMG/M |
| 3300006844|Ga0075428_100843694 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300006844|Ga0075428_100854880 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300006845|Ga0075421_100212319 | All Organisms → cellular organisms → Bacteria | 2390 | Open in IMG/M |
| 3300006845|Ga0075421_100225821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2305 | Open in IMG/M |
| 3300006845|Ga0075421_100542240 | All Organisms → cellular organisms → Bacteria | 1376 | Open in IMG/M |
| 3300006845|Ga0075421_100558151 | Not Available | 1352 | Open in IMG/M |
| 3300006845|Ga0075421_102647283 | Not Available | 520 | Open in IMG/M |
| 3300006852|Ga0075433_11330195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300006854|Ga0075425_101778271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
| 3300006871|Ga0075434_100492799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1246 | Open in IMG/M |
| 3300009038|Ga0099829_10587655 | Not Available | 926 | Open in IMG/M |
| 3300009038|Ga0099829_10717743 | Not Available | 830 | Open in IMG/M |
| 3300009053|Ga0105095_10040623 | All Organisms → cellular organisms → Bacteria | 2503 | Open in IMG/M |
| 3300009088|Ga0099830_10948041 | Not Available | 712 | Open in IMG/M |
| 3300009088|Ga0099830_11581326 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300009090|Ga0099827_10360652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1237 | Open in IMG/M |
| 3300009100|Ga0075418_11490901 | Not Available | 734 | Open in IMG/M |
| 3300009147|Ga0114129_10778798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1222 | Open in IMG/M |
| 3300009153|Ga0105094_10338053 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300009162|Ga0075423_11755469 | Not Available | 669 | Open in IMG/M |
| 3300009609|Ga0105347_1192286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
| 3300010359|Ga0126376_11393045 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300010359|Ga0126376_12250848 | Not Available | 590 | Open in IMG/M |
| 3300010360|Ga0126372_11998964 | Not Available | 626 | Open in IMG/M |
| 3300010362|Ga0126377_12319144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300010399|Ga0134127_10006002 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8824 | Open in IMG/M |
| 3300010400|Ga0134122_10307087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1364 | Open in IMG/M |
| 3300010400|Ga0134122_11679806 | Not Available | 662 | Open in IMG/M |
| 3300010401|Ga0134121_10011649 | All Organisms → cellular organisms → Bacteria | 6991 | Open in IMG/M |
| 3300010401|Ga0134121_12133905 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300011271|Ga0137393_10705158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 864 | Open in IMG/M |
| 3300011271|Ga0137393_10948882 | Not Available | 733 | Open in IMG/M |
| 3300012038|Ga0137431_1018220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae | 1916 | Open in IMG/M |
| 3300012350|Ga0137372_11004081 | Not Available | 582 | Open in IMG/M |
| 3300012469|Ga0150984_115262103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
| 3300012922|Ga0137394_10407951 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300012927|Ga0137416_11536039 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300012931|Ga0153915_12088635 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300015371|Ga0132258_10054974 | All Organisms → cellular organisms → Bacteria | 9137 | Open in IMG/M |
| 3300015371|Ga0132258_10672573 | All Organisms → cellular organisms → Bacteria | 2605 | Open in IMG/M |
| 3300015371|Ga0132258_10920208 | All Organisms → cellular organisms → Bacteria | 2208 | Open in IMG/M |
| 3300015371|Ga0132258_13670630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1048 | Open in IMG/M |
| 3300015371|Ga0132258_13699891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1043 | Open in IMG/M |
| 3300015374|Ga0132255_104326341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
| 3300017947|Ga0187785_10271112 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300017959|Ga0187779_10631913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_60_16 | 719 | Open in IMG/M |
| 3300018059|Ga0184615_10027522 | All Organisms → cellular organisms → Bacteria | 3141 | Open in IMG/M |
| 3300018063|Ga0184637_10023747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 3695 | Open in IMG/M |
| 3300018083|Ga0184628_10080818 | All Organisms → cellular organisms → Bacteria | 1659 | Open in IMG/M |
| 3300018083|Ga0184628_10159620 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1175 | Open in IMG/M |
| 3300018476|Ga0190274_12947942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300019361|Ga0173482_10421779 | Not Available | 626 | Open in IMG/M |
| 3300019362|Ga0173479_10190170 | Not Available | 857 | Open in IMG/M |
| 3300020581|Ga0210399_10000018 | All Organisms → cellular organisms → Bacteria | 121454 | Open in IMG/M |
| 3300020581|Ga0210399_10013727 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6372 | Open in IMG/M |
| 3300021090|Ga0210377_10121893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Hyalangium → unclassified Hyalangium → Hyalangium sp. H56D21 | 1723 | Open in IMG/M |
| 3300021090|Ga0210377_10169054 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
| 3300021171|Ga0210405_10144576 | All Organisms → cellular organisms → Bacteria | 1882 | Open in IMG/M |
| 3300021559|Ga0210409_11006131 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300023066|Ga0247793_1066058 | Not Available | 599 | Open in IMG/M |
| 3300023263|Ga0247800_1151145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300025160|Ga0209109_10129830 | Not Available | 1281 | Open in IMG/M |
| 3300025552|Ga0210142_1099727 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300025885|Ga0207653_10164320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 823 | Open in IMG/M |
| 3300025907|Ga0207645_10386530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 940 | Open in IMG/M |
| 3300025937|Ga0207669_10501023 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300026067|Ga0207678_10712674 | Not Available | 883 | Open in IMG/M |
| 3300026118|Ga0207675_100898245 | Not Available | 902 | Open in IMG/M |
| 3300026535|Ga0256867_10012641 | All Organisms → cellular organisms → Bacteria | 3677 | Open in IMG/M |
| 3300026538|Ga0209056_10143589 | All Organisms → cellular organisms → Bacteria | 1844 | Open in IMG/M |
| 3300027577|Ga0209874_1031671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1446 | Open in IMG/M |
| 3300027678|Ga0209011_1143446 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300027866|Ga0209813_10130250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 884 | Open in IMG/M |
| 3300027873|Ga0209814_10151874 | Not Available | 994 | Open in IMG/M |
| 3300027873|Ga0209814_10500144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300027882|Ga0209590_10220335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1204 | Open in IMG/M |
| 3300027909|Ga0209382_10037239 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5842 | Open in IMG/M |
| 3300027909|Ga0209382_10134370 | All Organisms → cellular organisms → Bacteria | 2877 | Open in IMG/M |
| 3300027909|Ga0209382_10296696 | All Organisms → cellular organisms → Bacteria | 1824 | Open in IMG/M |
| 3300027909|Ga0209382_10733846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1059 | Open in IMG/M |
| 3300027947|Ga0209868_1026939 | Not Available | 602 | Open in IMG/M |
| 3300028536|Ga0137415_10859894 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300028803|Ga0307281_10114574 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300028869|Ga0302263_10289357 | Not Available | 650 | Open in IMG/M |
| 3300029636|Ga0222749_10039214 | All Organisms → cellular organisms → Bacteria | 2049 | Open in IMG/M |
| 3300030002|Ga0311350_10652666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfocapsaceae → Desulfopila → unclassified Desulfopila → Desulfopila sp. IMCC35008 | 945 | Open in IMG/M |
| 3300030613|Ga0299915_10106702 | All Organisms → cellular organisms → Bacteria | 2035 | Open in IMG/M |
| 3300031232|Ga0302323_100559917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → Thermithiobacillaceae → Thermithiobacillus → Thermithiobacillus tepidarius | 1234 | Open in IMG/M |
| 3300031232|Ga0302323_101673866 | Not Available | 719 | Open in IMG/M |
| 3300031547|Ga0310887_10147269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1230 | Open in IMG/M |
| 3300031720|Ga0307469_11184970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
| 3300031740|Ga0307468_100552599 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300031965|Ga0326597_11375973 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300032012|Ga0310902_10095758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1575 | Open in IMG/M |
| 3300032157|Ga0315912_10005438 | All Organisms → cellular organisms → Bacteria | 11725 | Open in IMG/M |
| 3300032205|Ga0307472_101981989 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300032829|Ga0335070_10092426 | All Organisms → cellular organisms → Bacteria | 3187 | Open in IMG/M |
| 3300032829|Ga0335070_10298987 | All Organisms → cellular organisms → Bacteria | 1561 | Open in IMG/M |
| 3300033004|Ga0335084_10320054 | All Organisms → cellular organisms → Bacteria | 1602 | Open in IMG/M |
| 3300033004|Ga0335084_12447802 | Not Available | 502 | Open in IMG/M |
| 3300033419|Ga0316601_100834838 | Not Available | 913 | Open in IMG/M |
| 3300033419|Ga0316601_101143730 | Not Available | 780 | Open in IMG/M |
| 3300033433|Ga0326726_11912522 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300033433|Ga0326726_12018618 | Not Available | 561 | Open in IMG/M |
| 3300033480|Ga0316620_10285896 | All Organisms → cellular organisms → Bacteria | 1434 | Open in IMG/M |
| 3300033480|Ga0316620_12089505 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300033486|Ga0316624_10735210 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300033521|Ga0316616_104784117 | Not Available | 509 | Open in IMG/M |
| 3300033760|Ga0314870_027346 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 528 | Open in IMG/M |
| 3300034177|Ga0364932_0043419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RBG_16_70_10 | 1692 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 15.54% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.11% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.41% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.73% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.05% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.38% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.70% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.70% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.70% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.70% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 2.70% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.03% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.03% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.35% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.35% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.35% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.35% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.35% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.35% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.35% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.35% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.68% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.68% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.68% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.68% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.68% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2067725004 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300002121 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 | Environmental | Open in IMG/M |
| 3300003990 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 | Environmental | Open in IMG/M |
| 3300004025 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300006042 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006177 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012038 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2 | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300023066 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6 | Environmental | Open in IMG/M |
| 3300023263 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6 | Environmental | Open in IMG/M |
| 3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
| 3300025552 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027947 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028869 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030613 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033760 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_C | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPKC_07322460 | 2067725004 | Soil | MKNIGQLGTTALGIYLIAIGVVPYVLPSAVVLVSALAVVAGVLILLGR |
| INPgaii200_08373642 | 2228664022 | Soil | MKNIGRLGTTVLGVYLIAIGVVPYVLPSAVALVSALAVVAGVLILLGR |
| INPhiseqgaiiFebDRAFT_1007544923 | 3300000364 | Soil | MKNIGRLGTTVLGVYLIAIGVVPYVLPSAVALVSALAVVAGVLILLGR* |
| INPhiseqgaiiFebDRAFT_1007553492 | 3300000364 | Soil | MKNIGRLGTTVLGIYLIAVGVVPYLPPMGISMLVSVLAIVAGVLILLGR* |
| INPhiseqgaiiFebDRAFT_1013038911 | 3300000364 | Soil | MRTAGRLGMTVLGIYLIAQGVFPYLPILGLSPLMSVLAIVSGVLILMGR |
| INPhiseqgaiiFebDRAFT_1047073462 | 3300000364 | Soil | MLRPAAGRLGMTVLGIYLIAVGVAPYIFPMGFGPLIAVLAIVAGALILMGR* |
| JGIcombinedJ13530_1037021412 | 3300001213 | Wetland | MQVRGLSKTVLGIYLIAVGVVPYLPLLSGLMPLVSLLAIVAGVLLLFERKR* |
| C687J26615_100240332 | 3300002121 | Soil | MKTGGKLGTTLLGVYLIAVGVLPYLPLLSGLAPLASLLAIIAGIVILLGR* |
| Ga0055455_101245952 | 3300003990 | Natural And Restored Wetlands | MRIRGLGRTVLGIYLIAVGVVPYLPFFSGLMPLVSLMAIVAGVLLLLERGR* |
| Ga0055433_102018622 | 3300004025 | Natural And Restored Wetlands | MRAAAGRLGMTVLGVYLIAVGVAPYLPLMGLGPLLSIAAIVAGVLILTGR* |
| Ga0062593_1005917632 | 3300004114 | Soil | MKNIGRLGTTVLGVYLIAVGVVPYLPPMGISMLVSVLAIVAGVLILLGR* |
| Ga0062593_1007260401 | 3300004114 | Soil | MRPAAGRLGMTVLGIYLIAVGIVPYLPTIGLGPLLSVAAIVAGVLILSGR* |
| Ga0062595_1001013392 | 3300004479 | Soil | MRPAAGRLGMTVLGIYLIAVGIVPYLPTIGLGLLLSVAAILAGVLILTGR* |
| Ga0062591_1004525103 | 3300004643 | Soil | MKDIGRLGATVLGVYLIAVGVVPYLPPMGVSMLVSVLAIVAGVLILLGR* |
| Ga0066677_100666081 | 3300005171 | Soil | MRTMGRLGTTVLGVYLIAVAVVPYLPPMGVSVLVSILAFVAGILILVGR* |
| Ga0066388_1021057482 | 3300005332 | Tropical Forest Soil | MRPSAGRLGMTVLGIYLIAVGIVPYLPPVGLSMLVSVAAILAGVLILSGR* |
| Ga0066388_1030573872 | 3300005332 | Tropical Forest Soil | GGLFMRPAAGRLGMTVLGIYLIVVGVAPFVLPMGFGGLTALLAIVAGALILLGR* |
| Ga0066388_1061160981 | 3300005332 | Tropical Forest Soil | MRPAAGRLGMTVLGIYLIAVGIVPYLPTIGLGPLLSVAAIVA |
| Ga0068868_1012186382 | 3300005338 | Miscanthus Rhizosphere | MKNIGQLSTTALGIYLIAIGVVPYVLPSAVVLVSALAVVAGVLILLGR* |
| Ga0070705_1009278591 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNIGQLGTTALGIYLIAIGVVPYVLPSAVVLVSALAVVAGVLILLGR* |
| Ga0070705_1014041782 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPSAGRMGMTVLGIYLIAVGIVPYLPTIGLGPLLSVAAIVAGVLILTGR* |
| Ga0070698_1010607462 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTAGRLGTTLLGIYLIVVGVLPYVPLLGIGPLVSLLAIVAGIMILAGL* |
| Ga0066699_105083402 | 3300005561 | Soil | MRTMGRLGTTVLGVYLIAVAVVPYLPPMGVSVLVSILAFAAGILILVGR* |
| Ga0068861_1020791541 | 3300005719 | Switchgrass Rhizosphere | GVYLIAVGVVPYLPPMGISMLVSVLAIVAGVLILLGR* |
| Ga0066903_1028875152 | 3300005764 | Tropical Forest Soil | MRPAAGRLGMTVLGIYLIVVGVAPYIFPMGFGAIVSVLAIVAGTLILMGR* |
| Ga0066903_1041046672 | 3300005764 | Tropical Forest Soil | MTVLGIYLIVVGVAPFVLPMGFGGVTALLAIIAGALILTGR* |
| Ga0066903_1042913182 | 3300005764 | Tropical Forest Soil | MKTAGRLGMTVLGVYLIAVGIVPYLPFLAGLAPLLSLAAIVAGVLILMGR* |
| Ga0066903_1073408672 | 3300005764 | Tropical Forest Soil | MRPSAGRLGMTVLGIYLIAVGVVPYLPPIGLSMLVSVAAILAGVLILSGR* |
| Ga0074470_110962328 | 3300005836 | Sediment (Intertidal) | MKAAGKLGMTVLGIYLIAIGVVPYLPFLSGLSPLLSLAAIVAGILILMGR* |
| Ga0075368_100330014 | 3300006042 | Populus Endosphere | KNIGRLGTTVLGVYLIAVGVVPYLPPMGISMLVSVLAIVAGVLILLGR* |
| Ga0075417_100755542 | 3300006049 | Populus Rhizosphere | MRPAAGRLGMTVLGIYLIAVGIAPYLFPIGLGPLLSVGAIVAGVLILMGR* |
| Ga0075364_103689772 | 3300006051 | Populus Endosphere | MKNIGRLGTTVLGVYLIAVGVVPYLPPMGVSMLVSVLAIVAGVLILLGR* |
| Ga0075362_107640732 | 3300006177 | Populus Endosphere | MKRIGPLGSTVLGAYLILIGIAPYLPLMGLGVLISALAIAAGVLILMGR* |
| Ga0075422_103209862 | 3300006196 | Populus Rhizosphere | MRPAAGRLGMTVLGIYLIAVGVVPYLPTIGLGLLLSVAAILAGVLILSG |
| Ga0074055_105814381 | 3300006573 | Soil | MRPAAGRLGMTVLGIYLIAVGVVPYLPMMGLGPLLSVAAIVAGVLILTGR* |
| Ga0074057_113596132 | 3300006605 | Soil | VLGIYLIAVGVVPYLPMMGLGPLLSVAAIVAGVLILTGR* |
| Ga0075428_1000403914 | 3300006844 | Populus Rhizosphere | MRPAAGRLGMTVLGIYLIAVGVVPYLPTIGLGLLLSVAAILAGVLILSGR* |
| Ga0075428_1004661001 | 3300006844 | Populus Rhizosphere | AGRLGMTVLGIYLIAVGIAPYLFPIGLGPLLSVGAIVAGVLILMGR* |
| Ga0075428_1008436942 | 3300006844 | Populus Rhizosphere | MKNIGRLGTTLLGVYLIAVGVVPYLPPVGASMLVSVLAIVAGIVILLGR* |
| Ga0075428_1008548801 | 3300006844 | Populus Rhizosphere | MRPSAGRLGMTVLGIYLIAVGVVPYLPTIGLGLLLSVAAIVAGVLILTGR* |
| Ga0075421_1002123193 | 3300006845 | Populus Rhizosphere | MRPSAGRLGMTVLGIYLIAVGVVPYLPTMGLGLLLSVAAILAGVLILSGR* |
| Ga0075421_1002258213 | 3300006845 | Populus Rhizosphere | MKNIGRLGTTVLGIYLIAVGVVPYLPPMGVSMLVSVLAVVAGVLILLGR* |
| Ga0075421_1005422402 | 3300006845 | Populus Rhizosphere | MRPAAGRLGMTVLGIYLIAVGVVPYLPTIGLGLLLSVAAILAGVLILAGR* |
| Ga0075421_1005581513 | 3300006845 | Populus Rhizosphere | MRPSAGRLGMTVLGVYLIAVGVVPYLPLMGLGPLLSVAAIVAGVLILTGR* |
| Ga0075421_1026472831 | 3300006845 | Populus Rhizosphere | MKNIGRLGTTVLGVYLIAVGVVPYLPPMGVSMLVSVLA |
| Ga0075433_113301952 | 3300006852 | Populus Rhizosphere | TTVLGVYLIAVGVVPYLPPMGISMLVSVLAIVAGVLILLGR* |
| Ga0075425_1017782711 | 3300006854 | Populus Rhizosphere | MNNIPGTAHVGKLGATLLGVYLIAIGVVPYLPAMGISMLVSVLAIVTGIVILIGR* |
| Ga0075434_1004927993 | 3300006871 | Populus Rhizosphere | MRTAGRLGMTVLGCYLIAVGIVPYLPFIGLGPLMSLAAIVAGVLILMGR* |
| Ga0099829_105876552 | 3300009038 | Vadose Zone Soil | MIVLGIYLIAVGLMPYVSFLHSLSPLLSLTAIVAGILILLGR* |
| Ga0099829_107177432 | 3300009038 | Vadose Zone Soil | MKNGIATAHVGRLGATLLGVYLIAIGIVPYLPAMGISMLVSVLAVVTGIVILIGR* |
| Ga0105095_100406232 | 3300009053 | Freshwater Sediment | MTLLGIYLIAVGIVPYLPAFGLSSLVSLLAVATGVVILLGR* |
| Ga0099830_109480411 | 3300009088 | Vadose Zone Soil | LAKLADREADTMKAAGRLGMIVLGIYLIAVGLMPYVSFLHSLSPLLSLAAIVAGILILLGR* |
| Ga0099830_115813261 | 3300009088 | Vadose Zone Soil | MTVLGIYLIAIGILPYLPALSGLAPLLSLAAIVAGILILLGR* |
| Ga0099827_103606522 | 3300009090 | Vadose Zone Soil | MGRLGTTVLGVYLIAVGVVPYLPPMGISMLVSVLAIVAGVLILLGR* |
| Ga0075418_114909012 | 3300009100 | Populus Rhizosphere | MTVLGIYLIAVGVVPYLPTVGLGLLLSVAAILAGVLILSGR* |
| Ga0114129_107787983 | 3300009147 | Populus Rhizosphere | GRLGMTVLGIYLIAVGVVPYLPTIGLGLLLSVAAIVAGVLILTGR* |
| Ga0105094_103380531 | 3300009153 | Freshwater Sediment | MTLLGIYLIAVGIVPYLPAFGLSSLVSLLAVATGVVILMGR* |
| Ga0075423_117554692 | 3300009162 | Populus Rhizosphere | MKNIGRLGTTVLGVYLIAVGVVPYLPPMGISMLVSVLAIVAGVLILLG |
| Ga0105347_11922862 | 3300009609 | Soil | MTVLGVYLIAVGVVPYLPLMGLGPLLSVAAIVAGVLILTGR* |
| Ga0126376_113930452 | 3300010359 | Tropical Forest Soil | MKSRLTMTLLGVYLIAVGVVPYLPAVGLAPLVSLLAIVTGVLILIGR* |
| Ga0126376_122508481 | 3300010359 | Tropical Forest Soil | MRSIGRLGTTVLGVYLIAVGVVPYLPAIGLSMLVSVLAIVAGVLILLGR* |
| Ga0126372_119989641 | 3300010360 | Tropical Forest Soil | MTVLGIYLIAVGVAPYIFPMGFGPLIAVLAIVAGALILMGR* |
| Ga0126377_123191442 | 3300010362 | Tropical Forest Soil | MLRPAAGRLGMTVLGIYLIVVGVAPFVLPMGFGGLTALLAIVAGALILTGR* |
| Ga0134127_100060025 | 3300010399 | Terrestrial Soil | MTVLGIYLIAVGIVPYLPTIGLGPLLSVAAIVAGVLILSGR* |
| Ga0134122_103070871 | 3300010400 | Terrestrial Soil | MKNIGRLGTTVLGVYLIAVGVVPYVPPMGISMLVSVLAIVAGVLILLGR* |
| Ga0134122_116798061 | 3300010400 | Terrestrial Soil | MTVLGIYLIAVGIVPYLPPFGLSMLVSLAAIVAGMLILLGR* |
| Ga0134121_100116494 | 3300010401 | Terrestrial Soil | MTVLGIYLIAQGVFPYLPVLGLSPLLSVLAIVSGVLILMGR* |
| Ga0134121_121339051 | 3300010401 | Terrestrial Soil | IYLIAIGVVPYVLPSAVVLVSALAVVAGVLILLGR* |
| Ga0137393_107051582 | 3300011271 | Vadose Zone Soil | MTVLGVYLIAVGILPYLHALSGLAPLLSLAAIVAGILILLGR* |
| Ga0137393_109488822 | 3300011271 | Vadose Zone Soil | MIVLGIYLIAVGLMPYVSFLHSLSPLLSLAAIVAGILILLGR* |
| Ga0137431_10182201 | 3300012038 | Soil | SMRPSAGRLGMTVLGVYLIAVGVVPYLPLMGLGPLLSVAAIVAGVLILTGR* |
| Ga0137372_110040812 | 3300012350 | Vadose Zone Soil | MARNVGRLGTTVLGIYLIAVGVVPYLPPMGISTLVSVLAIVAGVLILLGR* |
| Ga0150984_1152621031 | 3300012469 | Avena Fatua Rhizosphere | NIGKLGTTVLGIYLIAVGVVPYLPPAGISMLVSVLAIVAGVLILLGR* |
| Ga0137394_104079512 | 3300012922 | Vadose Zone Soil | MKDIGRLGTTVLGIYLIAVGVVPYVLPSGVMLVSVLAILAGVLILLGR* |
| Ga0137416_115360392 | 3300012927 | Vadose Zone Soil | MTVLGIYLIAVGLFPYLPFLSGLAPLLSLAAIVAGILILLGR* |
| Ga0153915_120886352 | 3300012931 | Freshwater Wetlands | MTLLGIYLIAVGIVPYMGVVGLAYLVSLLAVAAGVLILLGR* |
| Ga0132258_100549747 | 3300015371 | Arabidopsis Rhizosphere | MTVLGIYLIAVGVVPYLPMMGLGPLLSVAAIVAGVLILTGR* |
| Ga0132258_106725732 | 3300015371 | Arabidopsis Rhizosphere | MRPAAGRLGMTVLGIYLIAVGIVPYLPTIGLGPLLSVAAIVAGVLILTGR* |
| Ga0132258_109202085 | 3300015371 | Arabidopsis Rhizosphere | MRPSAGRLGMTVLGIYLIAVGIVPYLPTIGLGPLLSVAAIV |
| Ga0132258_136706303 | 3300015371 | Arabidopsis Rhizosphere | MGMTVLGIYLIAVGIVPYLPTIGLGPLLSVAAIVAGVLILTGR* |
| Ga0132258_136998911 | 3300015371 | Arabidopsis Rhizosphere | MKNIGRLGTTVLGVYLIAVGVVPYLPAMGISMLVSVLAIVAGVLILL |
| Ga0132255_1043263411 | 3300015374 | Arabidopsis Rhizosphere | KSSRRSSMRPAAGRLGMTVLGIYLIAVGIVPYLPTIGLGPLLSVAAIVAGVLILTGR* |
| Ga0187785_102711122 | 3300017947 | Tropical Peatland | VKTRLTTTLLGVYLIAVGVLPYLAPLAPIGPLVSLLAIATGVLMLMGR |
| Ga0187779_106319132 | 3300017959 | Tropical Peatland | VKTKLTTTLLAVYLIAVGVLPYLAPLAPIAPLVSLLAIATGVLMLMGR |
| Ga0184615_100275224 | 3300018059 | Groundwater Sediment | MRSTRSLGMTVLGIYLIAVGIVPYLPPFGLATLVSVAAIVAGILILLGR |
| Ga0184637_100237472 | 3300018063 | Groundwater Sediment | MRAGMGRLGTTSLGVYLIAVGIVPFLPLFGLSSLLSLLAIVAGVLILMGR |
| Ga0184628_100808182 | 3300018083 | Groundwater Sediment | MRNMGKLGATVLGIYLIAVGILPYVPLGIPLIPVLAVVAGVLILMGR |
| Ga0184628_101596201 | 3300018083 | Groundwater Sediment | MRPAAGRLGMTVLGIYLIAVGVVPYLPMMGLGPLLSVAAIVAGVLILMGR |
| Ga0190274_129479421 | 3300018476 | Soil | MRNMGKLGATVLGIYLIAVGILPYVPLGIPLIPVLAVVAGVLILLGR |
| Ga0173482_104217791 | 3300019361 | Soil | MRPAAGRLGMTVLGIYLIAVGIVPYLPTIGLGPLLSVAAIVAGVLILSGR |
| Ga0173479_101901702 | 3300019362 | Soil | MKNIGQLSTTALGIYLIAIGVVPYVLPSAVVLVSALAVVAGVLILLGR |
| Ga0210399_1000001874 | 3300020581 | Soil | MKSAGRLGMTVLGIYLIAVGLFPYLTFLAGLAPLLSLAAIVAGILILLGR |
| Ga0210399_100137276 | 3300020581 | Soil | MKAAGRLGMIVLGIYLIAVGLMPYLSSLHSLSPLLSLAAIGAGILILLGR |
| Ga0210377_101218931 | 3300021090 | Groundwater Sediment | MKISGRLGMTLLGIYLIVVGVLPYLPLLGLGPLVSLLAIITGIVILLGR |
| Ga0210377_101690541 | 3300021090 | Groundwater Sediment | MKTSGKLGMTVLGIYLIAVGVLPYLPLLSGLGSLVSLTAILAGILILLGR |
| Ga0210405_101445762 | 3300021171 | Soil | MKSAGRLGMTVLGIYLIAVGILPYLPALSGLAPLLSLAAIIAGILILLGR |
| Ga0210409_110061312 | 3300021559 | Soil | MKSGGRLGMTVLGIYLIAIGILPYLPSLSGLAPLLSLAAIVAGILILLGR |
| Ga0247793_10660581 | 3300023066 | Soil | LGIYLIAVGIVPYLPTIGLGPLLSVAAIVAGVLILSGR |
| Ga0247800_11511452 | 3300023263 | Soil | MKDIGRLGTTVLGVYLIAVGVVPYLPPMGVSMLVSVLAIVAGVLILLGR |
| Ga0209109_101298302 | 3300025160 | Soil | MKTGGKLGTTLLGVYLIAVGVLPYLPLLSGLAPLASLLAIIAGIVILLGR |
| Ga0210142_10997272 | 3300025552 | Natural And Restored Wetlands | MRIRGLGRTVLGIYLIAVGVVPYLPFFSGLMPLVSLMAIVAGVLLLLERGR |
| Ga0207653_101643203 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNIGRLGTTVLGVYLIAVGVVPYLPPMGISMLVSVLAIVAGVLILLGR |
| Ga0207645_103865303 | 3300025907 | Miscanthus Rhizosphere | MKNIGRLGTTVLGDYLIAVGVVPYLPPMGISMLVSVLAIVAGVLILLGR |
| Ga0207669_105010233 | 3300025937 | Miscanthus Rhizosphere | YLIAVGIVPYLPTIGLGPLLSVAAIVAGVLILSGR |
| Ga0207678_107126741 | 3300026067 | Corn Rhizosphere | MKNIGRLGTTVLGVYLIAVGVVPYLPPMGISMLVSVLAIVAGVLI |
| Ga0207675_1008982451 | 3300026118 | Switchgrass Rhizosphere | MRPAAGRLGMTVLGIYLIAVGIVPYLPTIGLGLLLSVAAILAGVLILTGR |
| Ga0256867_100126413 | 3300026535 | Soil | MRPAAGRLGMTLLGIYLIAVGIVPYLPAIGLFSLVSLLAIAAGVLILLGR |
| Ga0209056_101435892 | 3300026538 | Soil | MRTMGRLGTTVLGVYLIAVAVVPYLPPMGVSVLVSILAFVAGILILVGR |
| Ga0209874_10316711 | 3300027577 | Groundwater Sand | MRPAAGRLGMTVLGFYLIAVGVAPYVPLLGIGPLLSVAAIVAGVSP |
| Ga0209011_11434462 | 3300027678 | Forest Soil | MRTMGRLGTTVLGVYLIAVGIVPYLPPMGVSMLVSVLAVAAGILILVGR |
| Ga0209813_101302501 | 3300027866 | Populus Endosphere | KNIGRLGTTVLGVYLIAVGVVPYLPPMGISMLVSVLAIVAGVLILLGR |
| Ga0209814_101518741 | 3300027873 | Populus Rhizosphere | MRPAAGRLGMTVLGIYLIAVGIAPYLFPIGLGPLLSVGAIVAGVLILMGR |
| Ga0209814_105001442 | 3300027873 | Populus Rhizosphere | VYLIAVGVVPYVLPSAVMLVSVLAIAAGVLILLGR |
| Ga0209590_102203352 | 3300027882 | Vadose Zone Soil | MRTMGRLGTTVLGVYLIAVGVVPYLPPMGISMLVSVLAIVAGVLILLGR |
| Ga0209382_100372394 | 3300027909 | Populus Rhizosphere | MKNIGRLGTTLLGVYLIAVGVVPYLPPVGASMLVSVLAIVAGIVILLGR |
| Ga0209382_101343704 | 3300027909 | Populus Rhizosphere | MKNIGRLGTTVLGIYLIAVGVVPYLPPMGVSMLVSVLAVVAGVLILLGR |
| Ga0209382_102966962 | 3300027909 | Populus Rhizosphere | MRPAAGRLGMTVLGIYLIAVGVVPYLPTIGLGLLLSVAAILAGVLILAGR |
| Ga0209382_107338461 | 3300027909 | Populus Rhizosphere | MRPSAGRLGMTVLGIYLIAVGVVPYLPTMGLGLLLSVAAILAGVLILSGR |
| Ga0209868_10269392 | 3300027947 | Groundwater Sand | MRPSAGRLGMTVLGVYLIAVGIVPYLPTIGLGPLLSVAAILAGVLILSGR |
| Ga0137415_108598942 | 3300028536 | Vadose Zone Soil | MRSAGRLGMTVLGIYLIAVGLFPYLPFLSGLAPLLSLAAIVAGILILLGR |
| Ga0307281_101145743 | 3300028803 | Soil | MRPSAGRLGMTVLGIYLIAVGVVPYLPLMGIGPLLSVAAIVAGVLILTGR |
| Ga0302263_102893571 | 3300028869 | Fen | PPGGAMQIRGLSKTVLGIYLIAVGVVPYLPLLSGLMPLVSLLAIVAGVLLLFERKR |
| Ga0222749_100392141 | 3300029636 | Soil | MKSAGRLGMTVLGIYLIAVGILPYLPALSGLAPLLSLAAIIAGILIL |
| Ga0311350_106526661 | 3300030002 | Fen | MQIRGLSKTVLGIYLIAVGVVPYLPLLSGLMPLVSLLAIVAGVLLLFERKR |
| Ga0299915_101067023 | 3300030613 | Soil | MRPGAARLGMTLLGIYLIAVGIVPYLPAFGLSSLVSLLAVAAGVVILLGR |
| Ga0302323_1005599172 | 3300031232 | Fen | IRGLSKTVLGIYLIAVGVVPYLPLLSGLMPLVSLLAIVAGVLLLFERKR |
| Ga0302323_1016738661 | 3300031232 | Fen | YLIAQGIFPYLPVLGLAPLLSVAAIVAGVLILMDR |
| Ga0310887_101472693 | 3300031547 | Soil | MRPSAGRLGMTVLGIYLIAVGIVPYLPTIGLGPLLSVAAIVAGVLILSGR |
| Ga0307469_111849702 | 3300031720 | Hardwood Forest Soil | MKSIGRLGTTVLGIYLIAMGIVPYMPPIGLSMLVSVLAILAGVLILLGR |
| Ga0307468_1005525991 | 3300031740 | Hardwood Forest Soil | MKNIGKLGTTVLGVYLIAVGVVPYLPPMGISMLVSVLAIVAGVLILLGR |
| Ga0326597_113759732 | 3300031965 | Soil | MRTTRSLGMTVLGIYLIAVGIVPYLPPIGLATLVSLAAIVAGILILLGR |
| Ga0310902_100957582 | 3300032012 | Soil | MRPAAGRLGMTVLGIYLIAVGVVPYLPMMGLGPLLSVAAIVAGVLILTGR |
| Ga0315912_100054383 | 3300032157 | Soil | MKTGGRLGTTLLGIYLVAVGVLPYLPLVAPISPLVSVLAIVAGILILSGR |
| Ga0307472_1019819891 | 3300032205 | Hardwood Forest Soil | TLLGVYLIAVGVLPYLGPLAPLAPLVSLLAIVTGVLILMGR |
| Ga0335070_100924262 | 3300032829 | Soil | MRPAAARLGMTLLGIYLIAVGIVPYLPAVGLASLVSRLAVVTGGVNQLGR |
| Ga0335070_102989872 | 3300032829 | Soil | MRPAAARLGMTLLGIYLIAVGIVPYLPAMGLSSLVSLLAIATGVVILLGR |
| Ga0335084_103200543 | 3300033004 | Soil | MRPAAARLGMTLLGIYLIAVGIVPYLPPFGLSSLVSLLAVVAGVLILLGR |
| Ga0335084_124478021 | 3300033004 | Soil | MRPSAGRLGMTVLGIYLIAVGVVPYLPPIGLAPLVSVAAILAGVLILSGR |
| Ga0316601_1008348382 | 3300033419 | Soil | MQIRGLSRTVLGIYLIAVGVVPYLPLLSGLMPLVSLMAIVAGVLLLFERKG |
| Ga0316601_1011437302 | 3300033419 | Soil | MQIRGLGKTVLGIYLIAVGVIPYLPYASGLMPLVSLLAVIAGVLLLLERKR |
| Ga0326726_119125221 | 3300033433 | Peat Soil | MRPAAARLGMTLLGIYLIAVGIVPYVAPNLVFLVSLLAVAAGVVILLGR |
| Ga0326726_120186182 | 3300033433 | Peat Soil | MQIRGLARTVLAIYLIAVGVVPYLPLVSSGLMPLVSLMAIVAGVLLLFERK |
| Ga0316620_102858962 | 3300033480 | Soil | MRPGAARLGMTLLGIYLIAVGIVPYLPAFGLSSLVSLLAVVAGVVILLGR |
| Ga0316620_120895052 | 3300033480 | Soil | MRIRGLGKTVLGIYLVAVGVVPYLPLLSGLAPLVSLLAIVAGVLILLERRT |
| Ga0316624_107352101 | 3300033486 | Soil | MRPGAARLGMTLLGIYLIAVGIVPYLPAFGLSSLVSLLAVVAGVVILL |
| Ga0316616_1047841172 | 3300033521 | Soil | GTMQIRGLSRTVLGIYLIAVGVVPYLPLVSSGLMPLVSLMAIVAGVLLLFERKR |
| Ga0314870_027346_1_123 | 3300033760 | Peatland | MRPAAARLGMTLLGIYLIAVGIVPYLPAVGLASLVSLLAVV |
| Ga0364932_0043419_876_1016 | 3300034177 | Sediment | MGRLGTTLLGVYLIAVGIVPFLPLFGLSSLLSLLAIVAGVLILMGR |
| ⦗Top⦘ |